Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_135701475632232214490.0
PYAP_17762147563483168903e-118
PYU1_G001735147563423177286e-94
PHYRA_81100147563493256782e-86
PYIR_13451147563593276768e-86
PHYSO_471523147563483256732e-85
PHYCA_556162147563513266402e-80
PPTG_17127147563513266383e-80
PITG_18456147563513256331e-79
PHALS_06478147563453236218e-78
PYIW_19971147563483256105e-76
PYVX_18171147562943206055e-76
PHYKE_8393147563262975346e-65
CCA18899147563433164634e-54
CCI45123147563013044133e-47
SPRG_06336147563353213203e-33
SDRG_01781147563353293178e-33
H310_09223147563331672705e-26
H257_06294147563581902635e-25
CCI451271609872022031502e-10
PYAR_154631526710911461010.002
H257_0309315267975971000.002
PYAP_18636152671009113990.003
H257_03361123428699120960.005
PYVX_1331215267101697960.006
CCA18023152671138146950.009
CCI46235152671155146940.010
PHYRA_82543152671199109940.012
H310_048431526796897930.013
SPRG_008901526788397890.037
SDRG_014071526781597890.042
PPTG_19371152671195109870.065
H310_070709639680124870.066
SDRG_14487123428964100870.066
PPTG_1915381951219140870.077
SPRG_02752123428831100850.12
PYIR_18382152671154109850.13
PYU1_G00884815267765109850.13
PITG_0993081951221117850.14
PITG_19213152671201109840.16
PYAR_2328616128607102840.16
PYIW_169871526782197840.16
PHYSO_54459815267116397840.17
PHYSO_48987281951240127840.18
PHYRA_7693181951212151810.36
H310_140199204683136800.43
CCI41909770028230790.43
H257_039319639695116800.45
SPRG_00889122518994145800.58
H257_030951395771086137800.58
CCA217152417782139790.64
CCA21860155078782139790.64
SDRG_0353112227225535770.69
PHALS_0409815267118329780.81
PHYRA_79281241780957780.85
PHYKE_66621526776529780.87
PHYCA_506137241781057780.88
PHALS_0354016904100771.2
PYIR_1449416819101771.3
H310_13911770036944761.4
SDRG_002761357731130761.5
PHYSO_48454116911124761.6
CCI458959511172145761.6
PYIR_16410823868948701.7
PYVX_1609581951137124761.7
PYU1_G0092499511258043761.7
HYAP_13690185337742751.9
CCI1048915870977779751.9
H257_05679770036745742.0
SDRG_01408122518916101752.1
HYAP_0445715267120348742.4
PYVX_145276030126942742.5
H310_027221483721879100742.7
PHYKE_5678241780957742.9
HYAP_1171317645417115733.3
HYAP_117121255455898733.3
H257_1622195112191121733.7
PHYSO_344112241781357733.8
PYU1_G01285918501183106733.9
HYAP_08026241779857724.1
PPTG_05519241781057724.2
SPRG_01740540416594704.2
PITG_1157895112131103724.4
PYAP_15706770027530714.6
SPRG_0036412227225534714.7
SDRG_07012770033145714.8
PITG_02762241781057724.8
PITG_0002016927100724.8
SPRG_13975770033145715.0
PYIW_1757181951330123725.1
PHALS_03645241783057725.1
PYIW_24869770026928705.5
SPRG_143129639661125715.6
SDRG_1477112554549124715.8
HYAP_0223081951195183716.0
PYIW_14856823868356656.5
CCI47145185339044706.7
H310_048421395771081107716.7
PYAP_15024540417097686.8
SPRG_0483112448371882707.1
PPTG_1171495112444228717.1
PYIR_1653981951346143717.4
PYIW_1961312330131464707.8
SDRG_0215412656882243707.8
H310_0545712227226933698.0
H310_0150412410821261688.7
PHYKE_8531770026928689.2
SDRG_0772112448372282699.4
SPRG_0921112554549124699.5
PYU1_G001268770026328689.7
PYAR_21583770023730689.8
PYVX_148517700227306810.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_13570

Length=322
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR_13570                                                            562        0.0   
PYAP_17762                                                            347        3e-118
PYU1_G001735                                                          285        6e-94 
PHYRA_81100                                                           265        2e-86 
PYIR_13451                                                            265        8e-86 
PHYSO_471523                                                          263        2e-85 
PHYCA_556162                                                          251        2e-80 
PPTG_17127                                                            250        3e-80 
PITG_18456                                                            248        1e-79 
PHALS_06478                                                           243        8e-78 
PYIW_19971                                                            239        5e-76 
PYVX_18171                                                            237        5e-76 
PHYKE_8393                                                            210        6e-65 
CCA18899                                                              182        4e-54 
CCI45123                                                              163        3e-47 
SPRG_06336                                                            127        3e-33 
SDRG_01781                                                            126        8e-33 
H310_09223                                                            108        5e-26 
H257_06294                                                            105        5e-25 
CCI45127                                                              62.4       2e-10 
PYAR_15463                                                            43.5       0.002 
H257_03093                                                            43.1       0.002 
PYAP_18636                                                            42.7       0.003 
H257_03361                                                            41.6       0.005 
PYVX_13312                                                            41.6       0.006 
CCA18023                                                              41.2       0.009 
CCI46235                                                              40.8       0.010 
PHYRA_82543                                                           40.8       0.012 
H310_04843                                                            40.4       0.013 
SPRG_00890                                                            38.9       0.037 
SDRG_01407                                                            38.9       0.042 
PPTG_19371                                                            38.1       0.065 
H310_07070                                                            38.1       0.066 
SDRG_14487                                                            38.1       0.066 
PPTG_19153                                                            38.1       0.077 
SPRG_02752                                                            37.4       0.12  
PYIR_18382                                                            37.4       0.13  
PYU1_G008848                                                          37.4       0.13  
PITG_09930                                                            37.4       0.14  
PITG_19213                                                            37.0       0.16  
PYAR_23286                                                            37.0       0.16  
PYIW_16987                                                            37.0       0.16  
PHYSO_544598                                                          37.0       0.17  
PHYSO_489872                                                          37.0       0.18  
PHYRA_76931                                                           35.8       0.36  
H310_14019                                                            35.4       0.43  
CCI41909                                                              35.0       0.43  
H257_03931                                                            35.4       0.45  
SPRG_00889                                                            35.4       0.58  
H257_03095                                                            35.4       0.58  
CCA21715                                                              35.0       0.64  
CCA21860                                                              35.0       0.64  
SDRG_03531                                                            34.3       0.69  
PHALS_04098                                                           34.7       0.81  
PHYRA_79281                                                           34.7       0.85  
PHYKE_6662                                                            34.7       0.87  
PHYCA_506137                                                          34.7       0.88  
PHALS_03540                                                           34.3       1.2   
PYIR_14494                                                            34.3       1.3   
H310_13911                                                            33.9       1.4   
SDRG_00276                                                            33.9       1.5   
PHYSO_484541                                                          33.9       1.6   
CCI45895                                                              33.9       1.6   
PYIR_16410                                                            31.6       1.7   
PYVX_16095                                                            33.9       1.7   
PYU1_G009249                                                          33.9       1.7   
HYAP_13690                                                            33.5       1.9   
CCI10489                                                              33.5       1.9   
H257_05679                                                            33.1       2.0   
SDRG_01408                                                            33.5       2.1   
HYAP_04457                                                            33.1       2.4   
PYVX_14527                                                            33.1       2.5   
H310_02722                                                            33.1       2.7   
PHYKE_5678                                                            33.1       2.9   
HYAP_11713                                                            32.7       3.3   
HYAP_11712                                                            32.7       3.3   
H257_16221                                                            32.7       3.7   
PHYSO_344112                                                          32.7       3.8   
PYU1_G012859                                                          32.7       3.9   
HYAP_08026                                                            32.3       4.1   
PPTG_05519                                                            32.3       4.2   
SPRG_01740                                                            31.6       4.2   
PITG_11578                                                            32.3       4.4   
PYAP_15706                                                            32.0       4.6   
SPRG_00364                                                            32.0       4.7   
SDRG_07012                                                            32.0       4.8   
PITG_02762                                                            32.3       4.8   
PITG_00020                                                            32.3       4.8   
SPRG_13975                                                            32.0       5.0   
PYIW_17571                                                            32.3       5.1   
PHALS_03645                                                           32.3       5.1   
PYIW_24869                                                            31.6       5.5   
SPRG_14312                                                            32.0       5.6   
SDRG_14771                                                            32.0       5.8   
HYAP_02230                                                            32.0       6.0   
PYIW_14856                                                            29.6       6.5   
CCI47145                                                              31.6       6.7   
H310_04842                                                            32.0       6.7   
PYAP_15024                                                            30.8       6.8   
SPRG_04831                                                            31.6       7.1   
PPTG_11714                                                            32.0       7.1   
PYIR_16539                                                            32.0       7.4   
PYIW_19613                                                            31.6       7.8   
SDRG_02154                                                            31.6       7.8   
H310_05457                                                            31.2       8.0   
H310_01504                                                            30.8       8.7   
PHYKE_8531                                                            30.8       9.2   
SDRG_07721                                                            31.2       9.4   
SPRG_09211                                                            31.2       9.5   
PYU1_G001268                                                          30.8       9.7   
PYAR_21583                                                            30.8       9.8   
PYVX_14851                                                            30.8       10.0  

>PYAR_13570
Length=322

 Score = 562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/322 (100%), Positives = 322/322 (100%), Gaps = 0/322 (0%)

Query  1    MNILHLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGA  60
            MNILHLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGA
Sbjct  1    MNILHLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGA  60

Query  61   QKKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTK  120
            QKKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTK
Sbjct  61   QKKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTK  120

Query  121  SLFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTS  180
            SLFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTS
Sbjct  121  SLFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTS  180

Query  181  GFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHSPVKS  240
            GFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKS
Sbjct  181  GFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKS  240

Query  241  KQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQVERVG  300
            KQSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVG
Sbjct  241  KQSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVG  300

Query  301  DALAHINERVQNQTKKADSAVL  322
            DALAHINERVQNQTKKADSAVL
Sbjct  301  DALAHINERVQNQTKKADSAVL  322

>PYAP_17762
Length=348

 Score = 347 bits (890),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 245/316 (78%), Gaps = 17/316 (5%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            SWRVR+LVLNGADL VSY+DSK+VART GA PKGSFYLSSVEKHEY VGVLGAQ+KPFGF
Sbjct  45   SWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGF  104

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            KMVGHAPRKGYVELDIFVE+ GDL KWLEVCQ+AL AAKKLTR+G  +A + KSLFGFSP
Sbjct  105  KMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSP  164

Query  128  ATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAE  187
            ATSPQ+Q++K++A+KE++LKQAI+EIESAKL+GR ACQEI +QG               E
Sbjct  165  ATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQG---------------E  209

Query  188  KLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHSPVKSKQsalss  247
            +LDHI  EL  V+ DLDY DKLL H+K+P L++FSSDARD+   +    P      +  S
Sbjct  210  RLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVS  269

Query  248  aaradalGQGVERASG--EMSDMerlalllgeleaqatllNEEAVRGTTQVERVGDALAH  305
                 A+      A G   +SD+ERLA LLGELE QATLLNEEA++GT QVERVG+ LAH
Sbjct  270  EETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAH  329

Query  306  INERVQNQTKKADSAV  321
            +NERV+ QT+KA++++
Sbjct  330  VNERVKAQTRKANASI  345

>PYU1_G001735
Length=342

 Score = 285 bits (728),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 226/317 (71%), Gaps = 20/317 (6%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            SWRVRYLV NGADL VSYF+S+D A  PG  PKGSFY+SSVEKHEY +GV+G ++KPFGF
Sbjct  37   SWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGF  96

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            K+VGHAP KGY+ELDIFVES  D+ KWLEV Q+AL AAKKLTR G++D  STKS+FGF  
Sbjct  97   KLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD--STKSMFGFGA  154

Query  128  ATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAE  187
            + SPQ Q++KL+A+KEELL++A+ EIE AKL+GREA  EIV QG               E
Sbjct  155  SISPQLQVKKLAATKEELLREALREIEGAKLIGREAVNEIVSQG---------------E  199

Query  188  KLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHSPVKSKQsalss  247
            KLD +E++L  V+ DLD+ DKLL HLKSP+L++FS+D R K  A  A +   S  ++ ++
Sbjct  200  KLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKGAPTAATASASGGASATT  259

Query  248  aaradalGQ---GVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQVERVGDALA  304
            +  +   GQ    +    G ++D+E LAL L ELE QA L+N EA R T Q+ R+ + L 
Sbjct  260  SPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQANLMNAEAARSTEQIARIEERLT  319

Query  305  HINERVQNQTKKADSAV  321
             +N+RVQ+QTKKA + +
Sbjct  320  SVNDRVQHQTKKATATM  336

>PHYRA_81100
Length=349

 Score = 265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 227/325 (70%), Gaps = 29/325 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGA---SPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWRVR+LVL G++L +SY++S+     P A   +PKGSFYLSS+E HEYVVGV+GA  KP
Sbjct  36   SWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKP  95

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122
            FGFKM+GHAP+KGYVELD+FVE++GD  KWLEV ++AL+A ++LTR  +  + S+  K+L
Sbjct  96   FGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNL  155

Query  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            FGF       P  +PQKQ+Q L+ +K+ELL  A+ +IE+AKL+GREAC EIV+QG     
Sbjct  156  FGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQG-----  210

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHS  236
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++AS  HS
Sbjct  211  ----------EKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTASKGHS  260

Query  237  PVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQV  296
            P +S+QS  S +    A+ + +  A   +SD+ERLA  LGELE QA +LN EA R T Q+
Sbjct  261  PQRSQQSGGSPSRLPPAM-ETINDAG--VSDLERLAQALGELEVQAEILNGEAGRSTQQI  317

Query  297  ERVGDALAHINERVQNQTKKADSAV  321
            ERV   L+++  RV+ QTK+A + +
Sbjct  318  ERVEHQLSNVTARVEKQTKQASATL  342

>PYIR_13451
Length=359

 Score = 265 bits (676),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 228/327 (70%), Gaps = 28/327 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGAS-------PKGSFYLSSVEKHEYVVGVLGA  60
            SWRVRYLV NGA+L V+Y++S+D ++   +S       PKGSFY+SSVEKHEY VGV+G 
Sbjct  42   SWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGG  101

Query  61   QKKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS-GLSDAAST  119
            ++KPFGFK+VGHAP+KGY+ELDIFVES GDL KW+EV Q+AL AAKK +R+ G  D ++T
Sbjct  102  REKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT  161

Query  120  KSLFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLT  179
            K++FGFS + SPQ Q++KL+A+KE+LL+ A+ EIE AKL+GREA  EIVVQG        
Sbjct  162  KTMFGFSASASPQLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQG--------  213

Query  180  SGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNS----ASPAH  235
                   EKLD +ES+L +V+ DLD+ DKLL H+K P+L+LFS D R K S     +  H
Sbjct  214  -------EKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSPHTGGASGH  266

Query  236  SPVKSKQsalssaaradalGQGVE-RASGEMSDMerlalllgeleaqatllNEEAVRGTT  294
            +   S      +     A GQ +  + +  +SD+E+LAL LGELE QA L+N EAV+ T 
Sbjct  267  TDRASHGQTPGTTNGGTAGGQQIHGQRNDALSDLEKLALALGELEEQANLMNAEAVKSTE  326

Query  295  QVERVGDALAHINERVQNQTKKADSAV  321
            Q+ RV   L  +N+RVQ QTKKA++ +
Sbjct  327  QIARVEQRLTAVNDRVQTQTKKANATM  353

>PHYSO_471523
Length=348

 Score = 263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 219/325 (67%), Gaps = 30/325 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPG---ASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWRVR+LVL+G++L VSY++S+     P    ++PKGSFYLSS+E HEYVVGV+GA +KP
Sbjct  36   SWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKP  95

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122
            FGFKMVGHAPRKGYVELD+FVE+  D  KWLEV ++AL+A ++LTR  +  + S   K+L
Sbjct  96   FGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNL  155

Query  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            FGF+      P  SPQKQ+Q L+ S++ELL  A+ +IE+AK +GREAC EIV QG     
Sbjct  156  FGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQG-----  210

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHS  236
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K SAS A S
Sbjct  211  ----------EKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKASASKASS  260

Query  237  PVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQV  296
            P +S+QS                     +SD+ERLA  LGELE QA LLN EA RGT Q+
Sbjct  261  PQRSQQSGRPPRLPPAMDSIN----DAGVSDLERLAQALGELEVQAELLNGEAGRGTQQI  316

Query  297  ERVGDALAHINERVQNQTKKADSAV  321
            ER+   L+++  RV+ QTK+A +A+
Sbjct  317  ERIEHQLSNVTARVEKQTKQASAAL  341

>PHYCA_556162
Length=351

 Score = 251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 168/326 (52%), Positives = 224/326 (69%), Gaps = 29/326 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVAR-TPG--ASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWRVR+LVL+G++L V+Y++S+     T G  + PKGSFYLSS+E HEYVVGV+GA  KP
Sbjct  36   SWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKP  95

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122
            FGFKMVGHAP+KGYVELD+FVE+ GD  KWLEV ++AL+A ++LTR  +  + S   K+L
Sbjct  96   FGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNL  155

Query  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            FGFS      PA SPQKQ+Q L+ +K++LL  A+ +IE+AK +GREAC EIV+QG     
Sbjct  156  FGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQG-----  210

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKN-SASPAH  235
                      EKLD IE +L  +D DLD+GDKLL  LKSP L++FS+D+R K+ S+S A+
Sbjct  211  ----------EKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPKSTSSSKAN  260

Query  236  SPVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQ  295
            SP +S+QS  SS  R     +   R     SD+ERLA  LGELE QA LLN+EA   T Q
Sbjct  261  SPQRSQQSGGSSPTRLAQAAES--RIDPGASDLERLAQALGELELQAELLNDEAGHSTQQ  318

Query  296  VERVGDALAHINERVQNQTKKADSAV  321
            ++ +   L+ +  RV+ QTK+A + +
Sbjct  319  IQTIEHHLSTVTGRVEKQTKQASATL  344

>PPTG_17127
Length=351

 Score = 250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 166/326 (51%), Positives = 219/326 (67%), Gaps = 29/326 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPG---ASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWRVR+LV++G++L VSY++S+     P    ++PKGSFYLSS+E HEYVVGV+GA  KP
Sbjct  36   SWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKP  95

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122
            FGFKMVGHAP+KGYVELD+FV++  D  KWLEV ++AL+  ++LTR  +  + S   K+L
Sbjct  96   FGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTL  155

Query  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            FGFS      PA SPQKQ+Q L+ SK+ELL +A+ E+E+AKL+GREAC EIV+QG     
Sbjct  156  FGFSVALSPQPAMSPQKQMQTLAKSKDELLSEALRELEAAKLVGREACNEIVIQG-----  210

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNS-ASPAH  235
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++  S   
Sbjct  211  ----------EKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTGGSKGS  260

Query  236  SPVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQ  295
            SP +  QS  SS +R          A G  SD+ERLA  LGELE QA +LN EA   + Q
Sbjct  261  SPQRFHQSGGSSPSRLPPAFDTSSDAGG--SDLERLAQALGELEVQAEMLNGEASHSSQQ  318

Query  296  VERVGDALAHINERVQNQTKKADSAV  321
            +ER+   L ++  RV+ QTK+A + +
Sbjct  319  IERIEHHLTNVTTRVEKQTKQASATL  344

>PITG_18456
Length=351

 Score = 248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 217/325 (67%), Gaps = 27/325 (8%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTP---GASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWRVR+LV++G++L VSY++S+     P    ++PKG FYLSS+E HEYVVGV+GA  KP
Sbjct  36   SWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKP  95

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122
            FGFKMVGHAP+KGYVELD+FV++  D  KWLEV ++AL A ++LTR  +  + S   K+L
Sbjct  96   FGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNL  155

Query  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            FGFS      PA SPQKQIQ LS SK+ELL QA+ E+E+AKL+GREAC EIVVQG     
Sbjct  156  FGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQG-----  210

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHS  236
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++ S   S
Sbjct  211  ----------EKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTGSSKGS  260

Query  237  PVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQV  296
              +    +  S+         +   +G +SD+ERLA  LGELE QA LLN EA R + Q+
Sbjct  261  SPQRSHQSGGSSPTRLPPALEISSDAG-VSDLERLAQALGELEVQAELLNGEAGRSSQQI  319

Query  297  ERVGDALAHINERVQNQTKKADSAV  321
            ER+   L ++  RV+ QTK+A + +
Sbjct  320  ERIEHHLTNVTTRVEKQTKQASATL  344

>PHALS_06478
Length=345

 Score = 243 bits (621),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 208/323 (64%), Gaps = 37/323 (11%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGAS---PKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWRVR+LVL+G++L V+Y++S+     P      PKGSFYLS++E HEYV+GV+GA  +P
Sbjct  36   SWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRP  95

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122
            FGFKMVGHAPRKG+VELD+FVE++ D  KWLEV  +AL A ++LTR  +  + S   K L
Sbjct  96   FGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKL  155

Query  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            FGFS      P  SPQKQ+Q L+ SKE LL +A+ EIE+AKL+GREAC EIV QG     
Sbjct  156  FGFSVPSSTQPVMSPQKQMQTLATSKEGLLLEALREIEAAKLVGREACNEIVNQG-----  210

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSAS--PA  234
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+ FS D R K      P 
Sbjct  211  ----------EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPH  260

Query  235  HSPVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTT  294
            HS   S    + +          + R +G +SD++RLA  LGELE QA LLN E+   + 
Sbjct  261  HSGSTSPSRLIPAIE--------ITRDAG-VSDLQRLAQALGELEVQAELLNSESGHSSQ  311

Query  295  QVERVGDALAHINERVQNQTKKA  317
            Q+ER+   L+H+ ERV+ QTK+A
Sbjct  312  QIERIEHHLSHVTERVEKQTKQA  334

>PYIW_19971
Length=348

 Score = 239 bits (610),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 215/325 (66%), Gaps = 33/325 (10%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            SWRVRYLV N      +   +        A+PKGSF++SSVEKHEY VGV+G ++KPFGF
Sbjct  40   SWRVRYLVFN-----GADLQAAGGGGASPATPKGSFFVSSVEKHEYWVGVMGGREKPFGF  94

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS-GLSDAASTKSLFGFS  126
            K+VGHAP+KGY+ELDIFVE+ GDL KW+EV Q+AL AAKK TR+ G +D+++TK++FGFS
Sbjct  95   KLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFS  154

Query  127  PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHA  186
               SPQ Q++KL+A+KEELL+ A+ EIE AKL+GREA  +I  QG               
Sbjct  155  ATVSPQLQVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQG---------------  199

Query  187  EKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHSPVKSKQsals  246
             KL+ IE +L +V++DLD+G KLL+H+K P+L+LFS+D R K +A   HS   S      
Sbjct  200  GKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNAH--HSGSHSDHKDGH  257

Query  247  saaradalGQGVERASGE----------MSDMerlalllgeleaqatllNEEAVRGTTQV  296
            S A   + G   E A+G           MSD+ERL L LGELE QAT +N EAV+ T Q+
Sbjct  258  SGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQI  317

Query  297  ERVGDALAHINERVQNQTKKADSAV  321
             RV   L  +N+RVQ QTKKA + +
Sbjct  318  ARVEQRLTAVNDRVQAQTKKATATM  342

>PYVX_18171
Length=294

 Score = 237 bits (605),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 195/320 (61%), Gaps = 65/320 (20%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYV---VGVLGAQKKP  64
            SWRVRYLVL+GADL V+YF+SK  A   GA+ KG FYLSS++KH YV   +G +GAQ+KP
Sbjct  27   SWRVRYLVLDGADLRVAYFESK-TAFQNGAASKGEFYLSSIDKHAYVAGGMGAVGAQEKP  85

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSD---AASTKS  121
            FGFKMVGHAP+KGY ELDIFVE+  DL KWLEV  +AL +A  ++R    D   +A+TKS
Sbjct  86   FGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMSRKAAGDGGGSATTKS  145

Query  122  LFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSG  181
            LFGFS  TSPQ+Q++ +S SK+ELLK A+ E+E AKL+GREAC E+VVQG          
Sbjct  146  LFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREACTEMVVQG----------  195

Query  182  FSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHSPVKSK  241
                 EKLD IE+ L  +++DLDYGDKLL  LKSP+L+L + D R      P  SP K+ 
Sbjct  196  -----EKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR-----RPP-SPTKT-  243

Query  242  QsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNEEAVRGTTQVERVGD  301
                         G G  RA+ E                            T Q+ R+ +
Sbjct  244  ---------LSNAGDG--RAALEQLS-------------------------TQQIARIEE  267

Query  302  ALAHINERVQNQTKKADSAV  321
             L  +N+RVQ QTK+A S +
Sbjct  268  RLTTVNDRVQRQTKQATSGI  287

>PHYKE_8393
Length=326

 Score = 210 bits (534),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 148/297 (50%), Positives = 191/297 (64%), Gaps = 28/297 (9%)

Query  36   GASP--KGSFYLSSVEKHEYVVGVLGAQKKPFGFKMVGHAPRKGYVELDIFVESRGDLAK  93
            G +P  KGSFYLS++  HEYVVGV+GA  KPFGFKMVGHAPRKGYVELD+FVE+  D  K
Sbjct  40   GETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNK  99

Query  94   WLEVCQHALAAAKKLTRSGLSDAAST--KSLFGF------SPATSPQKQIQKLSASKEEL  145
            WLEV ++AL A +++ R  +  + S   K +FGF       P   PQKQIQ L+ +KEEL
Sbjct  100  WLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEEL  159

Query  146  LKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAEKLDHIESELQRVDADLDY  205
            L +A+ E+E+AK++GREAC EIVVQG               EKLD +E +L  +D DLD+
Sbjct  160  LAEALRELEAAKMVGREACNEIVVQG---------------EKLDSVEHDLHAIDRDLDF  204

Query  206  GDkllshlkspllylFSSDARDKNSA-SPAHSPVKSKQsalssaaradalGQGVERASGE  264
            GDKLL  LK+P L+LFS D R K+ A S   SP ++ QSA S+             A  +
Sbjct  205  GDKLLRRLKNPTLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDA--D  262

Query  265  MSDMerlalllgeleaqatllNEEAVRGTTQVERVGDALAHINERVQNQTKKADSAV  321
             SD+ERLA  LGELE QA LLN EA R T Q+ R+   L+++  RV+ QTK+A + +
Sbjct  263  ASDLERLAHALGELELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATL  319

>CCA18899
Length=343

 Score = 182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 186/316 (59%), Gaps = 25/316 (8%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVG--VLGAQK-KP  64
            SWRVRYLV++G ++ VSY++SKD +++  A+PKGSF L S EKHEY +   V G+ K KP
Sbjct  31   SWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQSAEKHEYWISQMVTGSVKEKP  90

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSG-LSDAASTKSLF  123
            FGFKMVGHAP++GY+ELD+FV+S  D+ +WL+V  + L A+K + R   +++  +TKS+ 
Sbjct  91   FGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMAREAFMAEMDTTKSVL  150

Query  124  GFS-PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGF  182
            GFS   T+ ++QIQ L + K + + +A+ +IE AK  G  AC EIV QG  + G++    
Sbjct  151  GFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQG-EQLGKVEQNL  209

Query  183  SLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFSSDARDKNSASPAHSPVKSKQ  242
            S     L+H E  ++ +   L Y               F S +R  + A+ + S    + 
Sbjct  210  STIQNDLNHSEKLIKSIRHPLRY---------------FFSRSRPHDRATISKSSSIHRS  254

Query  243  salssaaradalGQGVERASGEM----SDMerlalllgeleaqatllNEEAVRGTTQVER  298
                         + V+  + E+    +D+E+LA+ L +LE QA L+N EAV+   Q+ R
Sbjct  255  HHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQIAR  314

Query  299  VGDALAHINERVQNQT  314
            +   L+ IN+R+Q QT
Sbjct  315  IEGQLSGINDRIQAQT  330

>CCI45123
Length=301

 Score = 163 bits (413),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 115/304 (38%), Positives = 186/304 (61%), Gaps = 26/304 (9%)

Query  21   LCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVG--VLGAQK-KPFGFKMVGHAPRKG  77
            + VSY++SKD  +   A+PKGSF L +VEKHEY +   V G+ K +PFGFKMVGHAP++G
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  78   YVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSG-LSDAASTKSLFGFSPA-TSPQKQI  135
            YVELD+FV+S  ++ +WL+V  + L A K++ R   +++  +TK + GFS A T+ ++Q+
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120

Query  136  QKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAEKLDHIESE  195
            ++L + K + + +A+ +IE AK  G  AC EIV QG               E+L  +E  
Sbjct  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQG---------------EQLGKVEQN  165

Query  196  LQRVDADLDYGDkllshlkspllylFS-SDARDKNSASPAHSPVKSKQsalssaaradal  254
            L  +++DL++ +KL+  ++ PL Y FS +   +K++ S  ++  +S              
Sbjct  166  LSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKND  225

Query  255  GQGVERASGEM----SDMerlalllgeleaqatllNEEAVRGTTQVERVGDALAHINERV  310
            G+ +E  + E+    +D+E+LA+ L ELE QA L+N EAV+   Q+ R+   L+ IN+R+
Sbjct  226  GK-IEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRI  284

Query  311  QNQT  314
            Q+QT
Sbjct  285  QSQT  288

>SPRG_06336
Length=335

 Score = 127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/321 (33%), Positives = 167/321 (52%), Gaps = 29/321 (9%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            + SWR RY+VL+G  L VSY+DSK + ++     KGSF L+ +EKH+Y     G   KP+
Sbjct  24   MKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY--SDEGGGVKPY  81

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125
            GFK+VGHAP  GY E  ++VE+  D  +WLEV  +AL   K +T     D  ++  L   
Sbjct  82   GFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTPQASVDQRASALLGHR  139

Query  126  SPA---TSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGF  182
            +P+   TS   Q++ ++ +KEELL++AI  +E A+ +G     E+               
Sbjct  140  APSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM---------------  184

Query  183  SLHAEKLDHIESELQRVDADLDYGDkllshlkspllylF-SSDARDKNSASPAHSPVKSK  241
              +AE LD  E+ +  V+ +LD GD ++  + SP  Y F SS ++ K + SP     +S 
Sbjct  185  GHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSKSARSH  244

Query  242  QsalssaaradalGQG-VERASGEMSD-----MerlalllgeleaqatllNEEAVRGTTQ  295
            Q      +       G   +A G  +D     +++L+ +L  LE  A  ++ E  R T Q
Sbjct  245  QPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVERTTEQ  304

Query  296  VERVGDALAHINERVQNQTKK  316
            ++R+   +   +ER+  Q+ K
Sbjct  305  IDRIQKKMVEADERIVEQSAK  325

>SDRG_01781
Length=335

 Score = 126 bits (317),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 106/329 (32%), Positives = 160/329 (49%), Gaps = 45/329 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            + SWR RY+VL+G  L VSYFDSK + ++     KGSF L+ +EKH+Y     G   KP+
Sbjct  24   MKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY--SDEGGGVKPY  81

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125
            GFK+VGHAP  GY E  ++VE+  D  +WLEV  +AL   K +     +D  +T +L G 
Sbjct  82   GFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVAPQASADQRAT-ALLGH  138

Query  126  SPA----TSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSG  181
              A    TS   Q++ ++ +KEELL++AI  +E A+ +G     E+              
Sbjct  139  RAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM--------------  184

Query  182  FSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylF--------------SSDARD  227
               +AE LD  E+ +  V  +LD GD ++  + SP  Y F              S  AR 
Sbjct  185  -GHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARS  243

Query  228  KNSASPAHSPVKSKQsalssaaradalGQGVERASGEMSDMerlalllgeleaqatllNE  287
                +P +SP   K     S   +   G   +    E+  +   + +L  LE  A  ++ 
Sbjct  244  HLPQTPMNSPTNKKP----SGPTSKTGGPTTDAGDDELDQL---SKILASLEVHANTIST  296

Query  288  EAVRGTTQVERVGDALAHINERVQNQTKK  316
            E  R T Q++R+   +   +ERV  Q+ K
Sbjct  297  EVERTTEQIDRIQKKMVEADERVVEQSAK  325

>H310_09223
Length=333

 Score = 108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 92/167 (55%), Gaps = 7/167 (4%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            + +W+ RY+VL+G  L V+Y+DSK++ ++ G  PKGSF LS  EK +  +   G   KPF
Sbjct  24   MKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGSFVLSECEKQD--LSDEGGSVKPF  80

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSD--AASTKSLF  123
            GFK +GH P +GY E  +FVE++ D  KWL V  +AL     +    +     A  K   
Sbjct  81   GFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPSMESHGGAGHKESA  140

Query  124  GFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQ  170
            G     S + QI+ +  +  ELL+QAI++ + A  +G     E+  Q
Sbjct  141  GL--MISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQ  185

>H257_06294
Length=358

 Score = 105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 98/190 (52%), Gaps = 28/190 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            + SW+ RY+VLNG  L VSY+DSK++  + G  PKGSF LS  EK +  +   GA  KPF
Sbjct  24   MKSWKRRYMVLNGDTLLVSYYDSKEIYTSKG-HPKGSFVLSECEKQD--LSDEGASVKPF  80

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS----------GLSD  115
            GFK +GH P +GY E  ++VES+ D  KWL V  +AL       +S           L  
Sbjct  81   GFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQRIEEITGPLLP  140

Query  116  AASTK-----------SLFGFSPAT----SPQKQIQKLSASKEELLKQAIDEIESAKLMG  160
             AS +           +  G   +     S + Q++ +  + +ELL+QAI++ + A  +G
Sbjct  141  CASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELLQQAINDAKEADRIG  200

Query  161  REACQEIVVQ  170
                 E+V Q
Sbjct  201  DATVNEMVYQ  210

>CCI45127
Length=202

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 114/203 (56%), Gaps = 22/203 (11%)

Query  118  STKSLFGFSPA-TSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176
            +TK + GFS A T+ ++Q+++L + K + + +A+ +IE AK  G  AC EIV QG     
Sbjct  3    TTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQG-----  57

Query  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDkllshlkspllylFS-SDARDKNSASPAH  235
                      E+L  +E  L  +++DL++ +KL+  ++ PL Y FS +   +K++ S  +
Sbjct  58   ----------EQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNN  107

Query  236  SPVKSKQsalssaaradalGQGVERASGEM----SDMerlalllgeleaqatllNEEAVR  291
            +  +S              G+ +E  + E+    +D+E+LA+ L ELE QA L+N EAV+
Sbjct  108  TNHRSHHHQTGILHMRKNDGK-IEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVK  166

Query  292  GTTQVERVGDALAHINERVQNQT  314
               Q+ R+   L+ IN+R+Q+QT
Sbjct  167  SNDQITRIEGQLSGINDRIQSQT  189

>PYAR_15463
Length=1091

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 67/146 (46%), Gaps = 20/146 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y++SK+ AR+ G + +G   +S V    Y         K  
Sbjct  88   LPRWEERYLVLDGATL--TYYNSKEEARS-GRNLRGRMIISKVRPENY--------GKAH  136

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKK---LTRSGLSDAA--STK  120
            GF +      KG+    +   +  +   W+E+ Q A+    K   L RS LS AA  ST 
Sbjct  137  GFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAIDEGVKHNTLDRSLLSAAALTSTS  192

Query  121  SLFGFSPATSPQKQIQKLSASKEELL  146
            S  G    +  Q  ++    +  ELL
Sbjct  193  SASGAVQPSPTQVDLRSFYFAFRELL  218

>H257_03093
Length=975

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y++SKD ART G + +G   ++ V    Y       +   F
Sbjct  114  LPRWEERYLVLDGASL--TYYNSKDEART-GTNLRGRMIITKVLPENY------GKAHGF  164

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
              + +GH     +  L    E   D+  W+E+ Q A+
Sbjct  165  LIETMGHK----HFHLCCTTELEKDM--WVEMMQAAI  195

>PYAP_18636
Length=1009

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 17/113 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++K+ AR+ G + +G   +S V    Y       +   F
Sbjct  113  LPRWEERYLVLDGATL--TYYNTKEEARS-GRNLRGRMIISKVRPENY------GKAHGF  163

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL--AAAKKLTRSGLSDA  116
              + +GH     +  L    E   D+  W+E+ Q A+      KL RS +S A
Sbjct  164  LLETMGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVKHKLERSLISSA  210

>H257_03361
Length=699

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 63/120 (53%), Gaps = 23/120 (19%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHE-YVVGVLGAQKKP  64
            +PSW+ RYLVL+G +  +SYFD K+V+  P A  KGSF L+ V+ ++ Y  G+    K+ 
Sbjct  21   VPSWKKRYLVLSGQN--ISYFD-KEVSN-PRAKEKGSFVLAGVQPNKSYDNGMTLLSKE-  75

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFG  124
                  G A       ++I  ++ G+      +C++AL  A  L R  +S+ +   +  G
Sbjct  76   ------GKA-------MNITTKTVGEYV----MCKNALENAVSLPRRRVSNPSPAAAAAG  118

>PYVX_13312
Length=1016

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 47/97 (48%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYL+L+GA L  +Y++SKD AR+ G + +G   LS V    Y         K  
Sbjct  86   LPRWEERYLILDGAAL--TYYNSKDEARS-GRNLRGRMQLSRVRPENY--------GKAH  134

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
            GF +      +G+    +   +  +   W+E+ Q A+
Sbjct  135  GFLIE----TRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>CCA18023
Length=1138

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 62/146 (42%), Gaps = 18/146 (12%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++K+ AR+   + +G   +  V    Y         K  
Sbjct  135  LPRWEERYLVLDGATL--TYYNTKEEARS-ARNLRGKMMIVKVRPENY--------GKAH  183

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAS---TKSL  122
            GF +      KG+    +   +  +   W+E+ Q A+  A   + +      S   + + 
Sbjct  184  GFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNASHSFVSLHHSIAP  239

Query  123  FGFSPATSPQKQIQKLSASKEELLKQ  148
            F  SPAT  Q      S  +  LL Q
Sbjct  240  FDQSPATQSQPSGSDCSDPRTHLLVQ  265

>CCI46235
Length=1155

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 39/146 (27%), Positives = 63/146 (43%), Gaps = 17/146 (12%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++K+ AR+   + +G   +  V    Y         K  
Sbjct  130  LPRWEERYLVLDGATL--TYYNTKEEARS-ARNLRGKMMIVKVRPENY--------GKAH  178

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125
            GF +      KG+    +   +  +   W+E+ Q A+  A   + +  S  +   S+  F
Sbjct  179  GFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAVPFSNTTHSFVSLHHSIAPF  234

Query  126  --SPATSPQKQIQKLSASKEELLKQA  149
              SPAT       + S  +  LL Q 
Sbjct  235  EQSPATQSHPSGSECSDPRTILLVQV  260

>PHYRA_82543
Length=1199

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (48%), Gaps = 15/109 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYL+L+GA L  +Y++SK+ AR+   + +G   +S V    Y       +   F
Sbjct  71   LPRWEERYLILDGATL--TYYNSKEEARS-ARNLRGRMIISKVRPENY------GKAHGF  121

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLS  114
              +  GH     +  L    E   D+  W+E+ Q A+    + T+S +S
Sbjct  122  LLETQGHK----HFHLCCATELEKDM--WVEMMQAAIEEGVRHTQSSMS  164

>H310_04843
Length=968

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 48/97 (49%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y++SK+ ART G + +G   ++ V    Y       +   F
Sbjct  113  LPRWEERYLVLDGASL--TYYNSKEEART-GKNLRGRMIITRVLPENY------GKAHGF  163

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
              + +GH     +  L    E   D+  W+E+ Q A+
Sbjct  164  LIETMGHK----HFHLCCTTELEKDM--WVEMMQAAI  194

>SPRG_00890
Length=883

 Score = 38.9 bits (89),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 47/97 (48%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++KD AR+ G + +G   ++ V    Y         K  
Sbjct  41   LPRWEERYLVLDGASL--TYYNTKDEARS-GRNLRGRMIITRVLPENY--------GKAH  89

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
            GF +      KG+    +   +  +   W+E+ Q A+
Sbjct  90   GFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  122

>SDRG_01407
Length=815

 Score = 38.9 bits (89),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 47/97 (48%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++KD AR+ G + +G   ++ V    Y         K  
Sbjct  95   LPRWEERYLVLDGASL--TYYNTKDEARS-GRNLRGRMIITRVLPENY--------GKAH  143

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
            GF +      KG+    +   +  +   W+E+ Q A+
Sbjct  144  GFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  176

>PPTG_19371
Length=1195

 Score = 38.1 bits (87),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (46%), Gaps = 15/109 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYL+L+GA L  +Y++SK+ AR+   + +G   +S V    Y       +   F
Sbjct  81   LPRWEERYLILDGATL--TYYNSKEEARS-ARNLRGRMIISKVRPENY------GKAHGF  131

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLS  114
              +  GH     +  L    E   D+  W+E+ Q A+    +   S LS
Sbjct  132  LIETQGHK----HFHLCCTTELEKDM--WVEMMQAAIEEGVRHAHSRLS  174

>H310_07070
Length=680

 Score = 38.1 bits (87),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 16/124 (13%)

Query  5    HLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            HL +W+ R++VL G  +   Y+ S   +      P+G   LS V+ H   V      KK 
Sbjct  131  HLKNWKKRFMVLRGQSMF--YYVSGTTSEE--TYPRGVISLSGVDVHPLDVSKF---KKQ  183

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTK-SLF  123
            F F+ + H     Y  L +  ++  DL +W+     ++ +A    R G++D   +K  LF
Sbjct  184  FCFE-ISHP---NYRSLYMVAKNDADLVQWMS----SIKSASLPVRDGIADIRESKEQLF  235

Query  124  GFSP  127
               P
Sbjct  236  QLPP  239

>SDRG_14487
Length=964

 Score = 38.1 bits (87),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 54/100 (54%), Gaps = 21/100 (21%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            +P+W+ RY+VL G    ++Y+D K+V+  P A  KG+F L++VE+        G +    
Sbjct  17   MPTWKKRYMVLKGRH--IAYYD-KEVSN-PRAKEKGTFTLAAVER------TPGME---L  63

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAA  105
            G  + G+    G + + I+ ++ G+      +C +A+ AA
Sbjct  64   GLTLAGY---DGKI-MHIYTKTVGEFV----LCNNAMTAA  95

>PPTG_19153
Length=1219

 Score = 38.1 bits (87),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 32/140 (23%), Positives = 63/140 (45%), Gaps = 14/140 (10%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + YF S+D     G  P        + +   V+   G    PF F
Sbjct  158  NWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIVLDRSGGGHAPFRF  209

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            ++     R     L +  ESR +  +W++ CQ  LA A + ++  ++ + S+ S+ G   
Sbjct  210  QI-----RTDAHTLLLEAESRENQKRWIDSCQE-LADAIRASKFSVNTSMSSFSIDGRRS  263

Query  128  ATSPQKQIQKLSASKEELLK  147
            +      +  L A++++LL+
Sbjct  264  SLVRGTTVHTLRATEKDLLE  283

>SPRG_02752
Length=831

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 21/100 (21%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            +P+W+ RY+VL G    ++Y+D K+V   P A  KG+F L++VE+   +           
Sbjct  17   MPTWKKRYMVLKGRH--IAYYD-KEVTN-PRAKEKGTFTLAAVERTPAME---------L  63

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAA  105
            G  + G+    G + + I+ ++ G+      +C +A+ AA
Sbjct  64   GLTLAGY---DGKI-MHIYTKTVGEFV----LCNNAMTAA  95

>PYIR_18382
Length=1154

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 15/109 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++K+ AR+   + +G   +S V    Y         K  
Sbjct  139  LPRWEERYLVLDGAAL--TYYNTKEEARS-ARNLRGRMIISKVRPENY--------GKAH  187

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLS  114
            GF +      KG+    +   +  +   W+E+ Q A+    K + +G S
Sbjct  188  GFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNGSS  232

>PYU1_G008848
Length=765

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (47%), Gaps = 15/109 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++K+ AR+   + +G   +S V    Y         K  
Sbjct  144  LPRWEERYLVLDGAAL--TYYNTKEEARS-ARNLRGRMIISKVRPENY--------GKAH  192

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLS  114
            GF +      KG+    +   +  +   W+E+ Q A+    K + +G S
Sbjct  193  GFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNGNS  237

>PITG_09930
Length=1221

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 29/117 (25%), Positives = 53/117 (45%), Gaps = 14/117 (12%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + YF S+D     G  P        V +   V+   G    PF F
Sbjct  164  NWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------VTEDTIVLDRSGGGHAPFRF  215

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFG  124
            ++     R     L +  ESR +  +W++ CQ  LA A + ++  ++++ S+ S+ G
Sbjct  216  QI-----RTDAHTLLLEAESRENQKRWIDSCQE-LADAIRASKFAVNNSVSSFSMDG  266

>PITG_19213
Length=1201

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (46%), Gaps = 15/109 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYL+L+GA L  +Y++SK+ AR+   + +G   ++ V    Y       +   F
Sbjct  81   LPRWEERYLILDGATL--TYYNSKEEARS-ARNLRGRMIINKVRPENY------GKAHGF  131

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLS  114
              +  GH     +  L    E   D+  W+E+ Q A+    +   S LS
Sbjct  132  LIETQGHK----HFHLCCTTELEKDM--WVEMMQAAIEEGVRHAHSRLS  174

>PYAR_23286
Length=607

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 22/102 (22%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            SW+ RY VL G+   VSY+   D A +P   P     +  V++ +          +PFGF
Sbjct  402  SWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIEDVQRWD---------GEPFGF  450

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLT  109
              +       YV    + ++  +  KW+        A +KLT
Sbjct  451  MFMTSEQIPYYV----YADNERERTKWMN-------ALRKLT  481

>PYIW_16987
Length=821

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 46/97 (47%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+GA L  +Y+++K+ AR+   + +G   +S V    Y         K  
Sbjct  130  LPRWEERYLVLDGAAL--TYYNTKEEARS-ARNLRGRMIISKVRPENY--------GKAH  178

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
            GF +      KG+    +   +  +   W+E+ Q A+
Sbjct  179  GFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>PHYSO_544598
Length=1163

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 46/97 (47%), Gaps = 15/97 (15%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYL+L+GA L  +Y++SK+ AR+   + +G   +S V    Y       +   F
Sbjct  29   LPRWEERYLILDGATL--TYYNSKEEARS-ARNLRGRMIISKVRPENY------GKAHGF  79

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL  102
              +  GH     +  L    E   D+  W+E+ Q A+
Sbjct  80   LLETQGHK----HFHLCCSTELEKDM--WVEMMQAAI  110

>PHYSO_489872
Length=1240

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 55/127 (43%), Gaps = 21/127 (17%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + YF S+D     G  P        + +   V+   G    PF F
Sbjct  165  NWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIVLDRSGGGHAPFRF  216

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQH---ALAAAKKLTRSGLS----DAASTK  120
            ++     R     L +  ESR +  +W+E CQ    A+ A+K    + LS    DA++ +
Sbjct  217  QI-----RTDAQTLLLEAESRENQKRWIEACQELADAIRASKYSVNTSLSSFSMDASNRR  271

Query  121  -SLFGFS  126
             SL G S
Sbjct  272  SSLLGAS  278

>PHYRA_76931
Length=1212

 Score = 35.8 bits (81),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 34/151 (23%), Positives = 65/151 (43%), Gaps = 19/151 (13%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + YF S+D     G  P        + +   ++   G    PF F
Sbjct  163  NWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIILDRSGGGHAPFRF  214

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            ++     R     L +  ESR +  +W++ CQ  LA A + ++  ++ + S+ S+ G S 
Sbjct  215  QI-----RTEAQTLLLEAESRENQKRWIDSCQE-LADAIRASKFSVTTSMSSFSMDGRSS  268

Query  128  ATSPQKQIQKLSASKEELLKQAIDEIESAKL  158
                 +  ++ S        Q  DE ES+++
Sbjct  269  LRYMNRHTEETSHH-----SQNWDETESSQV  294

>H310_14019
Length=683

 Score = 35.4 bits (80),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 53/136 (39%), Gaps = 24/136 (18%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ RY  LNG +L   Y +       PGA PKG         +  VVGV    + P+  
Sbjct  185  NWKRRYFTLNGQEL--KYMEG------PGAKPKG---------YGMVVGVKKLHELPYAL  227

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
              +   P +    LD+  ES  +   W+   Q  L A   +  +              +P
Sbjct  228  S-ISIVPNR---TLDVQAESTDEQEAWM---QRILDACGHVAATTPPPPPVLHVTLSSAP  280

Query  128  ATSPQKQIQKLSASKE  143
            AT PQ+    L ++ E
Sbjct  281  ATPPQQLAASLQSTLE  296

>CCI41909
Length=282

 Score = 35.0 bits (79),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVARTP  35
           L SW  RY  LNG    ++YFDS+D++R P
Sbjct  61  LRSWPRRYFTLNGK--VLTYFDSEDISRPP  88

>H257_03931
Length=695

 Score = 35.4 bits (80),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 52/116 (45%), Gaps = 15/116 (13%)

Query  5    HLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            HL +W+ R++VL G  +   Y+ S     +    P+G   LS V+ H          KK 
Sbjct  121  HLKNWKKRFMVLRGQSMF--YYVSG--TSSEETFPRGVISLSGVDVHPLDTAKF---KKQ  173

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTK  120
            F F+ + H     Y  L +  ++  DL +WL     ++ +A    R G++D   +K
Sbjct  174  FCFE-ISHP---NYRSLYMVAKNEADLVQWLS----SIKSASLPVRDGVADVRESK  221

>SPRG_00889
Length=994

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 36/145 (25%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+G  L  +Y+  +  AR+ G + +G   L+        VG     KK  
Sbjct  133  LPRWEPRYLVLDGTTL--TYYSKQHDARS-GKNLRGRMVLT-------YVGPDFKSKKAH  182

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKK------------------  107
            GF +      KG+    +   +  +   W+E+ Q AL  A                    
Sbjct  183  GFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSASTKPPPPQDDFMSSPSY  238

Query  108  -LTRSG-LSDAASTKSLFGFSPATS  130
             L+RSG +   ++T+S  G+SPA+S
Sbjct  239  DLSRSGPVVPKSATRS--GYSPASS  261

>H257_03095
Length=1086

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (46%), Gaps = 31/137 (23%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSV-------EKHEYVVGVL  58
            LP W  RYLVL+G    + Y+   + AR  G + +G   L+ V       ++H +VV  +
Sbjct  127  LPRWESRYLVLDGT--VLRYYSKHEDARM-GKNLRGKMTLTHVSPEFHKKKEHTFVVETV  183

Query  59   GAQKKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHAL--AAAKKLTRSGLSDA  116
            G  +K F            Y+  D  +E   D+  W+E+ Q A+   +A +  R  LS  
Sbjct  184  G--RKVF------------YMSCDTELEK--DM--WVEMMQAAIGEGSAAQPQRPQLSTR  225

Query  117  ASTKSLFGFSPATSPQK  133
              + S F   P+T+P +
Sbjct  226  HGSPSPF-VVPSTTPHR  241

>CCA21715
Length=782

 Score = 35.0 bits (79),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 65/139 (47%), Gaps = 26/139 (19%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQK---KP  64
            SWR RY VL+G   C SY+ SK++A            ++  E++   V V GA++   + 
Sbjct  121  SWRYRYAVLSGT--CFSYYSSKEIA------------MADTERYRGRVTVTGAERDGSRT  166

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFG  124
             G  +     +   ++    +ES  DL  W+ +   A+A +     +GL  + +T SL  
Sbjct  167  NGVLIRTTVNKVFSIQTSSTIES--DL--WIRMISQAVANS-----TGLKTSLTTGSLLA  217

Query  125  FSPATSPQKQIQKLSASKE  143
             +  +S   + + ++ +K+
Sbjct  218  QTVRSSGDLKTRNMNVTKQ  236

>CCA21860
Length=782

 Score = 35.0 bits (79),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 65/139 (47%), Gaps = 26/139 (19%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQK---KP  64
            SWR RY VL+G   C SY+ SK++A            ++  E++   V V GA++   + 
Sbjct  121  SWRYRYAVLSGT--CFSYYSSKEIA------------MADTERYRGRVTVTGAERDGSRT  166

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFG  124
             G  +     +   ++    +ES  DL  W+ +   A+A +     +GL  + +T SL  
Sbjct  167  NGVLIRTTVNKVFSIQTSSTIES--DL--WIRMISQAVANS-----TGLKTSLTTGSLLA  217

Query  125  FSPATSPQKQIQKLSASKE  143
             +  +S   + + ++ +K+
Sbjct  218  QTVRSSGDLKTRNMNVTKQ  236

>SDRG_03531
Length=255

 Score = 34.3 bits (77),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  9   WRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSF  43
           W+ R+ VL G  L  SYF ++D A  PG +PKG+ 
Sbjct  33  WKRRFFVLEGRRL--SYFGNEDEANDPGRAPKGAI  65

>PHALS_04098
Length=1183

 Score = 34.7 bits (78),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 2/29 (7%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVART  34
            LP W  RYL+L+GA L  +Y++SK+ AR+
Sbjct  85   LPRWEERYLILDGATL--TYYNSKEEARS  111

>PHYRA_79281
Length=809

 Score = 34.7 bits (78),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 27/57 (47%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+T              EK    V V GA + P
Sbjct  115  SWRYRYAVLSGTTF--SYYVSKDVAKT------------DTEKFRGRVTVTGASRDP  157

>PHYKE_6662
Length=765

 Score = 34.7 bits (78),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 22/29 (76%), Gaps = 2/29 (7%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVART  34
            LP W  RYL+L+GA L  +Y++SK+ AR+
Sbjct  82   LPRWEERYLILDGATL--TYYNSKEEARS  108

>PHYCA_506137
Length=810

 Score = 34.7 bits (78),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 27/57 (47%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+T              EK    V V GA + P
Sbjct  116  SWRYRYAVLSGTTF--SYYVSKDVAKT------------DTEKFRGRVTVTGASRDP  158

>PHALS_03540
Length=904

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 21/100 (21%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ RY  L+GA LC  YF S +          G+   S    H     V+  + K    
Sbjct  799  NWKRRYFTLHGATLC--YFKSDN----------GALLRSFTVCH-----VVTLRTKRLCL  841

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKK  107
            ++     RK    L +  E++ DL +WL+    A+AA K+
Sbjct  842  EITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKQ  877

>PYIR_14494
Length=819

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 42/101 (42%), Gaps = 21/101 (21%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            + +W++RY  LNGA L  SYF S +                 + K   V  VL  + K F
Sbjct  727  IKNWKLRYFTLNGATL--SYFKSDN---------------GPLLKTLKVCHVLVMRTKKF  769

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAK  106
              ++   + RK    L I  ES  +  +WL     A++  K
Sbjct  770  CLEITTESGRK----LLIAAESNAEYERWLAALHQAVSTEK  806

>H310_13911
Length=369

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (64%), Gaps = 6/44 (14%)

Query  5   HLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSV  48
           HL +W  R+  L+G+ L  SY+DS+D++     +P+G   ++SV
Sbjct  38  HLKTWNRRFFALSGSTL--SYYDSEDIS----GAPRGILEVASV  75

>SDRG_00276
Length=731

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 59/130 (45%), Gaps = 6/130 (5%)

Query  80   ELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSPATSPQKQIQKLS  139
            E+    E  GD++K L V +   + ++K T   ++ A  T S    SP T P     K+ 
Sbjct  107  EMHSTFEHEGDVSKPLPVLKLDRSQSEK-TPLTITAATPTSSAATESPHTPPPLTPIKVP  165

Query  140  ASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRL---TSGFSLHAEKLDHIESEL  196
            A K  +L+  +DE+ +++     A      Q + KR  L   +S F +HA    +  S +
Sbjct  166  A-KRPVLRLKLDEMPTSQQAENRA-NRAANQLLAKRDALERESSAFGVHASNNHNPTSHM  223

Query  197  QRVDADLDYG  206
            QR   DL  G
Sbjct  224  QRAMMDLKLG  233

>PHYSO_484541
Length=911

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 21/124 (17%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ RY  L+G  LC  YF S +          G+   S    H     V+  + K    
Sbjct  794  NWKRRYFTLHGPTLC--YFKSDN----------GALLRSFTVCH-----VVTLRTKKLCL  836

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            ++     RK    L +  E++ DL +WL+    A+AA K+    G +    T+++    P
Sbjct  837  EITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKRKKHGGDAPQRKTETMATGMP  892

Query  128  ATSP  131
               P
Sbjct  893  LALP  896

>CCI45895
Length=1721

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 2/45 (4%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVAR--TPGASPKGSFYLSSV  48
            +PS R RY VL   D  + YF++K+ A     G+ P G F +++V
Sbjct  853  IPSMRKRYFVLQSVDPTLRYFETKEDAEGFECGSKPLGEFQVANV  897

>PYIR_16410
Length=89

 Score = 31.6 bits (70),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query  44  YLSSVEKHEYVVGVLGAQKKPFGFKMVGHAPRKGYVELDIFVESR-GD  90
           ++ S  + EY+V + G Q+ PF  +   HA +  YVE  +  + R GD
Sbjct  36  HVKSTGRSEYIVTIFGQQRSPFQRRASRHARQISYVEPKLNTKLRQGD  83

>PYVX_16095
Length=1137

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 50/124 (40%), Gaps = 16/124 (13%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + YF S++     G          +V +   V+    A   P+ F
Sbjct  107  NWKTRFFILRRDFPSLCYFTSEEKLELLGEI--------AVTEDTLVLDRSSAGHAPYRF  158

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            ++     R     L +  ESR D  +W+E CQ    A + L     S +++  SLF   P
Sbjct  159  QV-----RSEDKALLLEAESRDDQRRWMESCQELADALRALK---FSHSSAGNSLFALHP  210

Query  128  ATSP  131
               P
Sbjct  211  RDRP  214

>PYU1_G009249
Length=2580

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  6     LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSV  48
             +PS R RY VL      + Y+ + + +R P  +P GSF + +V
Sbjct  1189  IPSMRKRYCVLLKRGNTLEYYATHEDSRNPSVAPHGSFRVDTV  1231

>HYAP_13690
Length=377

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 6/42 (14%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVE  49
            SW+ RY VL G+ L  SYF+S+D     GA+ KG  ++ +VE
Sbjct  149  SWKRRYFVLRGSVL--SYFNSEDT----GAAAKGYGHVRAVE  184

>CCI10489
Length=777

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 37/79 (47%), Gaps = 7/79 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEY-VVGVLGAQKKPFG  66
            SWR R+ VL+G   C+SY+ SK+VA       +G   +++    E    GVL        
Sbjct  119  SWRHRFAVLSGT--CLSYYTSKEVAMLNTEKYRGRVTVTAARNDETRSCGVLITTTINKT  176

Query  67   FKMVGHAPRKGYVELDIFV  85
            F +    P    VE DI+V
Sbjct  177  FIIYTRTP----VERDIWV  191

>H257_05679
Length=367

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 28/45 (62%), Gaps = 6/45 (13%)

Query  5   HLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVE  49
           HL +W  R+  L+G+ L  SY+DS+D++     +P+G   ++SV 
Sbjct  40  HLKTWNRRFFALSGSTL--SYYDSEDIS----GAPRGVLDVASVH  78

>SDRG_01408
Length=916

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 45/101 (45%), Gaps = 14/101 (14%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            LP W  RYLVL+G  L  +Y+  +  AR+ G + +G   L+        VG     KK  
Sbjct  135  LPRWEPRYLVLDGTTL--TYYSKQHDARS-GKNLRGRMVLT-------YVGPDFKGKKAH  184

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAK  106
            GF +      KG+    +   +  +   W+E+ Q AL  A 
Sbjct  185  GFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEAN  221

>HYAP_04457
Length=1203

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEY  53
            LP W  RYL+L+G  L  +Y++SK+ AR+   + +G   L  V    Y
Sbjct  72   LPRWEERYLILDGPTL--TYYNSKEDARS-ARNLRGRMLLLKVRPENY  116

>PYVX_14527
Length=1269

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVE  49
            +W+ R++VL+G  L  +Y+D+  +  TP    KGSF L +VE
Sbjct  914  NWKKRFMVLHGRQL--TYYDTARL--TPSVKAKGSFTLITVE  951

>H310_02722
Length=1879

 Score = 33.1 bits (74),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 41/100 (41%), Gaps = 1/100 (1%)

Query  32    ARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGFKMVGHAPRKGYVELDIFVESRGDL  91
             A T GASP     L    + E VV V+G  K+    ++VGH      V LD      G  
Sbjct  930   AGTAGASPVPKIPLRR-HRGELVVHVVGTSKRASTGRIVGHVRVPMDVALDYCGRHGGTF  988

Query  92    AKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSPATSP  131
             + W  +   A AA  +L    L      K  +   P+++P
Sbjct  989   STWFPIAPLADAAPLELDLHKLVHPVEMKLGYSSPPSSAP  1028

>PHYKE_5678
Length=809

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 28/57 (49%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G  +  SY+ SK+VA+T              EK    V V GA + P
Sbjct  115  SWRYRYAVLSG--VTFSYYVSKEVAKT------------DTEKFRGRVTVTGASRDP  157

>HYAP_11713
Length=417

 Score = 32.7 bits (73),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 46/115 (40%), Gaps = 17/115 (15%)

Query  9    WRVRYLVLNGADLCVSYFDS-KDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            W+ RY V+   +L + YF S +D  R    + +G    SSV   +          KP GF
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERR---TIRGKIPFSSVHAWD---------GKPNGF  89

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSL  122
            +    A         ++ E+  D  KWLEV Q  +  A         D ++T  +
Sbjct  90   QFYTPADHC----FRVYTETAADQLKWLEVMQKCIDNAPDRKDGARVDKSTTGEI  140

>HYAP_11712
Length=558

 Score = 32.7 bits (73),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 42/98 (43%), Gaps = 17/98 (17%)

Query  9    WRVRYLVLNGADLCVSYFDS-KDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            W+ RY V+   +L + YF S +D  R    + +G    SSV  H +         KP GF
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERR---TIRGKIPFSSV--HAW-------DGKPNGF  89

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAA  105
            +    A         ++ E+  D  KWLEV Q  +  A
Sbjct  90   QFYTPADHC----FRVYTETAADQLKWLEVMQKCIDNA  123

>H257_16221
Length=2191

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 54/121 (45%), Gaps = 17/121 (14%)

Query  6     LPSWRVRYLVLNGADLCVSYFDSKD--VARTPGASPKGSFYLSSVEKHEYVVGVLGAQKK  63
             +PS    Y VL G  L V  FD+K+  VA T G  PK    L++V   E+        K 
Sbjct  1104  MPSMSKFYAVLRGHMLHV--FDTKEDAVANTAGRPPKE---LAAVT--EWTGST--HDKY  1154

Query  64    PFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTR--SGLSDAASTKS  121
              FG ++V  A R  ++  D    S      W    QH LA  +  TR  SG   + +TK+
Sbjct  1155  RFGLELVTTAHRTYFIAFD----SDESKVHWTSAIQHGLALQRLATRIASGALQSDTTKA  1210

Query  122   L  122
             +
Sbjct  1211  I  1211

>PHYSO_344112
Length=813

 Score = 32.7 bits (73),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 26/57 (46%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+               EK    V V GA + P
Sbjct  116  SWRYRYAVLSGTTF--SYYVSKDVAKM------------DTEKFRGRVTVTGASRDP  158

>PYU1_G012859
Length=1183

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 21/106 (20%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            + +W+ RY  L+G  L   YF      R  G+  + SF +S VEK   V           
Sbjct  822  IKTWKRRYFSLHGTTL--RYF-----KRETGSMLR-SFTISHVEKQPQVA---------L  864

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS  111
            G +++  + RK    L +  ES+ D  +WL   Q +++A   + +S
Sbjct  865  GLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAESSVPKS  906

>HYAP_08026
Length=798

 Score = 32.3 bits (72),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 26/57 (46%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+               EK    V V GA + P
Sbjct  103  SWRYRYAVLSGTTF--SYYVSKDVAKV------------DTEKFRGRVTVTGATRDP  145

>PPTG_05519
Length=810

 Score = 32.3 bits (72),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 26/57 (46%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+               EK    V V GA + P
Sbjct  116  SWRYRYAVLSGTTF--SYYVSKDVAKM------------DTEKFRGRVTVTGASRDP  158

>SPRG_01740
Length=165

 Score = 31.6 bits (70),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 39/94 (41%), Gaps = 17/94 (18%)

Query  7    PSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEK-HEYVVGVLGAQKKPF  65
            PSW  R+  L+GA+L   YF SKD        P     L S+E    +  G  G      
Sbjct  24   PSWNRRWFALDGAEL--KYFGSKD-----STIPSKVIDLLSIESVRPFDTGDHGV-----  71

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQ  99
             +  V   P + Y    +  +S GD+ +W+   +
Sbjct  72   -YSFVLKTPSRSYF---LRADSEGDMKRWVRCLR  101

>PITG_11578
Length=2131

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (43%), Gaps = 5/103 (5%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            +PS +  Y VL G  L  S++ S+D A+ PGA PK    +  +     + G   A     
Sbjct  12   VPSMKRHYAVLKGTML--SFYLSQDEAQRPGAVPKRVLEIIDLR---IMPGSSSADTHHP  66

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKL  108
               ++ +    G   L    ++R     WLE  QHAL    ++
Sbjct  67   PHMVLKYLDADGGGTLQCRADTRESQQVWLEALQHALKEPDRM  109

>PYAP_15706
Length=275

 Score = 32.0 bits (71),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 2/30 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVARTP  35
           L SW  RY  L+G  L  +YFDS+D +R P
Sbjct  55  LRSWPRRYFTLSGKVL--TYFDSEDTSRAP  82

>SPRG_00364
Length=255

 Score = 32.0 bits (71),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  9   WRVRYLVLNGADLCVSYFDSKDVARTPGASPKGS  42
           W+ R+ VL G  L  SYF S+D A   G +PKG+
Sbjct  33  WKRRFFVLEGRRL--SYFGSEDDANDSGRAPKGT  64

>SDRG_07012
Length=331

 Score = 32.0 bits (71),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 5/45 (11%)

Query  4   LHLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSV  48
           LH  +W  R+ VL      +SY+DS+D+ +     P+G+  + SV
Sbjct  28  LHFKTWSRRFFVLTANTRVMSYYDSEDLRQ-----PRGTLEVLSV  67

>PITG_02762
Length=810

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 26/57 (46%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+               EK    V V GA + P
Sbjct  116  SWRYRYAVLSGTTF--SYYVSKDVAKL------------DTEKFRGRVTVTGASRDP  158

>PITG_00020
Length=927

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 21/100 (21%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ RY  L+G  LC  YF S +          G+   S    H     V+  + K    
Sbjct  811  NWKRRYFTLHGPTLC--YFKSDN----------GALLRSFTVCH-----VVTLRTKRLCL  853

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKK  107
            ++     RK    L +  E++ DL +WL+    A+AA K+
Sbjct  854  EITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKR  889

>SPRG_13975
Length=331

 Score = 32.0 bits (71),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (56%), Gaps = 5/45 (11%)

Query  4   LHLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSV  48
           LH  +W  R+ VL      +SY+DS+D+ +     P+G+  + SV
Sbjct  28  LHFKTWSRRFFVLTANTRVMSYYDSEDLRQ-----PRGTLEVLSV  67

>PYIW_17571
Length=1330

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 27/123 (22%), Positives = 49/123 (40%), Gaps = 22/123 (18%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + Y+ S+D     G  P        ++    V+    A   P+ F
Sbjct  186  NWKTRFFILRRDFPSLCYYTSEDKLELLGEIP--------IQPDTMVLDRSAAGHAPYRF  237

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAK---------KLTRSGLSDAAS  118
            ++     R     L +  ESR +  +W++ CQ  + A +          LTR+ + D  S
Sbjct  238  QV-----RSDAKTLLLEAESRDNQRRWIDSCQELVDAVRADKFRGSTATLTRTSIMDRES  292

Query  119  TKS  121
              S
Sbjct  293  RDS  295

>PHALS_03645
Length=830

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 26/57 (46%), Gaps = 14/57 (25%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            SWR RY VL+G     SY+ SKDVA+               EK    V V GA + P
Sbjct  116  SWRYRYAVLSGT--IFSYYVSKDVAKM------------DTEKFRGRVTVTGASRDP  158

>PYIW_24869
Length=269

 Score = 31.6 bits (70),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 2/28 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVAR  33
           L SW  RY VLNG    ++Y+DS+D +R
Sbjct  47  LRSWGRRYFVLNGK--VLTYYDSEDTSR  72

>SPRG_14312
Length=661

 Score = 32.0 bits (71),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 53/125 (42%), Gaps = 17/125 (14%)

Query  5    HLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKP  64
            HL +W+ R++VL G  L    F     A +  + PKG   L  VE    +V V    KK 
Sbjct  121  HLKNWKKRFMVLRGQSL----FYYVSGAASEDSYPKGLISLVGVEVQ--LVDV-ARFKKQ  173

Query  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKS--L  122
            F F++        Y  L +  ++  DL +W+      + +A    + G+ DA+      L
Sbjct  174  FCFEL----SHPYYRPLYLMAKNEADLTQWMS----CIKSASLPLKDGIVDASREPKDVL  225

Query  123  FGFSP  127
            F   P
Sbjct  226  FDLPP  230

>SDRG_14771
Length=549

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 18/124 (15%)

Query  9    WRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGFK  68
            W+ RY VL  + L + Y++S++ A     S KG     SV  H++         KP GF+
Sbjct  34   WKRRYCVLQESALAIFYYESEEAAAE--GSLKGKIPYCSV--HDW-------DGKPHGFQ  82

Query  69   MVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSPA  128
               + P        ++ +S  +  KW+   Q  L  A ++    L+  A   +    SP 
Sbjct  83   F--YTPTNKCFR--VYCDSDDERNKWMTAMQAQLDNAPEVADGELAPYARNGAA---SPT  135

Query  129  TSPQ  132
             SP+
Sbjct  136  GSPR  139

>HYAP_02230
Length=1195

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 78/183 (43%), Gaps = 24/183 (13%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + YF S+D     G          ++ +   V+   G    PF F
Sbjct  168  NWKTRFFILRSDCPSLCYFTSEDKLELLGE--------IAITEDTIVLDRSGGGTAPFRF  219

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            ++     R     L +  ESR    +W++ CQ  LA A + ++  ++ + S+ S    S 
Sbjct  220  QI-----RSDAHTLLLEAESRDSQKRWMDSCQE-LADAIRASKFSVNTSVSSLSGALESR  273

Query  128  ATSPQKQI--QKLSASKE-ELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSL  184
             +S  K +   +L+   E     Q +DE E++ +   + C       +R+  RLT G SL
Sbjct  274  RSSVVKAVGMTRLTDVGETSASSQNVDETENSVVDETDVC-------LRRPRRLTVGDSL  326

Query  185  HAE  187
              +
Sbjct  327  TTQ  329

>PYIW_14856
Length=83

 Score = 29.6 bits (65),  Expect = 6.5, Method: Composition-based stats.
 Identities = 19/56 (34%), Positives = 28/56 (50%), Gaps = 1/56 (2%)

Query  33  RTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGFKMVGHAPRKGYVELDIFVESR  88
           +T   SP  S ++ S  + EY+V V G Q+ PF  +   H  +  YVE  I  + R
Sbjct  20  KTHHKSPLRS-HIKSAGRSEYIVTVFGQQRSPFQRRAPRHTRQISYVEPKINTKLR  74

>CCI47145
Length=390

 Score = 31.6 bits (70),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (57%), Gaps = 5/44 (11%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVE  49
              SW+ RY VL G  L  +YF S+D   T GAS KG   + +VE
Sbjct  208  FKSWKKRYFVLRGNSL--AYFASED---TGGASAKGFGRVCAVE  246

 Score = 31.2 bits (69),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 3/42 (7%)

Query  8   SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVE  49
           SW+ RY+VL G  L  SY+D+ ++  +     KGSF + +VE
Sbjct  50  SWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVITVE  88

>H310_04842
Length=1081

 Score = 32.0 bits (71),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 45/107 (42%), Gaps = 28/107 (26%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSV-----EKHEYVVGVLGA  60
            LP W  RYLVL+G  L   Y+  +D AR  G   +G   L+ V     +K E+   V   
Sbjct  128  LPRWESRYLVLDGTVL--RYYSKQDDARL-GKHLRGKLILTHVSPEIHKKKEHTFAVETT  184

Query  61   QKKPFGFKMVGHAPRKGYVELDIFVESRGDLAK--WLEVCQHALAAA  105
             +K F                  F+    +L K  W+E+ Q A++ A
Sbjct  185  GRKMF------------------FMSCDTELEKDMWVEMIQAAISEA  213

>PYAP_15024
Length=170

 Score = 30.8 bits (68),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 40/97 (41%), Gaps = 17/97 (18%)

Query  4    LHLPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEK-HEYVVGVLGAQK  62
            + +P W  R+  L G DL   Y+ +++      A P     L S+E    +  G  G   
Sbjct  40   MLMPQWNKRFFALEGRDL--KYYTNEN-----SAEPSKVIDLLSIESIRRFENGDHGV--  90

Query  63   KPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQ  99
                F  V   P + Y    +  ES+GD+ +W+   Q
Sbjct  91   ----FSFVLKTPERSYF---LRAESKGDMKRWVRGLQ  120

>SPRG_04831
Length=718

 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 36/82 (44%), Gaps = 15/82 (18%)

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125
            GF + G+  R+G  +      SR D  +W+E+ QH      +          +T +   F
Sbjct  310  GFALTGYVERQGPKK-----ASRYDCGEWVEITQHTFFHYDE----------ATGACAYF  354

Query  126  SPATSPQKQIQKLSASKEELLK  147
             PA S   +  +L  S+ ELL+
Sbjct  355  DPAPSSANKTIQLQYSRNELLQ  376

>PPTG_11714
Length=2444

 Score = 32.0 bits (71),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 50/228 (22%), Positives = 94/228 (41%), Gaps = 43/228 (19%)

Query  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65
            +PS +  Y VL G  L  S++ ++D A+  GA PK             V+ ++  +  P 
Sbjct  12   VPSMKRHYAVLKGTML--SFYLTQDEAQRSGAVPK------------RVLEIIDLRIMPS  57

Query  66   GFKM-VGHAPR--------KGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDA  116
                   H P          G   L    +SR     WLE  QHAL    ++ +  +++ 
Sbjct  58   TSSTDTSHPPHMVLKYLDADGGGTLQCRADSRETQQDWLEALQHALKEPDRMAQEEITEV  117

Query  117  ---------ASTKSLFGFSPATSPQKQIQKLSASKEELLKQ----AID---EIESAKLMG  160
                       ++++   + A     +  +  A+ E  L+Q    A++   ++E+A+++ 
Sbjct  118  QEELRRDAQCHSRAVQQATEAVEAAGRHHREQANAEAALQQNREIAVELNTQLETARILQ  177

Query  161  REACQEI-VVQGVRKRGRL---TSGFSLHAEKLDHIESELQRVDADLD  204
            REA Q++  +QG  +  R    TS        LD     ++R+ A ++
Sbjct  178  REALQKLETLQGALEDARQRVHTSSLETEDSSLDQAMEAVERLAAKVE  225

>PYIR_16539
Length=1346

 Score = 32.0 bits (71),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 31/143 (22%), Positives = 59/143 (41%), Gaps = 14/143 (10%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67
            +W+ R+ +L      + Y+ S+D     G  P        +     V+    +   P+ F
Sbjct  182  NWKTRFFILRRDFPSLCYYTSEDKLELLGEIP--------ILPDTMVLDRSASGHAPYRF  233

Query  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127
            ++     R     L +  ESR +  +W++ CQ  + A +     G + A S  SL     
Sbjct  234  QV-----RSETKTLLLEAESRDNQRRWIDSCQELVDAVRADKFRGSTTALSRTSLMDRES  288

Query  128  ATSPQKQIQKLSASKEELLKQAI  150
            + S Q  I  L+A++   + +A+
Sbjct  289  SDSRQSNI-ALNAARRSSVSKAV  310

>PYIW_19613
Length=1314

 Score = 31.6 bits (70),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 5/64 (8%)

Query  19   ADLCVSYFDSKDVART--PGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGFKMVGHAPRK  76
            AD+   +F+   +  T  P  +P GS  LS+    E     L A    FG+K V  AP K
Sbjct  602  ADMINLFFEHLGICHTVMPEKAPDGSLRLSASSPDE---QALVAAAACFGYKFVARAPGK  658

Query  77   GYVE  80
              VE
Sbjct  659  AMVE  662

>SDRG_02154
Length=822

 Score = 31.6 bits (70),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEK  50
            +W+ R++VL    L   YF++  +  TP   PKGSF + ++E+
Sbjct  139  NWKRRFMVLQSCHL--HYFETDKL--TPTLKPKGSFQVLAIER  177

>H310_05457
Length=269

 Score = 31.2 bits (69),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 2/33 (6%)

Query  9   WRVRYLVLNGADLCVSYFDSKDVARTPGASPKG  41
           W+ R++VL G DL  SY+ ++  A  P   PKG
Sbjct  48  WKRRFMVLEGRDL--SYYGNETEAMEPSTPPKG  78

>H310_01504
Length=212

 Score = 30.8 bits (68),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 3/61 (5%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSF--YLSSVEKHEYVVGVLGAQKK  63
            P     Y+  NG   C S+FD KD+  TP ++P         SV+K +  +   GA   
Sbjct  41  FPDAPTSYVTCNGGP-CPSWFDLKDIPITPASAPNEPLKGLTDSVKKVQDAIARFGASGI  99

Query  64  P  64
           P
Sbjct  100 P  100

>PHYKE_8531
Length=269

 Score = 30.8 bits (68),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 2/28 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVAR  33
           L SW  RY  LNG  L  +Y+DS+D +R
Sbjct  46  LRSWARRYFTLNGKTL--TYYDSEDTSR  71

>SDRG_07721
Length=722

 Score = 31.2 bits (69),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 21/82 (26%), Positives = 36/82 (44%), Gaps = 15/82 (18%)

Query  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125
            GF + G+  R+G  +      SR D  +W+E+ QH      +          +T +   F
Sbjct  315  GFALTGYVERQGPKK-----PSRYDCGEWVEITQHTFFHYDE----------ATGACAYF  359

Query  126  SPATSPQKQIQKLSASKEELLK  147
             PA S   +  +L  ++ ELL+
Sbjct  360  DPAPSSTNKTIQLQYTRNELLQ  381

>SPRG_09211
Length=549

 Score = 31.2 bits (69),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 18/124 (15%)

Query  9    WRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGFK  68
            W+ RY VL  + L + Y++S++ A     S KG     SV  H++         KP GF+
Sbjct  34   WKRRYCVLQESALAIFYYESEEAAAE--GSLKGKIPYCSV--HDW-------DGKPHGFQ  82

Query  69   MVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSPA  128
               + P        ++ +S  +  KW+   Q  L  A ++    L+  A   +    SP 
Sbjct  83   F--YTPTNKCFR--VYCDSDDERNKWMTSMQAQLDNAPEVADGELAPYARNGAA---SPT  135

Query  129  TSPQ  132
             SP+
Sbjct  136  GSPR  139

>PYU1_G001268
Length=263

 Score = 30.8 bits (68),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 2/28 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVAR  33
           L SW  RY  LNG  L  +Y+DS+D +R
Sbjct  43  LRSWGRRYFTLNGKTL--TYYDSEDTSR  68

>PYAR_21583
Length=237

 Score = 30.8 bits (68),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 2/30 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVARTP  35
           L SW  RY  L+G  L  +Y+DS+D +R+P
Sbjct  46  LRSWPRRYFTLSGKVL--TYYDSEDTSRSP  73

>PYVX_14851
Length=227

 Score = 30.8 bits (68),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (7%)

Query  6   LPSWRVRYLVLNGADLCVSYFDSKDVARTP  35
           L SW  RY  L+G    ++Y+DS+D +R P
Sbjct  46  LRSWARRYFTLSGK--LITYYDSEDTSRAP  73

Lambda      K        H        a         alpha
   0.314    0.129    0.361    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 20291717910

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40