Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_222739320326826812808e-180
PYAR_24096932032271657681e-102
PHYCA_14369109792481925332e-66
PYU1_G001739932032661885254e-65
PPTG_10636109792462425201e-64
PPTG_10635528561991785133e-64
PHYCA_102852242061951875124e-64
PHYSO_341599109791851745115e-64
PHYKE_7718109792201875111e-63
PHYCA_102550457052681925151e-63
PYIR_26546866052391885122e-63
PYAP_22278932042891695152e-63
PYU1_G001740147522061695082e-63
PYIR_25089854042621865114e-63
PHYRA_84190720132061785056e-63
PHALS_00498109791991895048e-63
PPTG_10634720132081855031e-62
PHYRA_85631109792281885042e-62
PHYKE_3446231281991875003e-62
PHYSO_536424606911971664978e-62
PHYSO_507031586531971664978e-62
PYIR_26626147522121884988e-62
PPTG_17122147522041874961e-61
PHYKE_8389147522041844926e-61
PPTG_15264231281941854907e-61
PPTG_17366239131941854907e-61
PYU1_G001742932042131674911e-60
PPTG_10643457052501934922e-60
PYAP_22279854042231654884e-60
PPTG_14255469372682464907e-60
PHYCA_102624720131951914847e-60
PHYRA_82864231281931864821e-59
PHYKE_8388568762051924752e-58
PYU1_G001744568762131674744e-58
PHYSO_477820568762021824726e-58
PYU1_G001741854041991864691e-57
PHYCA_510817445761881894681e-57
PHYSO_417649445761851884672e-57
PITG_18450147522031874664e-57
PYVX_18173449665001654885e-57
PPTG_10048213141901834646e-57
PHYRA_81107568762021824622e-56
PHYRA_81106147522021674603e-56
PHYSO_284086147522041654595e-56
PHYCA_129425147522041654595e-56
PHALS_03284309411881774576e-56
PPTG_17121568762021794586e-56
PHYKE_9185445762811884613e-55
PPTG_14254445761881884454e-54
PHYCA_511409568762041674464e-54
PHYSO_499978231281741604428e-54
PHYSO_501575820771741604428e-54
PHYCA_53693413059831834801e-53
PYVX_18174854042041684404e-53
PYIW_18791854041941654352e-52
PYU1_G001738534612261774277e-51
PHYSO_262732469371881894151e-49
PYVX_18176568762011674143e-49
PPTG_0882086622501854158e-49
PHYSO_343376532371721314052e-48
PHYSO_527908600641741753974e-47
PITG_13520109791711573941e-46
PYIW_18788932032441703879e-45
PITG_1049986623231613894e-44
PHYSO_254168462841701523722e-43
PPTG_17123147532011403664e-42
PHYCA_537323449662001403622e-41
PHYSO_353401534611461403582e-41
PHYRA_81105534612011403594e-41
PITG_18452147538561403786e-40
PYAP_18131991722261133451e-38
HYAP_07096534612511883435e-38
PHYSO_341596528562311483345e-37
PHYCA_14368528562191943232e-35
PHYSO_340369526762001923212e-35
PHYSO_342364529831942013124e-34
PHYSO_246676457051871772932e-31
PYU1_G007476539131951792872e-30
PYAP_18709943552351792781e-28
PYIR_1644442341821932696e-28
PYIW_18792932041251202639e-28
PYIW_27477823991801402644e-27
PYIR_1643542333041282682e-26
PYU1_G005323943552511882624e-26
PYIR_16443823992751312626e-26
PHYSO_48395542353202122647e-26
PYAP_18711943562101342561e-25
PPTG_0461942342762842592e-25
PYIR_23585845342401832544e-25
PHYCA_13036542352662852564e-25
PHALS_0539242353671402605e-25
PHYKE_600144782891392565e-25
PYAP_246891014392521342521e-24
PHYRA_7358242353262092551e-24
PYAR_14260845342121442491e-24
PITG_1193697753332062552e-24
PHYSO_48552442342782042512e-24
PYAP_1871342341841312443e-24
PYIW_19151831912481392493e-24
PPTG_04622696962731382503e-24
PHYCA_12942213313531012543e-24
PPTG_1422144782751792494e-24
PHYCA_12727044782791792486e-24
PYU1_G005324845341911872436e-24
PYU1_G005326463491911872436e-24
PYU1_G00532842331911872436e-24
PYAR_14256943551991662436e-24
PYU1_G005325943562071872438e-24
PHYSO_533903604652081802438e-24
PHALS_0539442342881482471e-23
PHYRA_74651699693441942482e-23
PYU1_G00151997822651902442e-23
PPTG_0461842353261402462e-23
PHALS_03177526712592022433e-23
PYAR_206171040482541902414e-23
PPTG_04647194343271372445e-23
PITG_0494942353371892446e-23
PITG_0494842342321352388e-23
PYU1_G01469042342952112419e-23
PHYRA_7358442332872082401e-22
PITG_0527144782782062373e-22
PPTG_0313997753202072393e-22
PHYKE_6077188563222822393e-22
PYU1_G007364851643161862383e-22
PHYSO_438103557212381782344e-22
PHYRA_73606571983661962404e-22
PHYKE_10578778802392032334e-22
PHYSO_459106194342231342324e-22
PHYSO_533682604462781332354e-22
PYIW_2196497752651842337e-22
PHYSO_34033244782951332348e-22
PHYCA_531163194343142012358e-22
PYIR_19612831912601402328e-22
PHYRA_73607194343432032361e-21
PHYRA_78175764333192072351e-21
PHYSO_340333526712841332331e-21
PHYSO_484051571982852042321e-21
PHYRA_7868968382961452322e-21
PHYKE_2809752822911352322e-21
PHYKE_2937571983661372333e-21
PHYRA_7358342346301362364e-21
PHYRA_86016727462361052255e-21
H310_0636217301971392236e-21
PHYCA_12331697763161392288e-21
PPTG_0750738072991062261e-20
PPTG_07509718142991062261e-20
PHYRA_7914038074242122292e-20
PHYRA_86752732363001052252e-20
PHALS_02044930992372082212e-20
PHYKE_391342343211342243e-20
PYU1_G00152797792781302214e-20
PYU1_G00152397762781302214e-20
PITG_0494742332981272224e-20
CCI4738117292111492175e-20
PYU1_G00586817292672792205e-20
PHYCA_534473423310501292285e-20
PHYRA_85794726192301902186e-20
PITG_0820268381911912156e-20
PHALS_0317644782071482166e-20
PHYCA_534296526713091332218e-20
PYVX_14662510865401942258e-20
PHYSO_533747604512061782159e-20
PHYRA_77971705552301902169e-20
PHYRA_78625541464341752249e-20
SPRG_19916161733052002201e-19
PHYRA_78626578954731752241e-19
PHYRA_83494464352241052151e-19
PYIW_168101650732161762151e-19
PYIR_2048117292771912172e-19
PPTG_0462042333421282192e-19
PHYKE_391242332521222152e-19
PHYCA_69583463492242122133e-19
PHYCA_1961197755311872213e-19
PYU1_G00152697803341302174e-19
PYIR_2213497753001832155e-19
PHYRA_83500718143941062176e-19
PHYCA_12943369712871062146e-19
PYIR_24743851643572132166e-19
PPTG_0314597823012032146e-19
PHYCA_97965401872881062136e-19
PYIW_1552617302562032127e-19
PPTG_03138188562942102138e-19
PHYCA_98479819502761102128e-19
PHYRA_73581696932932032121e-18
PYAP_18221944962262032091e-18
PHYRA_83499204334731882161e-18
PHYKE_10296574615122022161e-18
SPRG_2216117303002812121e-18
PYIR_25999861323441952131e-18
H257_1355017302661982102e-18
PHYCA_120062539132122092072e-18
CCA1717917291851492052e-18
HYAP_1192397766061272152e-18
PHYRA_78176597733121422102e-18
PHALS_04411944962622082083e-18
PHYSO_255056463492692052083e-18
PHALS_03179308833722022123e-18
PYIW_187905687686791963e-18
PYU1_G005985820772002092043e-18
PHYSO_488921574612961992093e-18
PHYCA_1047197823091922093e-18
PYIR_2533497822721312073e-18
PHYRA_77290574613092022094e-18
PHYKE_6002526711971802034e-18
PYIR_24421899032131392044e-18
PITG_1193797763051392084e-18
PPTG_07516464352942072075e-18
PPTG_0752038142942072076e-18
PHYSO_329293510323101992076e-18
PYAP_236721009052572742056e-18
PHYKE_6076764332722082057e-18
PYVX_19277793613311992079e-18
PHYSO_48813917302652822031e-17
PHYCA_103479510323142062051e-17
PHALS_10635341192961332051e-17
PYAP_222571003612471402021e-17
PHYKE_607897753172062051e-17
PHYSO_37402597823001312042e-17
SDRG_081371363342821912032e-17
PYVX_16138786195592062082e-17
PHYCA_14560574613002032032e-17
PHYKE_6069456832981372032e-17
PYIW_18065851643082002032e-17
PYIR_26867868821631181953e-17
PHYRA_7816797822842002013e-17
PYU1_G00151697753041802023e-17
PHYKE_574938073001822023e-17
PPTG_04617696934961992053e-17
PPTG_18166242064451102053e-17
PPTG_0316097913792152043e-17
PHYSO_31868397763521992025e-17
SDRG_075651244122781912005e-17
PYAP_18226840622261561975e-17
PYAR_153911025081761921945e-17
PYAP_14265554392982142006e-17
PHYRA_7817297763851342027e-17
PPTG_01153944953171992007e-17
PHYKE_1913732362801341987e-17
PHYCA_12944369721711001928e-17
PHYKE_6079597733022081989e-17
PYAP_19712995812761811979e-17
PHYRA_7817797753242081999e-17
PYVX_2250897752981421981e-16
PHYRA_78174188562792131971e-16
PHYSO_324715696932741071971e-16
SDRG_081291363312181841941e-16
PYAR_2411397811921811921e-16
PYU1_G001528861322742001961e-16
PHYRA_7729117302522191952e-16
PYIR_14463819503692071982e-16
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_22273

Length=268
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAP_22273                                                            497        8e-180
PYAR_24096                                                            300        1e-102
PHYCA_14369                                                           209        2e-66 
PYU1_G001739                                                          206        4e-65 
PPTG_10636                                                            204        1e-64 
PPTG_10635                                                            202        3e-64 
PHYCA_102852                                                          201        4e-64 
PHYSO_341599                                                          201        5e-64 
PHYKE_7718                                                            201        1e-63 
PHYCA_102550                                                          202        1e-63 
PYIR_26546                                                            201        2e-63 
PYAP_22278                                                            202        2e-63 
PYU1_G001740                                                          200        2e-63 
PYIR_25089                                                            201        4e-63 
PHYRA_84190                                                           199        6e-63 
PHALS_00498                                                           198        8e-63 
PPTG_10634                                                            198        1e-62 
PHYRA_85631                                                           198        2e-62 
PHYKE_3446                                                            197        3e-62 
PHYSO_536424                                                          196        8e-62 
PHYSO_507031                                                          196        8e-62 
PYIR_26626                                                            196        8e-62 
PPTG_17122                                                            195        1e-61 
PHYKE_8389                                                            194        6e-61 
PPTG_15264                                                            193        7e-61 
PPTG_17366                                                            193        7e-61 
PYU1_G001742                                                          193        1e-60 
PPTG_10643                                                            194        2e-60 
PYAP_22279                                                            192        4e-60 
PPTG_14255                                                            193        7e-60 
PHYCA_102624                                                          191        7e-60 
PHYRA_82864                                                           190        1e-59 
PHYKE_8388                                                            187        2e-58 
PYU1_G001744                                                          187        4e-58 
PHYSO_477820                                                          186        6e-58 
PYU1_G001741                                                          185        1e-57 
PHYCA_510817                                                          184        1e-57 
PHYSO_417649                                                          184        2e-57 
PITG_18450                                                            184        4e-57 
PYVX_18173                                                            192        5e-57 
PPTG_10048                                                            183        6e-57 
PHYRA_81107                                                           182        2e-56 
PHYRA_81106                                                           181        3e-56 
PHYSO_284086                                                          181        5e-56 
PHYCA_129425                                                          181        5e-56 
PHALS_03284                                                           180        6e-56 
PPTG_17121                                                            181        6e-56 
PHYKE_9185                                                            182        3e-55 
PPTG_14254                                                            176        4e-54 
PHYCA_511409                                                          176        4e-54 
PHYSO_499978                                                          174        8e-54 
PHYSO_501575                                                          174        8e-54 
PHYCA_536934                                                          189        1e-53 
PYVX_18174                                                            174        4e-53 
PYIW_18791                                                            172        2e-52 
PYU1_G001738                                                          169        7e-51 
PHYSO_262732                                                          164        1e-49 
PYVX_18176                                                            164        3e-49 
PPTG_08820                                                            164        8e-49 
PHYSO_343376                                                          160        2e-48 
PHYSO_527908                                                          157        4e-47 
PITG_13520                                                            156        1e-46 
PYIW_18788                                                            153        9e-45 
PITG_10499                                                            154        4e-44 
PHYSO_254168                                                          147        2e-43 
PPTG_17123                                                            145        4e-42 
PHYCA_537323                                                          144        2e-41 
PHYSO_353401                                                          142        2e-41 
PHYRA_81105                                                           142        4e-41 
PITG_18452                                                            150        6e-40 
PYAP_18131                                                            137        1e-38 
HYAP_07096                                                            136        5e-38 
PHYSO_341596                                                          133        5e-37 
PHYCA_14368                                                           129        2e-35 
PHYSO_340369                                                          128        2e-35 
PHYSO_342364                                                          124        4e-34 
PHYSO_246676                                                          117        2e-31 
PYU1_G007476                                                          115        2e-30 
PYAP_18709                                                            111        1e-28 
PYIR_16444                                                            108        6e-28 
PYIW_18792                                                            105        9e-28 
PYIW_27477                                                            106        4e-27 
PYIR_16435                                                            107        2e-26 
PYU1_G005323                                                          105        4e-26 
PYIR_16443                                                            105        6e-26 
PHYSO_483955                                                          106        7e-26 
PYAP_18711                                                            103        1e-25 
PPTG_04619                                                            104        2e-25 
PYIR_23585                                                            102        4e-25 
PHYCA_130365                                                          103        4e-25 
PHALS_05392                                                           104        5e-25 
PHYKE_6001                                                            103        5e-25 
PYAP_24689                                                            101        1e-24 
PHYRA_73582                                                           102        1e-24 
PYAR_14260                                                            100        1e-24 
PITG_11936                                                            102        2e-24 
PHYSO_485524                                                          101        2e-24 
PYAP_18713                                                            98.6       3e-24 
PYIW_19151                                                            100        3e-24 
PPTG_04622                                                            100        3e-24 
PHYCA_12942                                                           102        3e-24 
PPTG_14221                                                            100        4e-24 
PHYCA_127270                                                          100        6e-24 
PYU1_G005324                                                          98.2       6e-24 
PYU1_G005326                                                          98.2       6e-24 
PYU1_G005328                                                          98.2       6e-24 
PYAR_14256                                                            98.2       6e-24 
PYU1_G005325                                                          98.2       8e-24 
PHYSO_533903                                                          98.2       8e-24 
PHALS_05394                                                           99.8       1e-23 
PHYRA_74651                                                           100        2e-23 
PYU1_G001519                                                          98.6       2e-23 
PPTG_04618                                                            99.4       2e-23 
PHALS_03177                                                           98.2       3e-23 
PYAR_20617                                                            97.4       4e-23 
PPTG_04647                                                            98.6       5e-23 
PITG_04949                                                            98.6       6e-23 
PITG_04948                                                            96.3       8e-23 
PYU1_G014690                                                          97.4       9e-23 
PHYRA_73584                                                           97.1       1e-22 
PITG_05271                                                            95.9       3e-22 
PPTG_03139                                                            96.7       3e-22 
PHYKE_6077                                                            96.7       3e-22 
PYU1_G007364                                                          96.3       3e-22 
PHYSO_438103                                                          94.7       4e-22 
PHYRA_73606                                                           97.1       4e-22 
PHYKE_10578                                                           94.4       4e-22 
PHYSO_459106                                                          94.0       4e-22 
PHYSO_533682                                                          95.1       4e-22 
PYIW_21964                                                            94.4       7e-22 
PHYSO_340332                                                          94.7       8e-22 
PHYCA_531163                                                          95.1       8e-22 
PYIR_19612                                                            94.0       8e-22 
PHYRA_73607                                                           95.5       1e-21 
PHYRA_78175                                                           95.1       1e-21 
PHYSO_340333                                                          94.4       1e-21 
PHYSO_484051                                                          94.0       1e-21 
PHYRA_78689                                                           94.0       2e-21 
PHYKE_2809                                                            94.0       2e-21 
PHYKE_2937                                                            94.4       3e-21 
PHYRA_73583                                                           95.5       4e-21 
PHYRA_86016                                                           91.3       5e-21 
H310_06362                                                            90.5       6e-21 
PHYCA_123316                                                          92.4       8e-21 
PPTG_07507                                                            91.7       1e-20 
PPTG_07509                                                            91.7       1e-20 
PHYRA_79140                                                           92.8       2e-20 
PHYRA_86752                                                           91.3       2e-20 
PHALS_02044                                                           89.7       2e-20 
PHYKE_3913                                                            90.9       3e-20 
PYU1_G001527                                                          89.7       4e-20 
PYU1_G001523                                                          89.7       4e-20 
PITG_04947                                                            90.1       4e-20 
CCI47381                                                              88.2       5e-20 
PYU1_G005868                                                          89.4       5e-20 
PHYCA_534473                                                          92.4       5e-20 
PHYRA_85794                                                           88.6       6e-20 
PITG_08202                                                            87.4       6e-20 
PHALS_03176                                                           87.8       6e-20 
PHYCA_534296                                                          89.7       8e-20 
PYVX_14662                                                            91.3       8e-20 
PHYSO_533747                                                          87.4       9e-20 
PHYRA_77971                                                           87.8       9e-20 
PHYRA_78625                                                           90.9       9e-20 
SPRG_19916                                                            89.4       1e-19 
PHYRA_78626                                                           90.9       1e-19 
PHYRA_83494                                                           87.4       1e-19 
PYIW_16810                                                            87.4       1e-19 
PYIR_20481                                                            88.2       2e-19 
PPTG_04620                                                            89.0       2e-19 
PHYKE_3912                                                            87.4       2e-19 
PHYCA_69583                                                           86.7       3e-19 
PHYCA_19611                                                           89.7       3e-19 
PYU1_G001526                                                          88.2       4e-19 
PYIR_22134                                                            87.4       5e-19 
PHYRA_83500                                                           88.2       6e-19 
PHYCA_12943                                                           87.0       6e-19 
PYIR_24743                                                            87.8       6e-19 
PPTG_03145                                                            87.0       6e-19 
PHYCA_97965                                                           86.7       6e-19 
PYIW_15526                                                            86.3       7e-19 
PPTG_03138                                                            86.7       8e-19 
PHYCA_98479                                                           86.3       8e-19 
PHYRA_73581                                                           86.3       1e-18 
PYAP_18221                                                            85.1       1e-18 
PHYRA_83499                                                           87.8       1e-18 
PHYKE_10296                                                           87.8       1e-18 
SPRG_22161                                                            86.3       1e-18 
PYIR_25999                                                            86.7       1e-18 
H257_13550                                                            85.5       2e-18 
PHYCA_120062                                                          84.3       2e-18 
CCA17179                                                              83.6       2e-18 
HYAP_11923                                                            87.4       2e-18 
PHYRA_78176                                                           85.5       2e-18 
PHALS_04411                                                           84.7       3e-18 
PHYSO_255056                                                          84.7       3e-18 
PHALS_03179                                                           86.3       3e-18 
PYIW_18790                                                            80.1       3e-18 
PYU1_G005985                                                          83.2       3e-18 
PHYSO_488921                                                          85.1       3e-18 
PHYCA_10471                                                           85.1       3e-18 
PYIR_25334                                                            84.3       3e-18 
PHYRA_77290                                                           85.1       4e-18 
PHYKE_6002                                                            82.8       4e-18 
PYIR_24421                                                            83.2       4e-18 
PITG_11937                                                            84.7       4e-18 
PPTG_07516                                                            84.3       5e-18 
PPTG_07520                                                            84.3       6e-18 
PHYSO_329293                                                          84.3       6e-18 
PYAP_23672                                                            83.6       6e-18 
PHYKE_6076                                                            83.6       7e-18 
PYVX_19277                                                            84.3       9e-18 
PHYSO_488139                                                          82.8       1e-17 
PHYCA_103479                                                          83.6       1e-17 
PHALS_10635                                                           83.6       1e-17 
PYAP_22257                                                            82.4       1e-17 
PHYKE_6078                                                            83.6       1e-17 
PHYSO_374025                                                          83.2       2e-17 
SDRG_08137                                                            82.8       2e-17 
PYVX_16138                                                            84.7       2e-17 
PHYCA_14560                                                           82.8       2e-17 
PHYKE_6069                                                            82.8       2e-17 
PYIW_18065                                                            82.8       2e-17 
PYIR_26867                                                            79.7       3e-17 
PHYRA_78167                                                           82.0       3e-17 
PYU1_G001516                                                          82.4       3e-17 
PHYKE_5749                                                            82.4       3e-17 
PPTG_04617                                                            83.6       3e-17 
PPTG_18166                                                            83.6       3e-17 
PPTG_03160                                                            83.2       3e-17 
PHYSO_318683                                                          82.4       5e-17 
SDRG_07565                                                            81.6       5e-17 
PYAP_18226                                                            80.5       5e-17 
PYAR_15391                                                            79.3       5e-17 
PYAP_14265                                                            81.6       6e-17 
PHYRA_78172                                                           82.4       7e-17 
PPTG_01153                                                            81.6       7e-17 
PHYKE_1913                                                            80.9       7e-17 
PHYCA_12944                                                           78.6       8e-17 
PHYKE_6079                                                            80.9       9e-17 
PYAP_19712                                                            80.5       9e-17 
PHYRA_78177                                                           81.3       9e-17 
PYVX_22508                                                            80.9       1e-16 
PHYRA_78174                                                           80.5       1e-16 
PHYSO_324715                                                          80.5       1e-16 
SDRG_08129                                                            79.3       1e-16 
PYAR_24113                                                            78.6       1e-16 
PYU1_G001528                                                          80.1       1e-16 
PHYRA_77291                                                           79.7       2e-16 
PYIR_14463                                                            80.9       2e-16 
SDRG_15426                                                            81.3       2e-16 
PPTG_07521                                                            79.7       2e-16 
PHYCA_552912                                                          80.5       3e-16 
PHYCA_14559                                                           78.6       3e-16 
PHYCA_19612                                                           80.9       4e-16 
PYVX_20783                                                            79.0       4e-16 
PPTG_18176                                                            78.6       4e-16 
PHYSO_246481                                                          79.3       4e-16 
PHYRA_86241                                                           77.4       4e-16 
PYIR_15187                                                            77.4       5e-16 
SDRG_08782                                                            80.1       5e-16 
PYU1_G005872                                                          79.0       5e-16 
PHYKE_10295                                                           78.6       6e-16 
PPTG_03153                                                            79.0       6e-16 
PYU1_G005871                                                          78.6       6e-16 
PHYCA_19598                                                           79.3       6e-16 
PHYCA_18657                                                           78.6       7e-16 
PPTG_01152                                                            77.8       7e-16 
PYU1_G001514                                                          79.7       7e-16 
PYU1_G001525                                                          78.6       8e-16 
PYIW_24289                                                            76.3       1e-15 
PHYRA_93650                                                           77.0       1e-15 
PPTG_10073                                                            75.9       1e-15 
PYU1_G005873                                                          76.3       1e-15 
PITG_01969                                                            77.0       1e-15 
PPTG_01147                                                            77.0       1e-15 
PHYSO_524101                                                          77.8       2e-15 
PITG_20312                                                            77.0       2e-15 
PITG_20631                                                            76.6       2e-15 
PITG_11944                                                            77.4       2e-15 
PYIW_25573                                                            77.0       2e-15 
PPTG_10186                                                            76.6       2e-15 
PYIR_20483                                                            76.6       3e-15 
PITG_11942                                                            76.6       3e-15 
SPRG_19917                                                            75.5       4e-15 
SPRG_07799                                                            77.0       4e-15 
PHYRA_78161                                                           77.0       4e-15 
PHYKE_7445                                                            77.0       4e-15 
PHYSO_255975                                                          74.3       4e-15 
PHYRA_78169                                                           77.0       4e-15 
PYAP_18138                                                            75.9       4e-15 
PHYCA_112615                                                          74.3       5e-15 
PHYCA_122958                                                          75.5       5e-15 
PYIW_21963                                                            76.3       5e-15 
PHYKE_2454                                                            76.6       5e-15 
PYU1_G001524                                                          76.3       5e-15 
PYVX_22510                                                            77.4       6e-15 
PHYSO_426658                                                          74.3       6e-15 
PYIW_24287                                                            76.3       7e-15 
PPTG_04801                                                            75.1       7e-15 
PHYSO_262844                                                          75.5       7e-15 
PYAP_24691                                                            72.4       8e-15 
PHYRA_86751                                                           73.2       8e-15 
PYIR_22133                                                            76.6       8e-15 
SDRG_17318                                                            74.7       8e-15 
PYAP_23673                                                            75.9       8e-15 
PHYSO_476077                                                          75.1       8e-15 
PHYSO_472009                                                          75.1       8e-15 
PHYRA_80750                                                           75.1       9e-15 
PYIW_24288                                                            73.6       9e-15 
HYAP_14170                                                            74.7       9e-15 
PITG_01966                                                            75.5       1e-14 
SPRG_04679                                                            73.9       1e-14 
PYVX_21438                                                            74.7       1e-14 
PHALS_02041                                                           74.3       1e-14 
PHYRA_86151                                                           72.4       2e-14 
PHALS_08575                                                           74.7       2e-14 
PHYCA_123476                                                          74.7       2e-14 
PHYRA_87941                                                           72.0       2e-14 
PYVX_24563                                                            73.9       2e-14 
PYAP_16338                                                            73.9       2e-14 
PPTG_03161                                                            75.5       2e-14 
PYVX_21297                                                            73.9       2e-14 
PYAP_18584                                                            72.8       2e-14 
SPRG_07795                                                            74.7       2e-14 
SPRG_07627                                                            75.5       2e-14 
PHYSO_375794                                                          70.9       2e-14 
PHYKE_7717                                                            75.5       3e-14 
PHYKE_8390                                                            70.9       3e-14 
PYU1_G005869                                                          73.6       3e-14 
PYAP_19707                                                            73.2       3e-14 
PYIW_25463                                                            72.4       3e-14 
PHYRA_77293                                                           73.9       3e-14 
PYU1_G001520                                                          74.3       3e-14 
PPTG_03148                                                            73.6       4e-14 
PHALS_01460                                                           73.6       4e-14 
PHYCA_19606                                                           73.9       4e-14 
PPTG_01148                                                            73.6       4e-14 
SDRG_00948                                                            73.9       4e-14 
PHALS_01293                                                           73.9       4e-14 
PHYKE_2539                                                            72.8       5e-14 
PYAR_18165                                                            72.4       6e-14 
PYIR_25571                                                            72.8       7e-14 
SDRG_16534                                                            73.2       7e-14 
PPTG_03156                                                            73.6       8e-14 
PYU1_G005867                                                          71.2       8e-14 
PPTG_20376                                                            70.9       8e-14 
SDRG_16535                                                            72.8       9e-14 
PHYRA_84947                                                           72.0       1e-13 
PYVX_18175                                                            69.7       1e-13 
PHALS_05110                                                           70.5       1e-13 
PHYCA_132255                                                          68.9       1e-13 
PPTG_03147                                                            72.0       1e-13 
PYAP_22462                                                            70.1       2e-13 
PYU1_G007242                                                          70.9       2e-13 
H257_11264                                                            71.2       2e-13 
PYVX_22511                                                            71.2       2e-13 
H257_11271                                                            72.0       2e-13 
PYAR_17307                                                            70.5       3e-13 
H310_05433                                                            71.2       3e-13 
PHYKE_7446                                                            71.6       3e-13 
PPTG_03140                                                            71.2       4e-13 
PPTG_03143                                                            71.2       4e-13 
SPRG_07797                                                            70.9       4e-13 
H310_05432                                                            70.5       4e-13 
PYVX_20789                                                            70.5       4e-13 
PYU1_G005862                                                          68.6       5e-13 
PHYRA_78165                                                           70.5       5e-13 
PYIW_18794                                                            69.7       6e-13 
PYU1_G005866                                                          68.6       6e-13 
PYAP_16337                                                            69.3       7e-13 
H257_11265                                                            69.7       7e-13 
PHYRA_84732                                                           69.7       7e-13 
PITG_19818                                                            67.4       7e-13 
PHYSO_256017                                                          67.0       8e-13 
PYAR_25093                                                            68.2       8e-13 
PHALS_02037                                                           70.1       9e-13 
PYAR_24818                                                            68.2       9e-13 
PYIR_22136                                                            69.7       9e-13 
HYAP_11925                                                            69.7       1e-12 
PHYSO_318693                                                          70.5       1e-12 
PYU1_G003057                                                          68.2       1e-12 
PHYSO_374518                                                          65.9       1e-12 
PYAP_23455                                                            70.1       1e-12 
PYIW_19601                                                            68.2       2e-12 
PPTG_04803                                                            68.6       2e-12 
PHYSO_525076                                                          69.3       2e-12 
SDRG_17317                                                            65.5       2e-12 
PYIW_16208                                                            68.2       2e-12 
PHYKE_2379                                                            67.8       3e-12 
PYVX_21174                                                            63.9       4e-12 
PYAR_13902                                                            65.5       4e-12 
PYVX_24274                                                            67.0       4e-12 
PHYCA_562062                                                          67.0       4e-12 
PHYRA_86201                                                           67.8       4e-12 
PHYCA_19599                                                           68.2       5e-12 
PHYKE_8104                                                            63.2       5e-12 
SPRG_07826                                                            68.2       5e-12 
PYIW_25642                                                            65.1       5e-12 
PITG_11957                                                            67.8       5e-12 
PHYRA_78164                                                           67.4       5e-12 
PHYKE_7443                                                            67.8       6e-12 
PYAR_14261                                                            64.3       8e-12 
PYAP_16994                                                            66.6       8e-12 
PYIW_17867                                                            67.4       8e-12 
PYAP_20077                                                            66.2       9e-12 
PYU1_G007250                                                          65.1       9e-12 
PHYKE_6066                                                            66.2       1e-11 
SPRG_07796                                                            66.6       1e-11 
PYVX_21643                                                            65.9       1e-11 
PYVX_23997                                                            64.7       1e-11 
PHYCA_10470                                                           65.9       2e-11 
PHYSO_342361                                                          63.2       2e-11 
PYIR_20482                                                            63.2       2e-11 
PITG_11943                                                            63.5       2e-11 
PYIR_16375                                                            65.1       2e-11 
PYU1_G006405                                                          65.5       2e-11 
PITG_11951                                                            63.2       3e-11 
PYVX_24774                                                            63.5       3e-11 
PYVX_21644                                                            63.9       3e-11 
PYU1_G001518                                                          65.5       3e-11 
SPRG_07825                                                            65.5       4e-11 
PYIR_22549                                                            64.7       4e-11 
PPTG_09880                                                            63.5       5e-11 
PHYCA_558591                                                          61.2       5e-11 
PYVX_16673                                                            65.5       6e-11 
PHYRA_78162                                                           65.1       6e-11 
H310_05438                                                            64.3       8e-11 
PHYCA_18729                                                           64.3       9e-11 
PYIW_26655                                                            63.5       9e-11 
PHYSO_257305                                                          62.4       9e-11 
PYVX_18179                                                            61.6       9e-11 
PYIW_23030                                                            63.2       1e-10 
PYAR_16493                                                            63.2       1e-10 
PPTG_07511                                                            62.0       1e-10 
PPTG_06106                                                            63.2       1e-10 
PHYCA_15126                                                           63.5       1e-10 
PYIR_22634                                                            63.2       1e-10 
SDRG_00972                                                            63.5       2e-10 
PYU1_G013346                                                          58.9       2e-10 
PYIR_20850                                                            62.0       2e-10 
PHYRA_79881                                                           62.4       2e-10 
PYIR_20304                                                            61.6       2e-10 
SDRG_17448                                                            62.4       3e-10 
PHYSO_525490                                                          62.8       3e-10 
PYIW_14247                                                            62.0       3e-10 
PYIR_24935                                                            62.0       3e-10 
PHALS_05395                                                           60.5       3e-10 
PYIR_26519                                                            61.6       4e-10 
PYAR_22058                                                            60.5       4e-10 
PHYKE_6067                                                            61.6       6e-10 
PYAR_16632                                                            60.8       6e-10 
PYAR_17163                                                            58.2       6e-10 
PYIR_23622                                                            60.8       7e-10 
PYIW_20715                                                            60.8       9e-10 
PHYCA_19608                                                           60.8       1e-09 
PHYCA_538650                                                          60.5       1e-09 
PYIR_22135                                                            60.5       2e-09 
H257_11306                                                            60.5       2e-09 
PITG_04404                                                            58.9       2e-09 
PHYKE_9024                                                            60.1       2e-09 
PHYCA_122138                                                          58.9       2e-09 
PYIR_26312                                                            57.0       3e-09 
HYAP_01683                                                            59.7       3e-09 
PHYSO_339832                                                          58.9       3e-09 
PHYSO_246472                                                          58.5       4e-09 
PYAP_16347                                                            57.8       4e-09 
PYVX_22512                                                            58.2       5e-09 
PPTG_22744                                                            57.0       5e-09 
PPTG_00482                                                            57.0       5e-09 
PYU1_G006672                                                          53.9       5e-09 
PYU1_G007254                                                          57.4       6e-09 
PYAP_18307                                                            58.2       6e-09 
PYIW_15528                                                            58.5       7e-09 
H257_11258                                                            58.5       8e-09 
PHYRA_77292                                                           56.6       1e-08 
PYAP_25026                                                            57.0       1e-08 
PYU1_G001517                                                          57.8       1e-08 
PYAR_21271                                                            57.0       1e-08 
PYAR_15390                                                            56.2       1e-08 
PHYSO_489485                                                          55.5       2e-08 
PHYCA_15125                                                           57.4       2e-08 
PYU1_G001533                                                          57.0       2e-08 
PYAR_17166                                                            54.3       2e-08 
PPTG_00483                                                            56.6       2e-08 
PHYRA_80632                                                           57.4       2e-08 
PHYKE_9023                                                            57.0       2e-08 
PYAR_21940                                                            56.6       2e-08 
PHYRA_75781                                                           56.2       2e-08 
PYAP_24338                                                            56.6       2e-08 
PYAR_24939                                                            55.1       3e-08 
PYIR_23623                                                            53.9       3e-08 
PHYRA_80631                                                           56.6       3e-08 
PPTG_06249                                                            56.2       4e-08 
PHYSO_457322                                                          54.7       4e-08 
PYAR_24386                                                            54.3       4e-08 
PYAR_15784                                                            54.7       5e-08 
PHYRA_95184                                                           56.6       5e-08 
PHYCA_6388                                                            55.8       6e-08 
PHYCA_97699                                                           55.1       7e-08 

>PYAP_22273
Length=268

 Score = 497 bits (1280),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 268/268 (100%), Positives = 268/268 (100%), Gaps = 0/268 (0%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK
Sbjct  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE
Sbjct  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI
Sbjct  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180

Query  181  YKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDDDAKETPKPETSK  240
            YKACIPLADKNGGGNNKTKVPTPTNKAPAKPTKAPAPKKDDAEVGKDDDAKETPKPETSK
Sbjct  181  YKACIPLADKNGGGNNKTKVPTPTNKAPAKPTKAPAPKKDDAEVGKDDDAKETPKPETSK  240

Query  241  PAAASPKPTEPATLKPSQKPPSCNRRRD  268
            PAAASPKPTEPATLKPSQKPPSCNRRRD
Sbjct  241  PAAASPKPTEPATLKPSQKPPSCNRRRD  268

>PYAR_24096
Length=227

 Score = 300 bits (768),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (88%), Gaps = 0/165 (0%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83
            EAHQRV+ P+VVYT+A+R TNWGPQAKLE QGYKTT DFNAYL AN YKTLR+FMDKPGA
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143
            YK N GAT ECG+TDP AP QPIP +G FRTSGYTHEGPCEIWIDDV VK G NCH+DIS
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            E AFTDKIDYSACKG CMLKWYWLGIRP GK YSWQIYKACIPL+
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PHYCA_14369
Length=248

 Score = 209 bits (533),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 123/192 (64%), Gaps = 5/192 (3%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +    AV+   +  A  AP+   +AHQ V  PE  +T  D+ T + P A LENQG+KT +
Sbjct  5    LVSTLAVVSTLSSIAFLAPTA--DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQ  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DF A+ + NGYK+LRDFMD+   Y    GA   CG+TDP   PQPIP     R++GYTH+
Sbjct  63   DFTAWRNENGYKSLRDFMDR-AKYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHD  121

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+W+DD MV  G NCH     K +T  +DYS+CKG C L+WYWLG+R +   YSWQ+
Sbjct  122  GPCEVWLDDTMVLDGDNCHEKFPGKDYT--VDYSSCKGTCTLRWYWLGVRFLKNAYSWQV  179

Query  181  YKACIPLADKNG  192
            YKACIPLA   G
Sbjct  180  YKACIPLAGSGG  191

>PYU1_G001739
Length=266

 Score = 206 bits (525),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 118/188 (63%), Gaps = 2/188 (1%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY  65
            + L   A+ AL A SV+V+AHQ + FPE  + +  +   W P A LENQG  T+ D   +
Sbjct  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGF  63

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEI  125
            +   GY  LR  MD    Y+ N  A  ECGYTDP    QPIPT G  R++GYTH+GPCE+
Sbjct  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEV  123

Query  126  WIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACI  185
            W+DDV V SG NCH     K F   +DYS+CKG C L+WYWLG+R + K+YSWQIYK C+
Sbjct  124  WLDDVKVMSGDNCHDKFPGKTF--PLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECV  181

Query  186  PLADKNGG  193
             L+D   G
Sbjct  182  SLSDNASG  189

>PPTG_10636
Length=246

 Score = 204 bits (520),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 141/242 (58%), Gaps = 24/242 (10%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY  65
            A+  AT ++++   + + +AHQ V  PE  +T  D+ T + P A LENQG+KT +DF ++
Sbjct  8    ALAVATTLSSMALLAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSW  67

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEI  125
             + N YK+LRDFMD    Y+   GA   CG+TDP   PQPIP     R++GYTH+GPCE+
Sbjct  68   RNENNYKSLRDFMDN-AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEV  126

Query  126  WIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACI  185
            W+DD MV  G+NCH     K +T  +DYS+CKG C L+WYWLGIR +  +YSWQ+YKACI
Sbjct  127  WLDDTMVLDGENCHEKFPGKDYT--VDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACI  184

Query  186  PLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDDDAKETPKPETSKPAAAS  245
            PL+   G G                  +A          G +   + TP PE+  PAA +
Sbjct  185  PLS---GSG------------------EATPTTSGSGTQGTERTMQATPAPESQAPAAET  223

Query  246  PK  247
            P 
Sbjct  224  PS  225

>PPTG_10635
Length=199

 Score = 202 bits (513),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 118/178 (66%), Gaps = 5/178 (3%)

Query  15   ALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTL  74
            AL AP  + +AHQ V  PE  +T  D+ T + P A LENQG+KT +DF ++   NGYK+L
Sbjct  2    ALLAP--MADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSL  59

Query  75   RDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKS  134
            RDFMD+   Y+   GA   CG+TDP   PQPIP     R++GYTH+GPCE+W+DD MV  
Sbjct  60   RDFMDR-AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLD  118

Query  135  GKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNG  192
            G NCH     K +T  +DYS+CKG C L+WYWLG+R +   YSWQ+YKACIPL    G
Sbjct  119  GDNCHEKFPGKDYT--VDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGAG  174

>PHYCA_102852
Length=195

 Score = 201 bits (512),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 122/187 (65%), Gaps = 5/187 (3%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +     V    +  AL AP+   +AHQ V  PE  +T  D+ T + P A LEN+G+ T +
Sbjct  5    LVSTLTVASTLSSMALLAPTA--DAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQE  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DF A+ + NGYK+LRDFMD+   Y   +GA  +CG+TDPN  PQPIP     R++GYTH+
Sbjct  63   DFTAWRTENGYKSLRDFMDR-AKYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHD  121

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+W+DD MV  G+NCH     K +T  IDYS+CKG C L W+WLG+R +   YSWQ+
Sbjct  122  GPCEVWLDDTMVLDGENCHEKFPGKGYT--IDYSSCKGTCTLYWFWLGVRFLKNDYSWQV  179

Query  181  YKACIPL  187
            YKACIPL
Sbjct  180  YKACIPL  186

>PHYSO_341599
Length=185

 Score = 201 bits (511),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 118/174 (68%), Gaps = 5/174 (3%)

Query  15   ALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTL  74
            A+ AP+   +AHQ V  PE  +T  D++T + P A LENQG+KT +DF A+   NGYK+L
Sbjct  2    AMLAPTA--DAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSL  59

Query  75   RDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKS  134
            RDFMD+   Y    GA   CG+TDP   PQPIP   + R++GYTH+GPCE+W+DD MV  
Sbjct  60   RDFMDR-AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLD  118

Query  135  GKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            G NCH     K +T  +DYS+CKG C L+WYWLG+R +   YSWQ+YKACIPL 
Sbjct  119  GDNCHEKFPGKDYT--VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  170

>PHYKE_7718
Length=220

 Score = 201 bits (511),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 118/187 (63%), Gaps = 5/187 (3%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYL  66
            V+ A  IAAL AP  + +AHQ V  PE  +T  D+ T + P A LE +G+   +DF A+ 
Sbjct  15   VVPAETIAALLAP--IADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWR  72

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIW  126
              NGYK+LRDFMD    Y    GA   CG+TDPN  PQPIP     R++GYTH+GPCE+W
Sbjct  73   IENGYKSLRDFMDN-AKYSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVW  131

Query  127  IDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIP  186
            IDD +     NCH     K +T  IDYSACKG C L+WYWLG+R +   YSWQ+YKACIP
Sbjct  132  IDDTLAMGNDNCHEAFPGKDYT--IDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIP  189

Query  187  LADKNGG  193
            L    GG
Sbjct  190  LTGSGGG  196

>PHYCA_102550
Length=268

 Score = 202 bits (515),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 118/192 (61%), Gaps = 5/192 (3%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +     V    +  AL AP+    AHQ V  P   +   +R T   P A LE+QG+KT +
Sbjct  5    LVSTLTVASTLSSMALLAPTAT--AHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQ  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DF A+ + NGYK+LRDFMD+   Y    GA  +CGYTDPN  PQPIP     R++GYTH+
Sbjct  63   DFTAWRNENGYKSLRDFMDR-AKYTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHD  121

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+WIDD MV  G NCH     K +T  IDYS CKGKC L WYWLG+R +   YSWQ+
Sbjct  122  GPCEVWIDDTMVMEGDNCHEKFPGKGYT--IDYSPCKGKCTLYWYWLGVRFLKNSYSWQV  179

Query  181  YKACIPLADKNG  192
            YK CIPLA   G
Sbjct  180  YKECIPLAGSGG  191

>PYIR_26546
Length=239

 Score = 201 bits (512),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 120/188 (64%), Gaps = 5/188 (3%)

Query  10   ATAIAALTAPSVLVE----AHQRVYFPEVVYTLADRKTNWGPQAKLENQ-GYKTTKDFNA  64
            AT+   L AP VL++    AHQ V  P+  +T+  +   W P A LE Q G+    DFN 
Sbjct  8    ATSTFLLAAPLVLLDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNG  67

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            YLS+ G+KT+R+FMD    Y+    A  +CGYT  +  PQPIP N + RT+GYTHEGPCE
Sbjct  68   YLSSKGFKTMREFMDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCE  127

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            IW+DDV V  GKNCHYD++      K+D+S+C GKC + WYW+GIR  GK  SWQIYK C
Sbjct  128  IWLDDVKVFYGKNCHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKEC  187

Query  185  IPLADKNG  192
            IPL    G
Sbjct  188  IPLIGHGG  195

>PYAP_22278
Length=289

 Score = 202 bits (515),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 115/169 (68%), Gaps = 4/169 (2%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPG  82
            V+AHQRV  P   +T  DR  NW P A LENQG K   D   +L + G KTLRD+MD   
Sbjct  22   VDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKA  81

Query  83   AYKAN-KGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSG--KNCH  139
             YK   +GA+ ECGYT+PN   QPIP NG  R++GYTH+GPCE+W+D+  V      NCH
Sbjct  82   NYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCH  141

Query  140  YDISEKAFTDKIDYSACKGKCMLKWYWLGIRPM-GKKYSWQIYKACIPL  187
             D+  KA + KID+S CKG CML+WYWLG R + GKK+SWQIYKAC+PL
Sbjct  142  RDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PYU1_G001740
Length=206

 Score = 200 bits (508),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 113/169 (67%), Gaps = 4/169 (2%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81
            + +AHQ V  P   +T+  +   W P A LENQGYKTT DFNAY  + GYK+LR FMD  
Sbjct  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83

Query  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141
             AYK N  A  ECGYT+ N   QPIP N  FRT+GYTH+GPCE+W+D+  V SG NCH D
Sbjct  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141

Query  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADK  190
               K  T  + Y+ACKG C L+WYW+GIR +  K+SWQ+YK C+PL  K
Sbjct  142  FPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRK  188

>PYIR_25089
Length=262

 Score = 201 bits (511),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 121/186 (65%), Gaps = 6/186 (3%)

Query  6    AVLGATAIAALTAPSVL----VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61
            +V  + A+AA+ + + L    V+AHQ V  P   +T+  R   + P A LENQG+KTT D
Sbjct  4    SVTKSLALAAIVSSAALYDTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTAD  63

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEG  121
            F+AY  A GYKTLR FMD   AYK   GA  ECG+T     PQPIP+    R++GYTH+G
Sbjct  64   FDAYYKAKGYKTLRAFMDDKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDG  123

Query  122  PCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            PCE+W+D   V  G NCH +     F  KIDYS+CKG C+L+WYW+GIR +  +YSWQ+Y
Sbjct  124  PCEVWLDKTRVLKGTNCHSEFPGTTF--KIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVY  181

Query  182  KACIPL  187
            K C+P+
Sbjct  182  KNCVPV  187

>PHYRA_84190
Length=206

 Score = 199 bits (505),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 119/178 (67%), Gaps = 5/178 (3%)

Query  15   ALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTL  74
            AL AP+   +AHQ V  PE  +T  D+ T + P A LEN+G+ T +DF A+ + NGYK+L
Sbjct  2    ALLAPTA--DAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSL  59

Query  75   RDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKS  134
            RDFMD    Y    GA   CG+TDP   PQPIP +   R++GYTH+GPCE+W+DD MV  
Sbjct  60   RDFMDN-AKYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLD  118

Query  135  GKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNG  192
            G+NCH     K +T  +DYS+CKG C L+WYW+G+R + + YSWQ+YK CIPL   +G
Sbjct  119  GENCHEKFPGKDYT--VDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSG  174

>PHALS_00498
Length=199

 Score = 198 bits (504),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 120/189 (63%), Gaps = 5/189 (3%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
             AV+   +   L AP+V   AHQ V  PE  +   D+ T + P A LENQ +KTT D  A
Sbjct  9    LAVVSTMSSVVLLAPNV--AAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQA  66

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            Y   N +KTLRDFMD    Y   KGA   CG+TDPN  PQPIP N   R++GYTH+GPCE
Sbjct  67   YFKQNHFKTLRDFMDN-AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCE  125

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W+++  V S  NCH     K +T  IDYS+CK  C+L+WYWLG+R + +KYSWQ+YKAC
Sbjct  126  VWLNNTRVLSASNCHEKFPGKDYT--IDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKAC  183

Query  185  IPLADKNGG  193
            IPL+    G
Sbjct  184  IPLSRSAKG  192

>PPTG_10634
Length=208

 Score = 198 bits (503),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 122/185 (66%), Gaps = 4/185 (2%)

Query  4    LFAVLGATA-IAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDF  62
            L + LG  A ++++   ++ V+AHQ V  PE  +T  D++T + P A LEN+G+ T +DF
Sbjct  5    LVSTLGVAATLSSMALLALTVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDF  64

Query  63   NAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGP  122
             A+   NGYK+LRDF+D    Y    GA  +CG+TDP   PQPIP     R++GYTH+GP
Sbjct  65   TAWRKENGYKSLRDFLDN-AKYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGP  123

Query  123  CEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYK  182
            CE+W+DD MV  G NCH     K +T  +DYS+CKG C L WYWLG+R +   YSWQ+YK
Sbjct  124  CEVWLDDTMVLDGDNCHEKFPGKDYT--VDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYK  181

Query  183  ACIPL  187
            ACIPL
Sbjct  182  ACIPL  186

>PHYRA_85631
Length=228

 Score = 198 bits (504),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 118/188 (63%), Gaps = 5/188 (3%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
             AV    +  AL AP+   +AHQ V  PE  +T  D+ T + P A LEN+G+ T +DF +
Sbjct  9    LAVASVLSSMALLAPTA--DAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFAS  66

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            +   NGYK+LRDFMD    Y    GA   CG+TDP   PQPIP     R++GYTH+GPCE
Sbjct  67   WRDENGYKSLRDFMDN-AKYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCE  125

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W+DD MV  G NCH     K +T  +DYS+CKG C L+WYWLGIR +   YSWQ+YK C
Sbjct  126  VWLDDTMVLDGDNCHEKFPGKDYT--VDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKEC  183

Query  185  IPLADKNG  192
            IPL   +G
Sbjct  184  IPLTGGSG  191

>PHYKE_3446
Length=199

 Score = 197 bits (500),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 5/187 (3%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +  +F V+ A + AA+ AP  + +AHQ V  PE  +    ++  + P A LENQG+ T +
Sbjct  5    LASVFTVVAALSGAAVIAP--ITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQE  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            D NA+   NGYKTLR FMD    Y+  +GA   CG+TDPN   QPIP  G  R++GYTH+
Sbjct  63   DANAWRRDNGYKTLRAFMDM-AKYQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHD  121

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+WID+  V    NCH  I+ K +T  IDYSAC+G CML+WYWLG+R +   YSWQ+
Sbjct  122  GPCEVWIDNTRVLESGNCHETITGKDYT--IDYSACQGTCMLRWYWLGVRFLKNSYSWQV  179

Query  181  YKACIPL  187
            YKACIPL
Sbjct  180  YKACIPL  186

>PHYSO_536424
Length=197

 Score = 196 bits (497),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 112/166 (67%), Gaps = 3/166 (2%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPG  82
            +  HQ V  PE ++T  D++T + P A LEN+G+ T +DF A+   NGYK+LRDFMD+  
Sbjct  20   ITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-A  78

Query  83   AYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDI  142
             Y    GA   CG+TDP   PQPIP   + R++GYTH+GPCE+W+DD MV  G NCH   
Sbjct  79   KYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  138

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
              K +T  +DYS+CKG C L+WYWLG+R +   YSWQ+YKACIPL 
Sbjct  139  PGKDYT--VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  182

>PHYSO_507031
Length=197

 Score = 196 bits (497),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 112/166 (67%), Gaps = 3/166 (2%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPG  82
            +  HQ V  PE ++T  D++T + P A LEN+G+ T +DF A+   NGYK+LRDFMD+  
Sbjct  20   ITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-A  78

Query  83   AYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDI  142
             Y    GA   CG+TDP   PQPIP   + R++GYTH+GPCE+W+DD MV  G NCH   
Sbjct  79   KYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  138

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
              K +T  +DYS+CKG C L+WYWLG+R +   YSWQ+YKACIPL 
Sbjct  139  PGKDYT--VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  182

>PYIR_26626
Length=212

 Score = 196 bits (498),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 124/188 (66%), Gaps = 8/188 (4%)

Query  6    AVLGATAIAALTAPSVL----VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61
            +V+ + A+AA+ + + L    V+AHQ V  P   +T  D+   W P A LENQGYKTT D
Sbjct  4    SVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTAD  63

Query  62   FNAYLSANGYKTLRDFMDKPGAYKAN-KGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            FN Y+ + GYKTLR FMD   AYK +  GA  ECGYT+ N   QPIP  G  R++GYTH+
Sbjct  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHD  122

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+W+D+  V SG NC+ D   K  T  I Y++CKG C L+WYW+G+R +  K+SWQ+
Sbjct  123  GPCEVWLDNTKVMSGTNCNKDFPGK--THSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180

Query  181  YKACIPLA  188
            YK C+P+ 
Sbjct  181  YKECVPIG  188

>PPTG_17122
Length=204

 Score = 195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 123/187 (66%), Gaps = 8/187 (4%)

Query  6    AVLGATAIAALTAPSVLV----EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61
            ++L + ++AA+ + + L+     AHQ V  P   YT  ++ T + P A LENQGY+T +D
Sbjct  4    SLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVED  63

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEG  121
            FN +   NGYKTLRDFMD+   Y    GA   CG+T+ NA PQPIP +G  R++GYTH+G
Sbjct  64   FNGWRRNNGYKTLRDFMDR-AKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDG  121

Query  122  PCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            PCE+W+D   V    NCH  IS K +   +DYS+C G C L+WYWLG+R +   YSWQIY
Sbjct  122  PCEVWLDTKRVLQSDNCHETISGKTY--NLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179

Query  182  KACIPLA  188
            KACIPL+
Sbjct  180  KACIPLS  186

>PHYKE_8389
Length=204

 Score = 194 bits (492),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 119/184 (65%), Gaps = 5/184 (3%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
             +V    + AAL AP+   +AHQ V  P   YT  D+ T + P A LENQG++T  DFNA
Sbjct  8    LSVAAVLSSAALLAPTA--DAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNA  65

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            +   NGYKTLR FMD    Y    GA   CG+T+ +A PQ IP+    R++GYTH+GPCE
Sbjct  66   WRRNNGYKTLRAFMDG-AKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCE  124

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W+D   V +  NCH  IS K +T  IDYS+C G C L+WYWLG+R +  +YSWQ+YKAC
Sbjct  125  VWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKAC  182

Query  185  IPLA  188
            +PL+
Sbjct  183  VPLS  186

>PPTG_15264
Length=194

 Score = 193 bits (490),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 124/185 (67%), Gaps = 6/185 (3%)

Query  6    AVLGATAIAALTAPSVL-VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
            +++   A+AA  + +VL  +AHQ V  PE  +T  ++   + P A LE QG++T +DFNA
Sbjct  4    SLVSTLAVAATLSCAVLSTDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNA  63

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            +   NGYKTLRDFMD+   Y   +GA   CG+TDP   PQPIP  G  R++GYTH+GPCE
Sbjct  64   WRRDNGYKTLRDFMDR-AKYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCE  122

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSAC--KGKCMLKWYWLGIRPMGKKYSWQIYK  182
            +W+DDV V  G NCH  I  K +T  IDYS+C  KG C+L+WYWLG+R +   YSWQ+YK
Sbjct  123  VWLDDVRVLEGGNCHESIPGKDYT--IDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYK  180

Query  183  ACIPL  187
             CIPL
Sbjct  181  ECIPL  185

>PPTG_17366
Length=194

 Score = 193 bits (490),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 124/185 (67%), Gaps = 6/185 (3%)

Query  6    AVLGATAIAALTAPSVL-VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
            +++   A+AA  + +VL  +AHQ V  PE  +T  ++   + P A LE QG++T +DFNA
Sbjct  4    SLVSTLAVAATLSCAVLSTDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNA  63

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            +   NGYKTLRDFMD+   Y   +GA   CG+TDP   PQPIP  G  R++GYTH+GPCE
Sbjct  64   WRRDNGYKTLRDFMDR-AKYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCE  122

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSAC--KGKCMLKWYWLGIRPMGKKYSWQIYK  182
            +W+DDV V  G NCH  I  K +T  IDYS+C  KG C+L+WYWLG+R +   YSWQ+YK
Sbjct  123  VWLDDVRVLEGGNCHESIPGKDYT--IDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYK  180

Query  183  ACIPL  187
             CIPL
Sbjct  181  ECIPL  185

>PYU1_G001742
Length=213

 Score = 193 bits (491),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 110/167 (66%), Gaps = 3/167 (2%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83
            +AHQ V  P   +T+  R   + P A LENQGYKTT DFNAY  A GYKTLR FMD P A
Sbjct  26   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKA  85

Query  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143
            YK   GA  +CG+T  +   QPIP  G  R++GYTH+GPCE+W+D   V  G NCH +  
Sbjct  86   YKVAAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFP  144

Query  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADK  190
               F  KIDYS+CKG C L+WYW+GIR +  KYSWQ+YK C+P+  K
Sbjct  145  GTTF--KIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK  189

>PPTG_10643
Length=250

 Score = 194 bits (492),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 122/193 (63%), Gaps = 7/193 (4%)

Query  4    LFAVLGATAIAALTAPSVLV----EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTT  59
            + +V+ A A+AA  +   LV    +AHQ V  PE  +T  D+ T + P A LENQG+K  
Sbjct  2    VHSVVQACAVAATLSGMALVLPTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQ  61

Query  60   KDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTH  119
            +DF A+   NGYK+LRDFMD+   Y+   GA   CG+T+P   PQPIP  G  R++GYTH
Sbjct  62   EDFAAWSKENGYKSLRDFMDR-AKYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTH  120

Query  120  EGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQ  179
            +GPCE+++DD +V  G NCH     K     IDYS+CKG C L+WYWLGIR +   YSWQ
Sbjct  121  DGPCEVYLDDTLVLQGDNCHEKFPGKDC--PIDYSSCKGTCTLRWYWLGIRFLKNAYSWQ  178

Query  180  IYKACIPLADKNG  192
            +YK CIPL    G
Sbjct  179  VYKECIPLVGSGG  191

>PYAP_22279
Length=223

 Score = 192 bits (488),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 108/165 (65%), Gaps = 4/165 (2%)

Query  26   HQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYK  85
            HQR+  P    T  DR T   P A LENQG K T D   YL   G KTLRDFMD    YK
Sbjct  22   HQRITIPAPTLT-TDRNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  86   ANK-GATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDD--VMVKSGKNCHYDI  142
                GAT ECGYTDPN   QPIP+NG  R++GYTH+GPCE+W+D+  V+  +  +CH DI
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             +   + KID+S CKG CML+WYWL  R +G K+SWQ+YK C+PL
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PPTG_14255
Length=268

 Score = 193 bits (490),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 142/246 (58%), Gaps = 21/246 (9%)

Query  11   TAIAALTAPSVL-VEAHQRVYFPEVVYTLA-----DRKTNWGPQAKLENQGYKTTKDFNA  64
            T++A L++  +L  +AHQ VY P   +T A     +R+  W P + LE +GY T ++F  
Sbjct  6    TSVAVLSSTLLLQTQAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQ  65

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            Y   NGYK+LRDFMD    Y    GA   CG+TDP   PQ IP +G  RTSGYTH+GPCE
Sbjct  66   YQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCE  124

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            I++ D +  S  NCH  I+++ F  K+DYSAC   C+L WYWLG+R + KKYSWQ+YK C
Sbjct  125  IYMGDTLALSYLNCHESITDQTF--KLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKEC  182

Query  185  IPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDDDAKETPKPETSKPAAA  244
            IPL   +GG           +   +    A AP+ D   VG    + ETP   T  P ++
Sbjct  183  IPLYSGSGGA---------PSTEVSAAGSAAAPEADSTTVGS---SNETPTESTEAPTSS  230

Query  245  SPKPTE  250
            + +P E
Sbjct  231  TIEPVE  236

>PHYCA_102624
Length=195

 Score = 191 bits (484),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 115/191 (60%), Gaps = 5/191 (3%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +     V    +  AL AP+    AHQ V  P+  +   +R T   P   LE  G+KT  
Sbjct  5    LVSTLVVASTLSSMALLAPTA--TAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQA  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DF A+   NGYK+LRDFMD    Y  ++GA  +CG+TDPN  PQPIP     R++GYTH+
Sbjct  63   DFTAWRKENGYKSLRDFMDN-AKYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHD  121

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+WIDD MV  G NCH     K +T  IDYS CKGKC L WYWLG+R +  +YSWQ+
Sbjct  122  GPCEVWIDDTMVMEGDNCHEKFPGKDYT--IDYSPCKGKCTLYWYWLGVRFLKNRYSWQV  179

Query  181  YKACIPLADKN  191
            YK CIPL  + 
Sbjct  180  YKECIPLTSEQ  190

>PHYRA_82864
Length=193

 Score = 190 bits (482),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 118/186 (63%), Gaps = 6/186 (3%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
             AV    A AAL AP+   +AHQ V  PE  +T  ++ T + P A LE QG+ T  DFNA
Sbjct  9    LAVATGLASAALLAPTA--DAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNA  66

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            +   NGYKTLRDFMD+   Y   +GA   CG+TDPN  PQPIP  G  R++GYTH+GPCE
Sbjct  67   WRRDNGYKTLRDFMDR-AKYTVTEGADYFCGWTDPNGTPQPIPA-GNMRSTGYTHDGPCE  124

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W+D+  V  G NCH    +K +   IDYS+CKG C L WYW+G+R +   YSWQ+YK C
Sbjct  125  VWLDNTRVLQGDNCHEQFPDKDY--PIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKEC  182

Query  185  IPLADK  190
            I L  +
Sbjct  183  ISLTSQ  188

>PHYKE_8388
Length=205

 Score = 187 bits (475),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 119/192 (62%), Gaps = 9/192 (5%)

Query  1    MTRLFA----VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGY  56
            MT  FA    V    + AAL AP  +  AHQ V  P   YT  D+ T + P A LE+QG+
Sbjct  1    MTPSFASSLLVAAVLSSAALIAP--IANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGF  58

Query  57   KTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSG  116
             T +DF A+ S NGY +LR F D   +Y  + GA   CG+TD N   QPIP +   R++G
Sbjct  59   STQEDFTAWRSDNGYASLRAFNDD-ASYTVSDGADFTCGFTDINGAAQPIPDDNAMRSTG  117

Query  117  YTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKY  176
            YTH+GPCE+W+DD MV    NCH  IS K +T  IDYS+C   C L W+W+G+R +  +Y
Sbjct  118  YTHDGPCEVWLDDTMVMQYNNCHDSISGKDYT--IDYSSCTSTCTLYWFWMGVRYLKNEY  175

Query  177  SWQIYKACIPLA  188
            SWQ+YKAC+PL+
Sbjct  176  SWQVYKACVPLS  187

>PYU1_G001744
Length=213

 Score = 187 bits (474),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 110/167 (66%), Gaps = 3/167 (2%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83
            +AHQ V  P   +T+  R   + P A LENQG+KTT DFNAY  A GYK+LR FMD   A
Sbjct  26   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKA  85

Query  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143
            YK   GA  +CG+T  +   QPIP  G  R++GYTH+GPCE+W+D+ +V  G NCH +  
Sbjct  86   YKVAAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFP  144

Query  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADK  190
                T KI Y++CKG C L+WYW+GIR +  KYSWQ+YK C+P+  K
Sbjct  145  --GTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK  189

>PHYSO_477820
Length=202

 Score = 186 bits (472),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYL  66
            V   +A A L+  ++L  AHQ V  P   YT  D+ T + P A LE+QG+ T +DF A+ 
Sbjct  6    VSSLSAAAVLSGAALLAGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWR  65

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIW  126
            + NGY +LR F D   +Y    GA   CG+T+ N   QPIP +   R++GYTH+GPCE+W
Sbjct  66   TDNGYDSLRAFNDG-ASYTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVW  124

Query  127  IDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIP  186
            +DD MV    NCH  IS K +T  IDYS+C   C L W+WLG+R +  +YSWQIYKAC+P
Sbjct  125  LDDTMVMQYDNCHESISGKDYT--IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVP  182

Query  187  LA  188
            L+
Sbjct  183  LS  184

>PYU1_G001741
Length=199

 Score = 185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 114/186 (61%), Gaps = 6/186 (3%)

Query  6    AVLGATAIAALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDF  62
            ++  +    AL + + L    +AHQ V  P   +T+  R   + P A LENQG++TT DF
Sbjct  4    SITKSLVFGALVSSATLYNTADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADF  63

Query  63   NAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGP  122
            NAY  A GYKTLR FMD   AY    GA  ECG+T  +   Q IP  G  R++GYTH+GP
Sbjct  64   NAYYKAKGYKTLRAFMDDKKAYTVASGADFECGWTKLDGTRQSIPA-GTIRSTGYTHDGP  122

Query  123  CEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYK  182
            CE+W+D   V  G NCH + +    T  IDYS+CKG C L+WYW+GIR +  +YSWQ+YK
Sbjct  123  CEVWLDSTRVMKGNNCHTEFTGT--THTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYK  180

Query  183  ACIPLA  188
             C+P+ 
Sbjct  181  NCVPIG  186

>PHYCA_510817
Length=188

 Score = 184 bits (468),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 120/189 (63%), Gaps = 11/189 (6%)

Query  7    VLGATAIAALTAPSVLV---EAHQRVYFPEVVYTL-----ADRKTNWGPQAKLENQGYKT  58
            +L + +  A+   S+L+   EAHQ VY P   +T       +R+  W P + LE +G+KT
Sbjct  1    MLSSLSTLAVIGSSMLLQSTEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKT  60

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYT  118
             ++F  Y   NGYK+LRDFM+K   YK + GA   CG++DP   PQ IP++G  RTSGYT
Sbjct  61   QENFTQYQVDNGYKSLRDFMEK-AKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYT  119

Query  119  HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSW  178
            H+GPCEIW+ D +  S  NCH  I E+ F  K+DYS C   C+L WYWLG+R +  KYSW
Sbjct  120  HDGPCEIWMGDKLALSYLNCHESIPEQTF--KLDYSGCGDSCILYWYWLGVRKLKGKYSW  177

Query  179  QIYKACIPL  187
            Q+YK CIPL
Sbjct  178  QVYKECIPL  186

>PHYSO_417649
Length=185

 Score = 184 bits (467),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 120/188 (64%), Gaps = 12/188 (6%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLA-----DRKTNWGPQAKLENQGYKTT  59
             AV+G+    AL   S+ VEAHQ VY P   +T A     +R+  W P + LE +G+KT 
Sbjct  4    IAVIGS----ALALQSLSVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQ  59

Query  60   KDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTH  119
            ++F  Y   NGYK+LRDFM++   YK   GA   CG+TDP   PQ IP +G  RTSGYTH
Sbjct  60   ENFTQYQVDNGYKSLRDFMER-AKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTH  118

Query  120  EGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQ  179
            +GPCEI++ D +  S  NCH  I+++ F  K+DYS C   C+L WYWLG+R +  K+SWQ
Sbjct  119  DGPCEIYMGDKLALSYLNCHESITDQTF--KLDYSGCGDSCILYWYWLGVRKLKGKFSWQ  176

Query  180  IYKACIPL  187
            +YK CIPL
Sbjct  177  VYKECIPL  184

>PITG_18450
Length=203

 Score = 184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 116/187 (62%), Gaps = 11/187 (6%)

Query  6    AVLGATAIAALTAPSVLV----EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61
            +V  +  +AA+ +   L+     AHQ V  P   YT  D+ T + P   LE QGY+T +D
Sbjct  4    SVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVED  63

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEG  121
            FN +   NGYKTLRDFM+    Y    GA   CG+T+ NA PQP P +G  R++GYTH+G
Sbjct  64   FNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDG  118

Query  122  PCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            PCE+W+D   V    NCH  I  K +   +DYS+CKG C L+WYWLG+R +   YSWQIY
Sbjct  119  PCEVWLDSTRVLQSDNCHETIIGKTY--NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIY  176

Query  182  KACIPLA  188
            KACIPL+
Sbjct  177  KACIPLS  183

>PYVX_18173
Length=500

 Score = 192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 107/165 (65%), Gaps = 3/165 (2%)

Query  25   AHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAY  84
            AHQ V  P   YT+  +   W P A LE Q + TT DF  YL ANG+ +LR FMD    Y
Sbjct  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293

Query  85   KANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISE  144
              N  A   CG+TDP+A PQPIP +G  R++GYTH+GPCE+W+DD  V    NCH  IS 
Sbjct  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352

Query  145  KAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLAD  189
            K +   +DYSAC G C L WYWLG+R + + YSWQ+YKAC+P++D
Sbjct  353  KTY--DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPISD  395

 Score = 157 bits (397),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 94/162 (58%), Gaps = 2/162 (1%)

Query  27   QRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKA  86
            Q V +P   + +        P A LE QG  T  +   +L+  GY TLR  MD  G Y  
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  87   NKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKA  146
             +    +CG T PN   QPIPTNG F TSGYT +GPCEIWID+ +  +G+NCH +  E  
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  147  FTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
             T  IDYS C   C + W+WLGI+  G++YSWQ++K CI L+
Sbjct  158  HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197

>PPTG_10048
Length=190

 Score = 183 bits (464),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 112/183 (61%), Gaps = 5/183 (3%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
            F  L   + AAL  P  L EAHQ V  P   +   +R T   P A LE+QG+KT +DF +
Sbjct  6    FIKLCGLSAAALAWP--LTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKS  63

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            +   NGYKTLRDFM+    Y   +GA   CG+T+P   PQPIP  G  R++GYTHEGPCE
Sbjct  64   WRIQNGYKTLRDFMEH-AKYTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCE  122

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W+ D  V    NCH  +  K +   IDYS CKG C+L WYWLG+R +   YSWQ+YK C
Sbjct  123  MWVADTQVYQADNCHVSLPGKEY--PIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKEC  180

Query  185  IPL  187
            IPL
Sbjct  181  IPL  183

>PHYRA_81107
Length=202

 Score = 182 bits (462),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 3/182 (2%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYL  66
            V   +A   L++ ++L +AHQ V  P   YT  D+ T + P A LE+QG+ T +DF A+ 
Sbjct  6    VSSLSAGIVLSSAALLADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWR  65

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIW  126
              NGY +LR F D   +Y  + GA   CG+TD N   Q IP     R++GYTH+GPCE+W
Sbjct  66   EENGYDSLRAF-DDGASYTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVW  124

Query  127  IDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIP  186
            +DD MV    NCH  IS K +T  IDYS+C   C L W+W+G+R +   YSWQ+YKAC+P
Sbjct  125  LDDTMVMQYDNCHEVISGKDYT--IDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVP  182

Query  187  LA  188
            L+
Sbjct  183  LS  184

>PHYRA_81106
Length=202

 Score = 181 bits (460),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 108/167 (65%), Gaps = 3/167 (2%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81
            + +AHQ V  P   YT   + T + P A LENQG++T  DFNA+  +NGYKTLR FMD  
Sbjct  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-  82

Query  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141
              Y    GA   CG+T+ +A PQ IP     R++GYTH+GPCE+W+D   V +  NCH  
Sbjct  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            IS K +T  IDYS+C G C L WYW+G+R +   YSWQ+YKAC+PL+
Sbjct  143  ISGKDYT--IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187

>PHYSO_284086
Length=204

 Score = 181 bits (459),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 108/165 (65%), Gaps = 4/165 (2%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83
            +AHQ V  P   YT  D+ T + P A LENQGY+T +DFNA+    GYKTLR FMD   +
Sbjct  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-AS  84

Query  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143
            Y    GA   CG+TD     QPIP +G  R++GYTH+GPCE+W+D   V    NCH   S
Sbjct  85   YTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143

Query  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
             K +   +DYS+CKG C L+WYWLG+R +  +YSWQ+YKAC+PL+
Sbjct  144  GKTY--DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186

>PHYCA_129425
Length=204

 Score = 181 bits (459),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 4/165 (2%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83
            +AHQ V  P   YT  ++ T + P A LE+QG+KT +DFN +  +NGYKTLR FMD    
Sbjct  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84

Query  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143
            Y    GA   CG+T+  A PQPIP +G  R++GYTH+GPCE+W+D   V    NCH    
Sbjct  85   YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143

Query  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
             K +   +DYS+CKG CML+WYWLG R +  ++SWQ+YKACIPL+
Sbjct  144  GKTY--NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186

>PHALS_03284
Length=188

 Score = 180 bits (457),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 111/177 (63%), Gaps = 5/177 (3%)

Query  12   AIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGY  71
            +  AL AP+V+  AHQ +  PE  +   D+ T + P A LENQ + T+ DF  YL  N Y
Sbjct  2    STVALLAPNVI--AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNY  59

Query  72   KTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVM  131
             +LRDF+ K   Y   +GA  +CG+TDPN  PQPIP     R +GYTH+G CE+W+DD  
Sbjct  60   NSLRDFL-KRANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTK  118

Query  132  VKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            V SG NCH D   K     +DYS+CK  C++ WYWL +R +  +YSWQ+YKACIPL 
Sbjct  119  VLSGSNCHNDFPGKDC--PVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLT  173

>PPTG_17121
Length=202

 Score = 181 bits (458),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 115/179 (64%), Gaps = 4/179 (2%)

Query  10   ATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSAN  69
            +TA+  L++ ++L  AHQ V      YT  D+ T + P A LE+QG+ T +DF A+   N
Sbjct  10   STAVV-LSSATLLANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDN  68

Query  70   GYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDD  129
            GY +LR F D   +Y  + GA + CG+T+ N   QPIP     R++GYTH+GPCE+W+DD
Sbjct  69   GYDSLRAFNDG-ASYTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDD  127

Query  130  VMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
             MV    NCH  IS K +T  IDYS+C   C L W+WLG+R +  +YSWQIYKAC+PL+
Sbjct  128  TMVMQYDNCHEAISGKYYT--IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  184

>PHYKE_9185
Length=281

 Score = 182 bits (461),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 115/188 (61%), Gaps = 12/188 (6%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTL-----ADRKTNWGPQAKLENQGYKTT  59
             AVLG+ A+   +      EAHQ VY P   +T       +R+  W P + LE +G KT 
Sbjct  8    LAVLGSAALLQYST----TEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQ  63

Query  60   KDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTH  119
            ++F  Y   N Y +LRDFMDK   YK + GA   CG+TDP   PQ IP +G  RTSGYTH
Sbjct  64   ENFTQYQVDNNYASLRDFMDK-AKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTH  122

Query  120  EGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQ  179
            +GPCEI++ D +  S  NCH  I+++ F  K+DYSAC   C+L WYWLG+R +   YSWQ
Sbjct  123  DGPCEIYMGDKLALSYLNCHESITDQTF--KLDYSACGDSCILYWYWLGVRKLKGSYSWQ  180

Query  180  IYKACIPL  187
            IYK CIPL
Sbjct  181  IYKECIPL  188

>PPTG_14254
Length=188

 Score = 176 bits (445),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 117/188 (62%), Gaps = 14/188 (7%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLA-----DRKTNWGPQAKLENQGYKTT  59
             AVLG++ +   T      EAHQ V  P   +T A     +R+  W P + LE +G+KT 
Sbjct  8    LAVLGSSMLLHAT------EAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQ  61

Query  60   KDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTH  119
            ++F  +   NGYK+LRDFMD+   YK  +GA   CG+TDP   PQ IP +G  RT+GYTH
Sbjct  62   ENFTQFQVDNGYKSLRDFMDR-AKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTH  120

Query  120  EGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQ  179
            +GPCEI++ + +  S  NCH  I E+ F  K+DYS C   C+L WYWLG+R +  KYSWQ
Sbjct  121  DGPCEIYMGEKLALSYLNCHESIPEQTF--KLDYSGCGDSCILYWYWLGVRKLKGKYSWQ  178

Query  180  IYKACIPL  187
            +YK CIP+
Sbjct  179  VYKECIPI  186

>PHYCA_511409
Length=204

 Score = 176 bits (446),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 106/167 (63%), Gaps = 3/167 (2%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81
            L +AHQ V  P   YT  D+ T + P A LE+QG+ T +DF A+   NGY +LR F D  
Sbjct  23   LADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDG-  81

Query  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141
             +Y  + GA   CG+T+ N   Q IP     R++GYTH+GPCE+W+DD MV    NCH  
Sbjct  82   ASYTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEA  141

Query  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            IS K +T  IDYS+C   C L W+WLG+R +  +YSWQIYKAC+PL+
Sbjct  142  ISGKDYT--IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  186

>PHYSO_499978
Length=174

 Score = 174 bits (442),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 5/160 (3%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYL  66
            V G  + AAL AP+   +AHQ V  PE  +T  D++T + P A LENQG+ T +DF  + 
Sbjct  11   VAGVLSSAALLAPTA--DAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWR  68

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIW  126
            + NGYKTLRDFMD  G Y   KGA   CG+TDP   PQPIP     R++GYTH+GPCE+W
Sbjct  69   TKNGYKTLRDFMDH-GKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVW  127

Query  127  IDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYW  166
            ID+  V  G NCH  I++K +T  IDYSACKG C L+WYW
Sbjct  128  IDNTRVLQGDNCHEKIADKGYT--IDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 174 bits (442),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 5/160 (3%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYL  66
            V G  + AAL AP+   +AHQ V  PE  +T  D++T + P A LENQG+ T +DF  + 
Sbjct  11   VAGVLSSAALLAPTA--DAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWR  68

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIW  126
            + NGYKTLRDFMD  G Y   KGA   CG+TDP   PQPIP     R++GYTH+GPCE+W
Sbjct  69   TKNGYKTLRDFMDH-GKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVW  127

Query  127  IDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYW  166
            ID+  V  G NCH  I++K +T  IDYSACKG C L+WYW
Sbjct  128  IDNTRVLQGDNCHEKIADKGYT--IDYSACKGTCTLRWYW  165

>PHYCA_536934
Length=983

 Score = 189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 116/183 (63%), Gaps = 9/183 (5%)

Query  11   TAIAALTAPSVL-VEAHQRVYFPEVVYTLA-----DRKTNWGPQAKLENQGYKTTKDFNA  64
            T+IA L +  +L  EAHQ VY P   +T A     +R+  W P + LE +GY T ++F  
Sbjct  23   TSIAVLGSALLLQTEAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQ  82

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
            Y   NGYK LRDFMD    Y    GA   CG++DPN  PQ IP +G  RTSGYTH+GPCE
Sbjct  83   YQVDNGYKNLRDFMDN-AKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCE  141

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            IW+ D +  S  NCH  I+++ F  K+DYS C   C+L WYWLG+R + KKYSWQ+YK C
Sbjct  142  IWMGDKLALSYLNCHESITDQTF--KLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKEC  199

Query  185  IPL  187
            IPL
Sbjct  200  IPL  202

>PYVX_18174
Length=204

 Score = 174 bits (440),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 109/168 (65%), Gaps = 6/168 (4%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81
            + +AHQ V  PE  +T  DR   + P A LE+QG++T +DFNA+  +NGYKTLR FMD+ 
Sbjct  24   VADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQ-  82

Query  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141
             +Y    GA   CG+T+ +  PQPIP N  FR++GYTH+GPCEIW+D   V +  NCH  
Sbjct  83   ASYTVTDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEA  140

Query  142  ISEKAFTDKIDYS-ACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            IS K     IDYS    G C L WYW+G+R +   YSWQ+YK C+PL+
Sbjct  141  ISGK--DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLS  186

>PYIW_18791
Length=194

 Score = 172 bits (435),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 105/165 (64%), Gaps = 4/165 (2%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83
            +AHQ V  P+  +T+A + T W P + LE  G KT++  + ++   GY TLR  MD    
Sbjct  20   DAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKL  79

Query  84   YKANKGA-TVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDI  142
            YK N  A    CGYTDP+   Q IP +   RT+GYTH GPCE+WIDD  V +G NCH  +
Sbjct  80   YKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQV  139

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            S    T K+DYS CKG+C ++WYWLG+R + KK+SWQ+YK CI L
Sbjct  140  SN---TTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  181

>PYU1_G001738
Length=226

 Score = 169 bits (427),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 103/177 (58%), Gaps = 4/177 (2%)

Query  11   TAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANG  70
             A+A L+A  V V A  +V +PE  Y +   +    P A LE QG KT+ D + ++   G
Sbjct  9    VALALLSA--VAVHAQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKG  66

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDV  130
            Y  LR  +D    Y  N  A  ECGYTDP    QPIP    F ++GY   GPCE+W+DD+
Sbjct  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDL  126

Query  131  MVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             V S  NCH       F   +DYS+CKG CML+WYWLGI+P+ + YSWQ+YK C+ L
Sbjct  127  KVMSDMNCHTKYPGTNFM--LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYSO_262732
Length=188

 Score = 164 bits (415),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 111/189 (59%), Gaps = 23/189 (12%)

Query  12   AIAALTAPSVL-VEAHQRVYFPEVVYT-----LADRKTNWGPQAKLENQGYKTTKDFNAY  65
            ++A + +  VL  EAHQ VY P   +T      A+R+  W P A LENQG++T       
Sbjct  7    SLAVVGSALVLQAEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTH------  60

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEI  125
                    LRDFMD    Y   +GA   CG+TDP    Q IP++G  RTSGYTH+GPCEI
Sbjct  61   --------LRDFMDN-AKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEI  111

Query  126  WIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACI  185
            ++ D +  S  NCH  I+++ F  K+DYS C   C L WYWLG+R +  KYSWQ+YK CI
Sbjct  112  YMGDKLALSYLNCHESITDQTF--KLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECI  169

Query  186  PLADKNGGG  194
            P+   +GGG
Sbjct  170  PIYSGSGGG  178

>PYVX_18176
Length=201

 Score = 164 bits (414),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 104/167 (62%), Gaps = 4/167 (2%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81
            + +AHQ V  P   +   D+   + P A LE+QG+ T +DF A+ S NGY +LR FMD  
Sbjct  21   VADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDG-  79

Query  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141
             +Y    GA   CG+T+ +   Q +P +G  R++GYTH GPCE+W+DD MV    NCH  
Sbjct  80   ASYTVTDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDS  138

Query  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            IS K +   +DYS+C   C L W+W+G+R +  +YSWQ+YK C+PL+
Sbjct  139  ISGKTY--DLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLS  183

>PPTG_08820
Length=250

 Score = 164 bits (415),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 116/185 (63%), Gaps = 10/185 (5%)

Query  11   TAIAALTAPSVL---VEAHQRVYFPEVVYT--LADRKTNWGPQAKLENQGYKTTKDFNAY  65
            T + AL   ++L   V+AHQ +  PE ++   + DR T W P A LE+QG+    DFN +
Sbjct  10   TVVVALFGSALLTLTVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGW  69

Query  66   LSANGYKTLRDFMDKPG-AYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCE  124
             + +GYK LRDFMD+         GA   CG T+   PP+PIP +G  +++GYTH+GPC 
Sbjct  70   RAQSGYKNLRDFMDRAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCA  129

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSAC--KGKCMLKWYWLGIRPMGKKYSWQIYK  182
            +++DD +V    NCH  +  K++  KIDYS+C  KG C L W+WLGIR +  ++SWQ+YK
Sbjct  130  VYLDDELVLEYDNCHEKLPGKSY--KIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYK  187

Query  183  ACIPL  187
             C+PL
Sbjct  188  ECVPL  192

>PHYSO_343376
Length=172

 Score = 160 bits (405),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 3/131 (2%)

Query  36   YTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECG  95
            +T  D++T + P A LENQG+ T +DF A+ + NGYKTLRDFMD  G Y   KGA   CG
Sbjct  36   WTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDH-GKYTVTKGADFSCG  94

Query  96   YTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSA  155
            +TDP   PQPIP     R++GYTH+GPCE+WID+  V  G NCH  I++K +T  IDYSA
Sbjct  95   WTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYT--IDYSA  152

Query  156  CKGKCMLKWYW  166
            CKG C L+WYW
Sbjct  153  CKGTCTLRWYW  163

>PHYSO_527908
Length=174

 Score = 157 bits (397),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 106/175 (61%), Gaps = 12/175 (7%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTN-----WGPQAKLENQG  55
            M    AVLG+    AL   S+ V+AHQ V+ P   +T A+  +      W P A LE QG
Sbjct  1    MLTSIAVLGS----ALMLQSLSVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQG  56

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            + T  +F  ++  NGYK+LRDFMD  G Y   KGA   CG+TDPN  PQ IP +G  RTS
Sbjct  57   FTTQANFTQFMVDNGYKSLRDFMDN-GNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTS  115

Query  116  GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIR  170
            G+TH+ PCEI++ D +  S  NCH  I+ + F  K+DYSAC   C+L WYWLG+R
Sbjct  116  GFTHDDPCEIYMGDKLSLSYPNCHESITSQPF--KLDYSACGDSCVLYWYWLGVR  168

>PITG_13520
Length=171

 Score = 156 bits (394),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 97/157 (62%), Gaps = 5/157 (3%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +    AV    +  AL AP+   +AHQ V  PE  +T  D+ T + P A LENQG+KT +
Sbjct  5    LVSTLAVASTLSSIALLAPTA--DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQ  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DF A+   NGYK+LRDFMD+   Y    GA   CG+TDP   PQPIP  G  R++GYTH+
Sbjct  63   DFKAWRDENGYKSLRDFMDR-AKYDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHD  121

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACK  157
            GPCE+W+DD MV  G NCH     K +T  +DYS+CK
Sbjct  122  GPCEVWLDDKMVLDGDNCHEKFPGKDYT--VDYSSCK  156

>PYIW_18788
Length=244

 Score = 153 bits (387),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 101/170 (59%), Gaps = 3/170 (2%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81
            +V A+ +V +PE  + L     +    A+LE+Q   T+ D   +L   GY +LR  +D  
Sbjct  23   VVVANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDE  82

Query  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141
              Y  N  +  ECGYTDP    QPIPTNG+ R +GY  +GPCEIWIDD+ + S  NC  D
Sbjct  83   TLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKD  142

Query  142  ISEKAFTDKIDYSACKGKCMLKWYWLGI-RPMGKKYSWQIYKACIPLADK  190
                  + K+DYS+CKG+C L+WY L + +  G  YSW++YK C+ L+D+
Sbjct  143  F--PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDE  190

>PITG_10499
Length=323

 Score = 154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 102/161 (63%), Gaps = 7/161 (4%)

Query  32   PEVVYT--LADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPG-AYKANK  88
            PE ++   + DR T W P A LE+QG+   +DFN + + NGYK LRDFMD+         
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  89   GATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFT  148
            GA   CG T+   PP+PIP +G  R++GYTH+GPC I++DD +V    NCH  I  + + 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTY-  122

Query  149  DKIDYSAC--KGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             KID+S+C  KG C L W+WLGIR +  ++SWQ+YK CI L
Sbjct  123  -KIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYSO_254168
Length=170

 Score = 147 bits (372),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 97/152 (64%), Gaps = 20/152 (13%)

Query  38   LADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYT  97
            + D+ T + P A LE QG+ T + F+A    NGYKTLRDFMD+ G Y   +GA   CG+T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDR-GKYTVTQGADYFCGWT  86

Query  98   DPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSAC-  156
            +P   PQPIP     R++GYTH+GPCEIW+DDV V           E++ T  IDYS+C 
Sbjct  87   NPKGTPQPIP-----RSTGYTHDGPCEIWLDDVRVL----------ERSPT--IDYSSCE  129

Query  157  -KGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             KG C + WYWLG+R +   YSWQ+YK CIPL
Sbjct  130  KKGGCTMHWYWLGVRFLKNSYSWQVYKECIPL  161

>PPTG_17123
Length=201

 Score = 145 bits (366),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 2/140 (1%)

Query  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108
            A L+ QG  T+ +  +++  +GY +LR  +D    YK  + A  ECG T P    QPIPT
Sbjct  59   AYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPT  118

Query  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
            N  F+TSGYT +GPCE+W+DD  V SG+NCH +        ++DYS+C   C L WYWLG
Sbjct  119  NNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ--HEVDYSSCGKACTLSWYWLG  176

Query  169  IRPMGKKYSWQIYKACIPLA  188
            I+ +   YSWQ+YK C+ L+
Sbjct  177  IKYIEGIYSWQVYKNCVGLS  196

>PHYCA_537323
Length=200

 Score = 144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 87/140 (62%), Gaps = 2/140 (1%)

Query  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108
            A L+ QG  T+ +  +++  +GY +LR  +D    Y+  + A  ECG T P    QPIPT
Sbjct  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPT  117

Query  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
            N  F+TSGYT +GPCE+W+DD  V +G+NCH +  +     ++DYS+C   C L WYWLG
Sbjct  118  NNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ--HQVDYSSCGESCTLSWYWLG  175

Query  169  IRPMGKKYSWQIYKACIPLA  188
            I+ +   YSWQ+YK C+ L 
Sbjct  176  IKYVEGIYSWQVYKNCVGLG  195

>PHYSO_353401
Length=146

 Score = 142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 2/140 (1%)

Query  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108
            A L+ QG  T+ +  +++  +GY +LR  +D    YK  + A  +CG T P    QPIP+
Sbjct  4    AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63

Query  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
            N  F+TSGYT +GPCE+W+DD  V +G+NCH          +IDYSAC   C L WYWLG
Sbjct  64   NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ--HEIDYSACGDSCTLWWYWLG  121

Query  169  IRPMGKKYSWQIYKACIPLA  188
            I+ +   YSWQ+YK C+ L+
Sbjct  122  IKYVEGAYSWQVYKNCVALS  141

>PHYRA_81105
Length=201

 Score = 142 bits (359),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 2/140 (1%)

Query  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108
            A L+ QG  T+ +   ++  +GY +LR  +D    Y+  + A  +CG T P    Q IPT
Sbjct  59   AYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPT  118

Query  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
            N  F++SGYT +GPCE+W+DD    +G+NCH +        +IDYSAC   CML+WYWLG
Sbjct  119  NSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG--QHQIDYSACGAACMLRWYWLG  176

Query  169  IRPMGKKYSWQIYKACIPLA  188
            I+ +   YSWQ+YK CI L 
Sbjct  177  IKYVEGAYSWQVYKNCIALG  196

>PITG_18452
Length=856

 Score = 150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 87/140 (62%), Gaps = 2/140 (1%)

Query  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108
            A L+ QG  T+ +  +++   GY +LR  +D    YK  + A  ECG T P    QPIPT
Sbjct  714  AYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPT  773

Query  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
            N  F+TSGYT +GPCEIW+DD  V SG+NCH +        ++DYS+C G C L WYWLG
Sbjct  774  NNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ--HQVDYSSCGGSCHLSWYWLG  831

Query  169  IRPMGKKYSWQIYKACIPLA  188
            I+ +   YSWQ+YK C+ L+
Sbjct  832  IKYVEGIYSWQVYKNCVGLS  851

>PYAP_18131
Length=226

 Score = 137 bits (345),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 5/113 (4%)

Query  78   MDKPGAYKANK-GATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGK  136
            MD    YK    GAT ECG TDPN P QPIP NG  R++G+TH+G   +WID+  V   K
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  137  --NCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
              NCH  I +   + KID+S CKG CM++WYWLG+R +GKK+SWQ+YKACIP+
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

>HYAP_07096
Length=251

 Score = 136 bits (343),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 100/188 (53%), Gaps = 5/188 (3%)

Query  4    LFAVLGATAIAALTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61
            LF +L  +    +T   +   +   Q V +P   + + D        A L+ QG  T+ +
Sbjct  61   LFHLLALSLSVCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIE  120

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTD-PNAPPQPIPTNGEFRTSGYTHE  120
              ++   +GY +LR  +D    Y  +K A  +CG+T  P+   Q IPTNG   +SGYT +
Sbjct  121  AQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLD  180

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            GPCE+W DD  V SG+NC  +        ++DYS+C   C L+WYWLGI+ M   YSWQ+
Sbjct  181  GPCEVWFDDTQVTSGRNCRTEFPHGQ--HQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQV  238

Query  181  YKACIPLA  188
            YK CI L 
Sbjct  239  YKNCIGLG  246

>PHYSO_341596
Length=231

 Score = 133 bits (334),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 88/148 (59%), Gaps = 11/148 (7%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTK  60
            +T+  AV  A +  A+ AP+   +AHQ V        L D+ T + P A LENQG++T +
Sbjct  5    ITQTLAVASALSSMAMLAPTA--DAHQIV--------LLDKDTKYNPLAFLENQGFETQE  54

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHE  120
            DF ++   NGYK+LRDFMDK   Y    GA   CG+TDP   PQPIP     R++GYTH+
Sbjct  55   DFASWRDKNGYKSLRDFMDK-AKYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHD  113

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFT  148
            GPCE+W+DD  V  G NCH     K +T
Sbjct  114  GPCEVWLDDTKVLEGDNCHEKFPGKDYT  141

>PHYCA_14368
Length=219

 Score = 129 bits (323),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 95/194 (49%), Gaps = 50/194 (26%)

Query  1    MTRLFAVLGATA--IAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKT  58
            M   FA+  A A  +++L       EAHQ V  PE  +T  D+ T + P A LENQG+KT
Sbjct  1    MVHSFALTFAVASTLSSLALLDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  60

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYT  118
             +DF ++ + N YK+LRDFMD    Y    GA   CG+TDP                   
Sbjct  61   QQDFASWRTENNYKSLRDFMDN-AKYTVTDGADFSCGFTDP-------------------  100

Query  119  HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSW  178
                                      K +T  +DYS+CKG C L+WYWLGIR +  +YSW
Sbjct  101  --------------------------KDYT--VDYSSCKGTCTLRWYWLGIRFLKNQYSW  132

Query  179  QIYKACIPLADKNG  192
            Q+YKACIPL+   G
Sbjct  133  QVYKACIPLSGSGG  146

>PHYSO_340369
Length=200

 Score = 128 bits (321),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 100/192 (52%), Gaps = 23/192 (12%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTN-----WGPQAKLENQG  55
            M+ LF+       A +  P++   A+Q V+ P   +T A+  T+     W P A  E+QG
Sbjct  1    MSSLFSSFVVLLGAFVLHPAI-TRANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQG  59

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            + T+ +F  +   NG+KTLRDFMD  G Y                  PQ IP +   RT 
Sbjct  60   FNTSSNFTQWQLTNGFKTLRDFMDN-GNYSVTS--------------PQQIPDDNIMRTY  104

Query  116  GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKK  175
            GYT +GPCEIW+D+ +  S  +C   +    +T  +DYS C   C++ WY LG+    + 
Sbjct  105  GYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYT--LDYSGCGASCVMYWYTLGVAKPDRV  162

Query  176  YSWQIYKACIPL  187
            YSW++YK CIPL
Sbjct  163  YSWEVYKECIPL  174

>PHYSO_342364
Length=194

 Score = 124 bits (312),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 99/201 (49%), Gaps = 23/201 (11%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWG-------PQAKLEN  53
            M    A+  A  I A + P    +AH  +Y P+  +      + W        P      
Sbjct  1    MKTTAAIASAAVIMAASMPGA--DAHGYIYVPQSQF-FGGENSQWSVQIPPVWPSNDWYG  57

Query  54   QGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGE-F  112
               K+ + FN+  +++ YK LR  +D    Y  N      CGYT+PN  PQPIPTNG+  
Sbjct  58   NTQKSVQVFNSLKTSHNYKDLRTLLDNTAVYGPN------CGYTNPNGTPQPIPTNGKAI  111

Query  113  RTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSACK--GKCMLKWYW  166
             + G  H GPCEIW+DD  V +  +C+          K    +DYS CK  G CM+++YW
Sbjct  112  FSRGLIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYW  171

Query  167  LGIRPMGKKYSWQIYKACIPL  187
            LG + +GKK  WQ YK CIPL
Sbjct  172  LGFQALGKKTVWQTYKNCIPL  192

>PHYSO_246676
Length=187

 Score = 117 bits (293),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 86/177 (49%), Gaps = 41/177 (23%)

Query  16   LTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLR  75
            +  P+   +AHQ V  PE  +T  D+ T + P A LENQG+KT +DF A+   NGY+TLR
Sbjct  1    MALPAPTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLR  60

Query  76   DFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSG  135
            DFMDK   Y    GA   CG+TDP   PQPIP   + R++GYTH+G     +   +V  G
Sbjct  61   DFMDK-AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG----LVHASLVLDG  115

Query  136  KNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNG  192
                                                M   YSW++YKACIPL+   G
Sbjct  116  ------------------------------------MKNSYSWKVYKACIPLSGSGG  136

>PYU1_G007476
Length=195

 Score = 115 bits (287),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 93/179 (52%), Gaps = 21/179 (12%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKT----TKDFNAYLSANGYKTLRDFM  78
            VEAH  +  P V +      +NW  + K    G+ +      DF       GYKTLR F+
Sbjct  23   VEAHGYIRQPLVAFKGGRTTSNWIKEDKPAWAGFSSWNNYMNDFARISKQKGYKTLRSFL  82

Query  79   DKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF----RTSGYTHEGPCEIWIDDVMVKS  134
            +       NKGA+  CGYT+PN  P+ IP +G+        G+ H GPCE+W+D+ M+  
Sbjct  83   E-------NKGAS--CGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGPCELWLDNKMILH  133

Query  135  GKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGG  193
              NC            +D+S+CKG CML+ YWLG +  G++  WQ YK C+P+  K GG
Sbjct  134  KDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQDQGQR--WQTYKYCVPV--KKGG  188

>PYAP_18709
Length=235

 Score = 111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 98/179 (55%), Gaps = 24/179 (13%)

Query  21   VLVEAHQRVYF--PEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAYLSANGYKTLRDF  77
             + + H  VY   P   +     K++W  + +    G +KT   + A     G+K LR F
Sbjct  16   FVADVHAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSF  75

Query  78   MDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGYTHEGPCEIWIDDVMVKSGK  136
            ++       +KG T  CG + PNA P+PIP++G  +  S   H GPCE+W+D+      +
Sbjct  76   LE-------DKGPT--CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNT-----R  121

Query  137  NCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKN  191
              H D  EKAF    + K+D+ ACKG CML++YWLG++  GK+  WQ YK CIPL DKN
Sbjct  122  AFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGKR--WQSYKNCIPLNDKN  178

>PYIR_16444
Length=182

 Score = 108 bits (269),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 97/193 (50%), Gaps = 14/193 (7%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRK-TNWGPQAKLENQG-YKT  58
            M     V+   A+A        V+AH  V  P+  +       + W  +      G +K 
Sbjct  1    MVSALQVIATVALATTAVTIPQVDAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKD  60

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GY  117
             K+F       G+ TLR +++       NKGA   CG T+  A P+PIP++G+   S   
Sbjct  61   PKNFAKVAKQKGFPTLRSYIE-------NKGAI--CGKTNAKATPKPIPSDGKVHFSRAI  111

Query  118  THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYS  177
             H GPCE+W+D+  V    NC      K    KID+S+CKG CML+++WLG++  GK+  
Sbjct  112  VHPGPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQDQGKR--  169

Query  178  WQIYKACIPLADK  190
            WQ+YK C+P+  K
Sbjct  170  WQVYKNCVPVKGK  182

>PYIW_18792
Length=125

 Score = 105 bits (263),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (58%), Gaps = 1/120 (1%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY  65
            ++  +  +A   + + LV+AHQ V  P   +T+  R   + P A LE QGYK T DF AY
Sbjct  4    SITKSLVLAVAVSSAALVDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAY  63

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEI  125
              + GYK LR FMD   AYK + G   ECG++     PQPIP  G  R++GYTH+GP  I
Sbjct  64   YKSKGYKNLRGFMDDKKAYKVD-GGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PYIW_27477
Length=180

 Score = 106 bits (264),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 78/140 (56%), Gaps = 15/140 (11%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            +K   +F       G++TLR +++  GA         +CG TDPNA  + IP++   + S
Sbjct  35   WKDPANFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFS  85

Query  116  -GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGK  174
                H GPCE+WIDD  V    NC      K  T KID+SACKGKCML+W+WLG++  GK
Sbjct  86   RAIVHPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGK  145

Query  175  KYSWQIYKACIPLADKNGGG  194
            +  WQ+Y   IP  D  G G
Sbjct  146  R--WQVY---IPGHDHQGPG  160

>PYIR_16435
Length=304

 Score = 107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 73/128 (57%), Gaps = 12/128 (9%)

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTH  119
            +F       GY TLR +++  G           CG T+P+A P+ IP++   + S    H
Sbjct  66   NFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVH  116

Query  120  EGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQ  179
             GPCE+W+DD  V    NC      K  T KID+S+CKG CML+W+WLG++  G++  WQ
Sbjct  117  PGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGER--WQ  174

Query  180  IYKACIPL  187
            +YK C+PL
Sbjct  175  VYKNCVPL  182

>PYU1_G005323
Length=251

 Score = 105 bits (262),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 95/188 (51%), Gaps = 23/188 (12%)

Query  9    GATAIAALTAPSV-LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAYL  66
            G  A  AL A  V   E H  +  P   +     K++W  +      G ++T   + A  
Sbjct  5    GVIASLALVATFVHQAEGHVYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAVA  64

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGYTHEGPCEI  125
               GYK L+ F++  G           CG + P+A  +PIP++G  +  S   H GPCE+
Sbjct  65   PGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEV  115

Query  126  WIDDVMVKSGKNCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            W DDV     +  H D  EK F    + K+D+SACKG CML++YWLG++  GK+  WQ Y
Sbjct  116  WFDDV-----RAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGKR--WQSY  168

Query  182  KACIPLAD  189
            K CIPL D
Sbjct  169  KNCIPLTD  176

>PYIR_16443
Length=275

 Score = 105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 13/131 (10%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            +K  K+F       G++TLR +++  GA          CG T+PNA P+ IP++   + S
Sbjct  58   WKDPKNFATVSKQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFS  108

Query  116  -GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGK  174
                H GPCEIW+DD  V    NC      K  T KID+S+CKG CML+W+WLG++  GK
Sbjct  109  RAIVHPGPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGK  168

Query  175  KYSWQIY-KAC  184
            +  WQ+Y K+C
Sbjct  169  R--WQVYSKSC  177

>PHYSO_483955
Length=320

 Score = 106 bits (264),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 100/212 (47%), Gaps = 30/212 (14%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTN-WGPQAKLENQ---GY  56
            M    ++L   A  A T     V+AH  +  PE  +   D+KTN W    ++E Q   G+
Sbjct  1    MVSSTSILAMVAAVATTID--YVQAHGYIAKPEPSW--KDKKTNDW--VVEIEPQWKGGW  54

Query  57   KTTKD-------FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN  109
              +K        F    +AN YK +R  MD    Y        +CG+TDP   P   PT+
Sbjct  55   DESKGDEGLLATFKELSAANNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTD  108

Query  110  GEFRTS-GYTHEGPCEIWIDDVMVKSGKNCHYDISEK-----AFTDKIDYSAC-KGKCML  162
            G    S G  H GPCEIW+DD MV    +C     +      A    +DYS+C  G CML
Sbjct  109  GTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCML  168

Query  163  KWYWLGIRPMGKKYSWQIYKACIPLADKNGGG  194
            ++YWL ++ +  K  WQ YK CIPL    GGG
Sbjct  169  RFYWLALQRLDGKTVWQAYKNCIPLTGPAGGG  200

>PYAP_18711
Length=210

 Score = 103 bits (256),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 13/134 (10%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRT-  114
            ++T   ++A     G K LR F++  G          ECG T+PNA  +PIP++G  +  
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFG  105

Query  115  SGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGK  174
            S   H GPCE+W D+ +V S  +C       A   KIDYS CKG CML++YWLG++  GK
Sbjct  106  SSMEHPGPCEVWFDNTLVFSEVDCEKRFGS-ATQFKIDYSKCKGNCMLRFYWLGLQDGGK  164

Query  175  KYSWQIYKACIPLA  188
            +  WQ YK C+P+ 
Sbjct  165  R--WQSYKNCVPIG  176

>PPTG_04619
Length=276

 Score = 104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/284 (31%), Positives = 134/284 (47%), Gaps = 31/284 (11%)

Query  4    LFAVLGATAIAALTAPSV-LVEAHQRVYFPEVVYTLADRKTN-W----GPQAKLENQGYK  57
            + + +   A+A+  A S   V+AH  V  PE  +   D+KT+ W     PQ K +    K
Sbjct  1    MVSSMSIVAVASAIAMSANYVQAHGYVENPESEF--KDKKTSEWIVQIDPQWKGDWDNAK  58

Query  58   TTKDFNAYL----SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR  113
              +   A      ++N  K +R  +D   +         +CGYT+P+  P+  PT+G   
Sbjct  59   GDEGLVALYKELKASNNAKDIRTLLDSDTSLYG-----ADCGYTNPDVTPKDPPTDGTAT  113

Query  114  TS-GYTHEGPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYW  166
             S G  H GPCEIW+DD MV    +C     D +++  +    +DYS+C  G CM ++YW
Sbjct  114  FSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYW  173

Query  167  LGIRPMGKKYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGK  226
            L ++ +  K  WQ+YK CIPL+   GGG ++T   T      ++ + +       +E   
Sbjct  174  LALQRLDGKTYWQVYKNCIPLSGPAGGGTSQTTPSTGDGSGTSQTSTSSGE----SEAQT  229

Query  227  DDDAKETPKPETSKPAAASPKPTEPATLKPSQKP-PS--CNRRR  267
               A  TP  + SK    +P P  P+   P   P PS  CN RR
Sbjct  230  TPSAPSTPTSDNSKSTETTPAPETPSVETPEVTPAPSSKCNGRR  273

>PYIR_23585
Length=240

 Score = 102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 89/183 (49%), Gaps = 14/183 (8%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK-TTKDFNAY  65
            VL   A+ A+T P V   AH  +  P+  +     +++W  +      G K +  DF   
Sbjct  7    VLATLALTAVTVPQV-ANAHGYIATPKSEFKSGASQSSWVAEFSSPWGGSKWSAADFAKT  65

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCE  124
                G+ T R F++  G           CG T  NA P+PIP++   + S    H GPCE
Sbjct  66   APGKGFATTRAFLESRGP---------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCE  116

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +WID+  V    +C         T KID+SACKG CML++YWLG++  G ++  Q Y  C
Sbjct  117  LWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSKC  174

Query  185  IPL  187
            + L
Sbjct  175  LAL  177

>PHYCA_130365
Length=266

 Score = 103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 90/285 (32%), Positives = 134/285 (47%), Gaps = 42/285 (15%)

Query  7    VLGATAIAALTAPSVLV---EAHQRVYFPEVVYTLADRKTNWGPQAKLENQ---GYKTTK  60
            ++ +T+I AL +    V   +AH  +  PE  +    + ++W    ++E Q   G+  +K
Sbjct  1    MVSSTSILALVSAVATVDYVQAHGYIAKPEPSWK-GKKTSDW--VVEIEPQWKGGWDESK  57

Query  61   D-------FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR  113
                    F    ++N YK +R  MD    Y        +CG+TDPN  P   PT+G   
Sbjct  58   GDEGLLATFKELAASNNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTAT  111

Query  114  TS-GYTHEGPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYW  166
             S G  H GPCEIW+DD MV    +C     D ++   +    +DYS+C  G CML++YW
Sbjct  112  FSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYW  171

Query  167  LGIRPMGKKYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDA---E  223
            LG++ +  K  WQ YK CIPL             P+  +        + +P  DD+    
Sbjct  172  LGLQRLDGKTVWQAYKNCIPLTGPA----GGGGSPSTGDSNSPSSGNSDSPSTDDSGSPS  227

Query  224  VGKDDDAKETPKPETSKPAAASPKPTEPATLKPSQKPPSCNRRRD  268
             G + D + TP PE+  P+  +P+ T PA   PS K     RRRD
Sbjct  228  KGDEADVQTTPAPES--PSVDTPEVT-PA---PSTKCNGRRRRRD  266

>PHALS_05392
Length=367

 Score = 104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 72/140 (51%), Gaps = 13/140 (9%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F    +AN +K +R  MD    Y        +CGYTDPN  P   P+NGE   S G  H 
Sbjct  150  FKELATANNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHA  203

Query  121  GPCEIWIDDVMVKSGKNCHYDISEK-----AFTDKIDYSACKGK-CMLKWYWLGIRPMGK  174
            GPCEIW+DD MV    +C     +      A    +DYS+C    CML++YWL ++ +  
Sbjct  204  GPCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDG  263

Query  175  KYSWQIYKACIPLADKNGGG  194
            K  WQ YK CIPL    GGG
Sbjct  264  KTVWQAYKNCIPLNGPAGGG  283

>PHYKE_6001
Length=289

 Score = 103 bits (256),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 75/139 (54%), Gaps = 13/139 (9%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            FNA   AN Y  L+  MD    Y A      +CG+TDPN  PQPIP++G+   S    H 
Sbjct  66   FNALKKANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHV  119

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSACKGKCM--LKWYWLGIRPMGK  174
            GPCEIW+DD MV S ++C+     +    K    +DYS+C G     +++YWL  + +  
Sbjct  120  GPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDG  179

Query  175  KYSWQIYKACIPLADKNGG  193
            K  WQ YK CIPL    GG
Sbjct  180  KTVWQSYKNCIPLEGSGGG  198

>PYAP_24689
Length=252

 Score = 101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 76/134 (57%), Gaps = 13/134 (10%)

Query  57   KTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TS  115
            +T   ++A    +G KTLR F++  G           CG T+PNA  +PIP +G  +  S
Sbjct  59   RTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFGS  109

Query  116  GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKK  175
               H GPCEIW D+  V    +C+      A   KIDYS C+GKC+L++YWLG++  GK+
Sbjct  110  SMEHPGPCEIWFDNTRVFVDADCNKRFG-SATQFKIDYSKCRGKCLLRFYWLGLQDGGKR  168

Query  176  YSWQIYKACIPLAD  189
              WQ YK C+PL +
Sbjct  169  --WQSYKNCVPLGN  180

>PHYRA_73582
Length=326

 Score = 102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 100/209 (48%), Gaps = 25/209 (12%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQ-AKLENQGYKTT  59
            M    ++L   A AA T     V+AH  +  P   +   +   +W  + A L   G+  +
Sbjct  1    MVSTTSILAMVAAAATTID--YVQAHGYIANPAPTWK-KEETNDWVVEIAPLWKGGWDES  57

Query  60   KDFNAYLSA-------NGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF  112
            K  +  L+        N YK L+  MD P   +       +CG+TDPN  P   PT+G  
Sbjct  58   KGDDGILAVFKELSATNNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTA  110

Query  113  RTS-GYTHEGPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSACK-GKCMLKWY  165
              S G  H GPCEIW+DD MV    +C     D +++  +    +DYS C  G C+L++Y
Sbjct  111  TFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFY  170

Query  166  WLGIRPMGKKYSWQIYKACIPLADKNGGG  194
            WL ++ +  K  WQ YK CIPL    GGG
Sbjct  171  WLALQRLDGKAVWQSYKNCIPLTGPAGGG  199

>PYAR_14260
Length=212

 Score = 100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 82/144 (57%), Gaps = 25/144 (17%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-T  114
            +KT   + A     G+K LR F++       +KG T  CG +  +A P+PIP++G  +  
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLE-------SKGPT--CGNSLSSAKPKPIPSDGMVKFA  81

Query  115  SGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIR  170
            S   H GPCEIW+D+ M       H D  EK F    + K+++SACKG CML++YWLG++
Sbjct  82   STLEHPGPCEIWLDETMA-----FHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ  136

Query  171  PMGKKYSWQIYKACIPLADKNGGG  194
              G +  WQ YK C+PL    GGG
Sbjct  137  DSGTR--WQSYKNCVPL----GGG  154

>PITG_11936
Length=333

 Score = 102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 96/206 (47%), Gaps = 23/206 (11%)

Query  7    VLGATAIAALTAPSVLV---EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK------  57
            VLG +++AA+ A ++LV   + H  +  P+V +T     T +         G+       
Sbjct  2    VLGKSSLAAIAASTMLVSTAKGHGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGS  61

Query  58   ---TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP------T  108
                T +FN   +A+ YK+L++FM+       N+  T ECGYT+P+A PQP+P      +
Sbjct  62   PTDNTANFNKGFAASKYKSLKEFMND-NMVLVNEDFTKECGYTNPDATPQPLPKTYVEWS  120

Query  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
            +G       +HEGPCE++ D+  V    NC  +          D+ AC G   L  YW+ 
Sbjct  121  HGAGEGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIA  180

Query  169  IRPMGKKYSWQIYKACIPLADKNGGG  194
            +       SWQ+Y  C PL      G
Sbjct  181  LH----SPSWQVYINCAPLEKTTSTG  202

>PHYSO_485524
Length=278

 Score = 101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 103/204 (50%), Gaps = 23/204 (11%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVY---TLADRKTNWGPQAKLENQGYKTTKDF  62
            ++L AT   AL+  +V  +AH  V  PE  +     ++      PQ K +  G K  +  
Sbjct  6    SILAATLAVALSVNTV--QAHGYVEKPESEFKDKISSEWIVQIDPQWKGDWDGAKGDEGL  63

Query  63   NAYL----SANGYKTLRDFMDK-PGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-G  116
             A       +N  K +R  +D     Y AN      CGYT+P+A P+  PT+G    S G
Sbjct  64   VALYKELKDSNNAKDIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRG  117

Query  117  YTHEGPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYWLGIR  170
              H GPCEIW+DD MV    +C     D +++  +    +DYS+C  G CM ++YWL ++
Sbjct  118  IVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQ  177

Query  171  PMGKKYSWQIYKACIPLADKNGGG  194
             +  K  WQ+YK CIPL+   GGG
Sbjct  178  RLDGKTYWQVYKNCIPLSGPAGGG  201

>PYAP_18713
Length=184

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 72/131 (55%), Gaps = 12/131 (9%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            +KT   +       G+K LR F++  G           CG T+PNA P+ +P++ +   S
Sbjct  57   FKTGAQYAVVAKDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVFS  107

Query  116  G-YTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGK  174
                H GPCE+WIDD MV    +C  +  +K     +D+S+CKGKCML++YWLG++  GK
Sbjct  108  RPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQDSGK  167

Query  175  KYSWQIYKACI  185
            +  WQ Y   I
Sbjct  168  R--WQSYSTYI  176

>PYIW_19151
Length=248

 Score = 100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 22/139 (16%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            +K  K+F A     G+ TLR +++  GA          CG+TDP   P+ IP +   R S
Sbjct  55   WKDPKNFAAAAKEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFS  105

Query  116  -GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI-----DYSACKGKCMLKWYWLGI  169
                H GPCE++IDD  V    +C     E AFT  I     D+S CKG+CM+++YWLG+
Sbjct  106  RDIPHPGPCELYIDDTRVYQNDDC-----ESAFTGVIPSWDVDWSLCKGECMIRFYWLGL  160

Query  170  RPMGKKYSWQIYKACIPLA  188
            +  G +  WQ+YK+C+P++
Sbjct  161  QASGTR--WQVYKSCVPVS  177

>PPTG_04622
Length=273

 Score = 100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 75/138 (54%), Gaps = 16/138 (12%)

Query  59   TKDFNAYLSANGYKTLRDFMDK-PGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-G  116
            T  + +   +NGY  +R  +D     Y AN      CG+TDP+A P+  PT G+   S G
Sbjct  66   TTLYTSLKESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRG  119

Query  117  YTHEGPCEIWIDDVMVKSGKNCHYDISE------KAFTDKIDYSACK-GKCMLKWYWLGI  169
              H GPCEIW+DD MV S  +C     +        FT  +DYS+C  G CML++YWL  
Sbjct  120  MVHAGPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFT-PVDYSSCSTGGCMLRFYWLAF  178

Query  170  RPMGKKYSWQIYKACIPL  187
            + +  K  WQ+YK C+PL
Sbjct  179  QGVDSKMVWQVYKDCVPL  196

>PHYCA_12942
Length=353

 Score = 102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 62/101 (61%), Gaps = 10/101 (10%)

Query  93   ECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAF  147
            +CGYT  +APPQPIP++G  +       G+TH+GPCEI+IDD MV  G NC  +      
Sbjct  83   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDT  142

Query  148  TD-KIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            +D KIDYS+C G CML  YWLG +       WQ Y  C+PL
Sbjct  143  SDMKIDYSSCNGNCMLTIYWLGFQ----NAQWQAYVNCVPL  179

>PPTG_14221
Length=275

 Score = 100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 87/179 (49%), Gaps = 21/179 (12%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQA-------KLENQGYKTTKDFNAYLSANGYKTLR  75
            VEAH  +  PE  +      + W  Q        K +    K+   F +  +AN +K L+
Sbjct  21   VEAHGYMLIPESQFK-GSANSAWIVQIDPVWASDKWDGNNPKSVDTFKSLKAANNFKDLK  79

Query  76   DFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIWIDDVMVKS  134
              MD    Y A      +CG+T+PN  PQPIPT+G+   S    H GPC IW+DD MV  
Sbjct  80   TLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHGPCGIWLDDKMVLY  133

Query  135  GKNCHYDISEKAFTDK----IDYSACK-GKC-MLKWYWLGIRPMGKKYSWQIYKACIPL  187
              +C      +    K    +DYS+C  G C  +++YWL  + + KK  WQ YK CIPL
Sbjct  134  EDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSYKDCIPL  192

>PHYCA_127270
Length=279

 Score = 100 bits (248),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 87/179 (49%), Gaps = 21/179 (12%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQA-------KLENQGYKTTKDFNAYLSANGYKTLR  75
            V+AH  +  PE  +      + W  Q        K +    ++   F +  +AN +K L+
Sbjct  21   VDAHGYMLIPESQFK-GSANSAWIVQIDPVWASDKWDGNNPQSVDTFKSLKAANNFKDLK  79

Query  76   DFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIWIDDVMVKS  134
              MD    Y A      +CG+TDPN  PQPIPT+G+   S    H GPCEIW+DD  V  
Sbjct  80   TLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDDKKVLY  133

Query  135  GKNCHYDISEKAFTDK----IDYSAC-KGKC-MLKWYWLGIRPMGKKYSWQIYKACIPL  187
              +C      K    K    +DYS+C  G C  +++YWL  + + KK  WQ YK CIPL
Sbjct  134  EDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKDCIPL  192

>PYU1_G005324
Length=191

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 94/187 (50%), Gaps = 24/187 (13%)

Query  9    GATAIAALTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAY  65
            G  A  AL   + +  VE H  +  P   +     K++W  +      G ++T   + A 
Sbjct  5    GMIASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAV  64

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGYTHEGPCE  124
                GYK L+ F+D       +KG T  CG T  NA  + IP +G  +  S   H GPCE
Sbjct  65   APKKGYKDLKSFLD-------SKGPT--CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCE  115

Query  125  IWIDDVMVKSGKNCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            IW+ +      +  H D  EK F    + KID+SACKG CML++YWLG++  GK+  WQ 
Sbjct  116  IWLGNT-----RAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQS  168

Query  181  YKACIPL  187
            YK C+PL
Sbjct  169  YKNCVPL  175

>PYU1_G005326
Length=191

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 94/187 (50%), Gaps = 24/187 (13%)

Query  9    GATAIAALTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAY  65
            G  A  AL   + +  VE H  +  P   +     K++W  +      G ++T   + A 
Sbjct  5    GMIASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAV  64

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGYTHEGPCE  124
                GYK L+ F+D       +KG T  CG T  NA  + IP +G  +  S   H GPCE
Sbjct  65   APKKGYKDLKSFLD-------SKGPT--CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCE  115

Query  125  IWIDDVMVKSGKNCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            IW+ +      +  H D  EK F    + KID+SACKG CML++YWLG++  GK+  WQ 
Sbjct  116  IWLGNT-----RAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQS  168

Query  181  YKACIPL  187
            YK C+PL
Sbjct  169  YKNCVPL  175

>PYU1_G005328
Length=191

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 94/187 (50%), Gaps = 24/187 (13%)

Query  9    GATAIAALTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAY  65
            G  A  AL   + +  VE H  +  P   +     K++W  +      G ++T   + A 
Sbjct  5    GMIASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAV  64

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGYTHEGPCE  124
                GYK L+ F+D       +KG T  CG T  NA  + IP +G  +  S   H GPCE
Sbjct  65   APKKGYKDLKSFLD-------SKGPT--CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCE  115

Query  125  IWIDDVMVKSGKNCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            IW+ +      +  H D  EK F    + KID+SACKG CML++YWLG++  GK+  WQ 
Sbjct  116  IWLGNT-----RAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQS  168

Query  181  YKACIPL  187
            YK C+PL
Sbjct  169  YKNCVPL  175

>PYAR_14256
Length=199

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 85/166 (51%), Gaps = 13/166 (8%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAYLSANGYKTLRDFMDKPG  82
            +AH  +  P   +     K++W  +      G ++T   + A     G+K LR F++   
Sbjct  18   QAHVYLTQPLAEFKAGASKSSWVAEFSPPWDGTFRTGAQYAAVAPDKGFKNLRAFLE---  74

Query  83   AYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDI  142
                +KG T  CG T PNA P+P         S   H GPCEIW+DD +     +C    
Sbjct  75   ----DKGPT--CGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWLDDSLAFHDDDCEKKF  128

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
               A + K+D+SACKG CML++YWLG++  GK+  WQ YK CIPL 
Sbjct  129  GS-ATSFKVDFSACKGSCMLRFYWLGLQNSGKR--WQSYKNCIPLG  171

>PYU1_G005325
Length=207

 Score = 98.2 bits (243),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 94/187 (50%), Gaps = 24/187 (13%)

Query  9    GATAIAALTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKTTKDFNAY  65
            G  A  AL   + +  VE H  +  P   +     K++W  +      G ++T   + A 
Sbjct  5    GMIASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAV  64

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGYTHEGPCE  124
                GYK L+ F+D       +KG T  CG T  NA  + IP +G  +  S   H GPCE
Sbjct  65   APKKGYKDLKSFLD-------SKGPT--CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCE  115

Query  125  IWIDDVMVKSGKNCHYDISEKAF----TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQI  180
            IW+ +      +  H D  EK F    + KID+SACKG CML++YWLG++  GK+  WQ 
Sbjct  116  IWLGNT-----RAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQS  168

Query  181  YKACIPL  187
            YK CIPL
Sbjct  169  YKNCIPL  175

>PHYSO_533903
Length=208

 Score = 98.2 bits (243),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 91/180 (51%), Gaps = 22/180 (12%)

Query  23   VEAHQRVYFPEVVYTLADRKTNW----GPQAKLENQGYKTTKDFNAYLS---ANGYKTLR  75
            V+AH  +Y P+  +      + W     P  K ++    T K    + S   AN +K L+
Sbjct  22   VDAHGYIYVPQSQFK-GGENSQWLVQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDLK  80

Query  76   DFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGE-FRTSGYTHEGPCEIWIDDVMVKS  134
              +D    Y        +CG+TDPN  PQPIPT+G+   + G  H GPCE W+DD  V  
Sbjct  81   TMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  135  GKNCHYDISEKAFTDK----IDYSACK-GKC-MLKWYWLGIRPM-GKKYSWQIYKACIPL  187
              +C+ +        K    IDYS+C+ G C M+++YWLG + +  KK  WQ YK CIPL
Sbjct  135  ADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYKDCIPL  194

>PHALS_05394
Length=288

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 78/148 (53%), Gaps = 15/148 (10%)

Query  53   NQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF  112
            +QG   T  F    +AN +K+ R  MD    Y A      +CGYTDPN  P   P++G  
Sbjct  62   DQGLLDT--FKELGAANNFKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTA  113

Query  113  RTSG-YTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDK-----IDYSACKG-KCMLKWY  165
              S    H G CEIWI+  MV    +C     +KA   K     IDYS+CKG KC+L++Y
Sbjct  114  TFSRPMKHAGLCEIWINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFY  173

Query  166  WLGIRPMGKKYSWQIYKACIPLADKNGG  193
            WL ++ +G K  WQ YK CI +   +GG
Sbjct  174  WLALQRIGDKTVWQAYKNCISIKGSSGG  201

>PHYRA_74651
Length=344

 Score = 100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 91/194 (47%), Gaps = 29/194 (15%)

Query  14   AALTAPSVLVEAHQRVYFPEVVYTLADRKT-------------NWGPQAKLENQGYKTTK  60
            AAL   +V V AH  V  P  +    D +T             +W   +  +N+   T  
Sbjct  12   AALVVFAVQVNAHGYVSNP--LSEFVDSETSAWVVQIDPQWAGDWDSCSSDDNECLTTL-  68

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTH  119
             + +   +NGY  +R  +D   +         +CG+TDPNA P+  P+ G+   S G  H
Sbjct  69   -YTSLKESNGYSDIRTLLDSDTSLYG-----ADCGFTDPNATPKDPPSTGDATFSRGMVH  122

Query  120  EGPCEIWIDDVMVKSGKNCH----YDISEKAFT-DKIDYSAC-KGKCMLKWYWLGIRPMG  173
             GPCEIW+DD  V S  NC         EKA     +DYS+C  G C L++YWL  + + 
Sbjct  123  AGPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLD  182

Query  174  KKYSWQIYKACIPL  187
                WQ+YK C+PL
Sbjct  183  SSTVWQVYKNCVPL  196

>PYU1_G001519
Length=265

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 89/190 (47%), Gaps = 18/190 (9%)

Query  11   TAIAALTAPSVLVEAHQRVYFPEVVY-----TLADRKTNWGPQAKLENQGYKTTKD----  61
            T + AL   +   +AH ++  P+  +     T +   T  GP       G     D    
Sbjct  7    TTVLALAVMAATADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSN  66

Query  62   FNAYLSA----NGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGY  117
             NAYL A      YK+L+D +    A K   GAT ECG++D N  PQP+P   ++     
Sbjct  67   TNAYLKAFKAQTKYKSLKD-LAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDN  125

Query  118  THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYS  177
            +H GPCE+W DDVMV    NC  +I E     K D + C GK ML  +W+ +       +
Sbjct  126  SHMGPCEVWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALH----VPT  181

Query  178  WQIYKACIPL  187
            WQIY  C P+
Sbjct  182  WQIYTNCAPI  191

>PPTG_04618
Length=326

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 72/140 (51%), Gaps = 13/140 (9%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F      N YK +R  MD    Y  +      CG+TDP   P   P++G    S G  H 
Sbjct  67   FKELAPKNNYKDVRSLMDGNPVYGED------CGFTDPKGTPSEPPSDGTATFSRGIVHA  120

Query  121  GPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYWLGIRPMGK  174
            GPCEIW+DD MV    +C     D ++K  +    +DYS+C  G CML++YWL ++ +  
Sbjct  121  GPCEIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDG  180

Query  175  KYSWQIYKACIPLADKNGGG  194
            K  WQ YK CIPL    GGG
Sbjct  181  KTVWQAYKNCIPLTGPAGGG  200

>PHALS_03177
Length=259

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 96/202 (48%), Gaps = 26/202 (13%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQ-------AKLEN  53
            MTR   +     I A   PS+  ++H  +Y P   +        W  Q       +    
Sbjct  1    MTRTALIASTIVIFATLTPSI--DSHGYMYIPRTQFK-GQGNDGWIVQIEPLWKSSDWNG  57

Query  54   QGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR  113
               K+ K F +  +AN +K L+  MD P   +       +CGY+DPN  PQPIP +G+  
Sbjct  58   NTQKSVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKAT  110

Query  114  TS-GYTHEGPCEIWIDDVMVKSGKNCH-----YDISEKAFTDKIDYSAC-KGKC-MLKWY  165
             S    H GPCE+W+D+  V    +C+      D++ K+    +DYS+C  G C  +++Y
Sbjct  111  FSRAMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVF-PVDYSSCANGGCKQMRFY  169

Query  166  WLGIRPMGKKYSWQIYKACIPL  187
            WL  + +  K  WQ YK CIPL
Sbjct  170  WLAFQGINGKTFWQSYKMCIPL  191

>PYAR_20617
Length=254

 Score = 97.4 bits (241),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 94/190 (49%), Gaps = 24/190 (13%)

Query  3    RLFAVLG-ATAIAALTAPSVLVEAHQRVYFPEVV--YTLADRKTNWGPQAKLENQG-YKT  58
            RL A L  ATA+        + +AH  VY  E +  +     K++W  + K   +G +KT
Sbjct  5    RLIASLAVATAVG-------IHDAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKT  57

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-TSGY  117
               + A   A G   LR F++  G           CG +  +A P+ IP +G+    S  
Sbjct  58   GAQYAAKAKAEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKISLASTI  108

Query  118  THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYS  177
             H GPCE+W DDV+     +C       A +  +D+S C G C+L++YWLG++  GK+  
Sbjct  109  EHAGPCEVWFDDVLAFHDDDCEKTFGS-ATSFAVDFSKCSGSCLLRFYWLGLQDGGKR--  165

Query  178  WQIYKACIPL  187
            WQ YK C+PL
Sbjct  166  WQSYKNCVPL  175

>PPTG_04647
Length=327

 Score = 98.6 bits (244),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 73/137 (53%), Gaps = 14/137 (10%)

Query  59   TKDFNAYLSANGYKTLRDFMDK-PGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-G  116
            T  +    S+NGY  +R  +D     Y A      +CGYT+P+A  +  PT G+   S G
Sbjct  65   TSVYTTLKSSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRG  118

Query  117  YTHEGPCEIWIDDVMVKSGKNCHY-----DISEKAFTDKIDYSACK-GKCMLKWYWLGIR  170
              H GPCEIW+DD MV S  NC        +  K+    +DYS+C    CML++YWL  +
Sbjct  119  MVHVGPCEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQ  178

Query  171  PMGKKYSWQIYKACIPL  187
             +  K  WQ+YK C+PL
Sbjct  179  GVDSKMVWQVYKDCVPL  195

>PITG_04949
Length=337

 Score = 98.6 bits (244),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 92/189 (49%), Gaps = 26/189 (14%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQ---GYKTTKDFNAYLSA-------NGYK  72
            V+AH  +  P   +  A +  NW    ++E Q   G+  +K     L+        N +K
Sbjct  21   VQAHGYIAKPAPSWK-ASKTNNW--VVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFK  77

Query  73   TLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIWIDDVM  131
             +R  MD       N     ECG+TDP   P   P++G    S G  H GPCEIW+DD M
Sbjct  78   DVRSLMD------GNPVFGEECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKM  131

Query  132  VKSGKNCHY---DISEK--AFTDKIDYSACK-GKCMLKWYWLGIRPMGKKYSWQIYKACI  185
            V    +C     D +++  A    +DYS+C  G CML++YWL ++ +  K  WQ YK CI
Sbjct  132  VLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCI  191

Query  186  PLADKNGGG  194
            PL    GGG
Sbjct  192  PLTGPAGGG  200

>PITG_04948
Length=232

 Score = 96.3 bits (238),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 12/135 (9%)

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
            ++N  K +R  +D   +         +CGYT+P+  P+  PT+G    S G  H GPCEI
Sbjct  72   ASNNAKDIRTLLDSDTSLYG-----ADCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYWLGIRPMGKKYSWQ  179
            W+DD MV    +C     D +++  +    +DYS+C  G CML++YWL ++ +  K  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  186

Query  180  IYKACIPLADKNGGG  194
            +YK CIPL+   GGG
Sbjct  187  VYKNCIPLSGPAGGG  201

>PYU1_G014690
Length=295

 Score = 97.4 bits (241),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 108/211 (51%), Gaps = 17/211 (8%)

Query  55   GYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRT  114
             +K   +F       G+ TLR +++  GA          CG TDPNA P+ IP++ +   
Sbjct  56   NWKDPANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHF  106

Query  115  S-GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            S    H GPCEIW+DD  V    +C     ++     ID+S+CK  CML+++WLG++  G
Sbjct  107  SRPIVHPGPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQDSG  166

Query  174  KKYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDDDAKET  233
             +  WQ+YK C+PL    G G++ +  P  T KAP+  + +  P    A       A + 
Sbjct  167  TR--WQVYKNCVPLKGLGGNGSSSSTTPAATTKAPSATSSSKTPAPAPA-TKTPSPATKA  223

Query  234  PKPETSKP---AAASPKPTE-PATLKPSQKP  260
            P P T  P   A  +PKP++ P T KP++ P
Sbjct  224  PSPTTKTPSTKAPKTPKPSKAPKTPKPTKAP  254

>PHYRA_73584
Length=287

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 102/208 (49%), Gaps = 30/208 (14%)

Query  7    VLGATAIAALTAPSV-LVEAHQRVYFPEVVYTLADRKTN-WGPQAKLENQG---------  55
            ++  TAI ++ A  +  V AH  +Y P  +    D +T+ W  Q + +  G         
Sbjct  1    MVSTTAILSVVAAMLSQVSAHGYMYIP--LAEFVDSETSAWVVQIEPQWTGDWDSCSSSD  58

Query  56   -YKTTKDFNAYLSANGYKTLRDFMDKPGA-YKANKGATVECGYTDPNAPPQPIPTNGEFR  113
                T  +++   +NGY  +R  +D     Y AN      CG+T+P+A  +  PT G+  
Sbjct  59   DDCLTTLYSSLKKSNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDAT  112

Query  114  TS-GYTHEGPCEIWIDDVMVKSGKNCHYDI----SEKA--FTDKIDYSACKGK-CMLKWY  165
             S G  H GPCEIW+DD +V S  +C         EKA  FT  +DYS+C    CML++Y
Sbjct  113  FSRGMVHAGPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFT-PVDYSSCSSSGCMLRFY  171

Query  166  WLGIRPMGKKYSWQIYKACIPLADKNGG  193
            WL  + +  K  WQ+YK C+PL     G
Sbjct  172  WLAFQGVDSKTVWQVYKDCVPLTGPAAG  199

>PITG_05271
Length=278

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 95/206 (46%), Gaps = 22/206 (11%)

Query  4    LFAVLGATAIAALTAPSV-LVEAHQRVYFPEVVYTLADRKTNWGPQ-----AKLENQGYK  57
            + +     + A L A S+   +AH  +  PE  +      + W  Q     A  +  G K
Sbjct  1    MLSAAAFASTAVLLAASIPSTDAHGYMLIPESQFK-GSANSAWIVQIDPVWASEDWDGNK  59

Query  58   --TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
              +   F A  +AN +K L+  MD    Y A      +CG+TDPN   QPIP +G+   S
Sbjct  60   PGSVNAFKALKTANKFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFS  113

Query  116  -GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSAC-KGKCM-LKWYWLG  168
                H GPCEIW+DD  V    +C      +    K    +DYS+C  G C  +++YWL 
Sbjct  114  RALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLA  173

Query  169  IRPMGKKYSWQIYKACIPLADKNGGG  194
             + +  K  WQ YK CIPL    GGG
Sbjct  174  FQGVDGKTVWQSYKDCIPLEGSGGGG  199

>PPTG_03139
Length=320

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 93/207 (45%), Gaps = 25/207 (12%)

Query  7    VLGATAIAALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK------  57
            VLG  +  A+ A ++L   V+ H  +  P+V +T     T +    +  + G+       
Sbjct  2    VLGKASFTAIAASAMLASTVKGHGYMSVPKVEFTFNGDTTQYMATIEASSSGFSGNFGQS  61

Query  58   ---TTKDFNAYLSANGYKTLRDFM-DKPGAYKANKGATVECGYTDPNAPPQPIP------  107
                T +FN   +A+ Y +L++FM DK      +K  T ECGYT+P+  PQP+P      
Sbjct  62   PTDNTANFNKGFAASKYSSLKEFMTDK--MVLVSKDFTKECGYTNPDETPQPVPETYVEW  119

Query  108  TNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWL  167
            ++G       +HEGPCE+W DD  V    NC  +          D+ AC G   L  YW+
Sbjct  120  SHGSGEGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWI  179

Query  168  GIRPMGKKYSWQIYKACIPLADKNGGG  194
             +       SWQ+Y  C  L      G
Sbjct  180  ALH----SPSWQVYINCAALEKTTSTG  202

>PHYKE_6077
Length=322

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/282 (29%), Positives = 117/282 (41%), Gaps = 41/282 (15%)

Query  7    VLGATAIAALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK------  57
            V+G T++  + A S+L   V+ H  +  P V +TL    T +         G+       
Sbjct  2    VIGKTSVLTVVASSMLAATVQGHGYMSAPPVEFTLVGDTTQYMGSIDAATSGFSGEFGGA  61

Query  58   ---TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGA---TVECGYTDPNAPPQPIPT---  108
                T +FN  ++A+ Y +L++FM    A KA   +   T+ECGYT+P    QP+P    
Sbjct  62   PKDNTANFNKGMAASKYTSLKEFM----AAKAKVTSPEFTLECGYTNPKGAAQPLPETYV  117

Query  109  -----NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLK  163
                 +GE  TS  +HEGPCE+W DD  V    NC  +          D  AC G  +L 
Sbjct  118  EWSHGSGEGFTS--SHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLT  175

Query  164  WYWLGIRPMGKKYSWQIYKACIPLADKNGGGnnktkvptptnkapa----kptkapapkk  219
             YW+ +       SWQ+Y  C  L      G         ++   +          +   
Sbjct  176  LYWIALH----SPSWQVYINCAALEKTTSTGAKSKFAVGSSSGGTSSSKPTTPATDSSTT  231

Query  220  DDAEVGKDDDAKETPKPETSKPAAASPK----PTEPATLKPS  257
             DAE      A ETP    +  A A+P     P+ PAT  PS
Sbjct  232  QDAETPATPSAPETPSTPATPSAPATPSAPETPSTPATEAPS  273

>PYU1_G007364
Length=316

 Score = 96.3 bits (238),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 91/186 (49%), Gaps = 29/186 (16%)

Query  18   APSVLVEAHQRVYFPEVVYTLADRKTNWGPQ------AKLENQGYKTTKDFNAYLSANG-  70
            APS  V AH  +  P   ++    KTN+  +       K  +        F     A+G 
Sbjct  30   APSA-VNAHGYITVPMAEFSDGAMKTNFIAKMDPAFPGKFNDNPQANVDTFTKAFQASGK  88

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR------TSGY--THEGP  122
            Y +LRD +         +G   +CG T  +A P+PIP++G           G+  +H GP
Sbjct  89   YASLRDLL---------QGHGEDCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGP  139

Query  123  CEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYK  182
            CEIW+DD  V   +NC           K+D+S+C GKC++++YWL ++    + +WQIYK
Sbjct  140  CEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQIYK  195

Query  183  ACIPLA  188
             CIPLA
Sbjct  196  NCIPLA  201

>PHYSO_438103
Length=238

 Score = 94.7 bits (234),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 85/178 (48%), Gaps = 21/178 (12%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQA-------KLENQGYKTTKDFNAYLSANGYKTLRD  76
            +AH  +  PE  +T     + W  Q        K +     + + F +  SAN +K L+ 
Sbjct  21   DAHGYMLIPESQFT-GGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLKT  79

Query  77   FMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIWIDDVMVKSG  135
             MD    Y        +CG+TDPN  PQPIPT+G+   S    H GPCEIW+D+  V   
Sbjct  80   LMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYE  133

Query  136  KNCHYDISEKAFTDK----IDYSACK-GKCM-LKWYWLGIRPMGKKYSWQIYKACIPL  187
             +C      +    K    +DYS+C  G C  +++YWL  + +  K  WQ YK CIPL
Sbjct  134  DDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PHYRA_73606
Length=366

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 94/196 (48%), Gaps = 27/196 (14%)

Query  11   TAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTN-WGPQAKLENQG-YKT---------T  59
            +A+ +L      V AH  +Y P   +T  D  T+ W  Q   +  G + T         T
Sbjct  9    SAVVSLAVAFQNVNAHGYMYIPLAEFT--DSVTSAWVVQISPQWSGDWDTCSSDDSDCLT  66

Query  60   KDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYT  118
              +    S+NGY  +R  +D   +         +CGYT+P+A  +  PT G+   S G  
Sbjct  67   SVYTGLKSSNGYSDIRTLLDSDTSLYG-----ADCGYTNPDATAKDPPTTGDATFSRGMV  121

Query  119  HEGPCEIWIDDVMVKSGKNCHYDISE------KAFTDKIDYSACK-GKCMLKWYWLGIRP  171
            H GPCEIW+DD MV S  +C     +        FT  +DYS+C    CML++YWL  + 
Sbjct  122  HVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFT-PVDYSSCSTSGCMLRFYWLAFQG  180

Query  172  MGKKYSWQIYKACIPL  187
            +  +  WQ+YK C+PL
Sbjct  181  VDSEIVWQVYKDCVPL  196

>PHYKE_10578
Length=239

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 90/203 (44%), Gaps = 33/203 (16%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLEN-----QG  55
            M    A+  A AI A T+ +   +AH  +  PE  +      +NW     ++N      G
Sbjct  1    MLSGAALSSAVAILAFTSHA---DAHGALKVPEPTFEQGASHSNW--VTLVDNYWDIGSG  55

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF---  112
                  F    +  G       +D     K        CG+T  +A PQP+P++G+    
Sbjct  56   GDQVGKFKTMATEKGMSVKDVILDMVKDKK--------CGFTRADADPQPVPSDGKLVWR  107

Query  113  --RTSGYTHEGPCEIWIDDVMVKSGKNCHY------DISEKAFTDKIDYSACKGKCMLKW  164
                +G+TH GPCE++IDD +V  G NC        D S K     IDYS+C G CML +
Sbjct  108  GSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSF  167

Query  165  YWLGIRPMGKKYSWQIYKACIPL  187
            YWLG +       WQ Y  C+PL
Sbjct  168  YWLGFQ----NEQWQSYVNCVPL  186

>PHYSO_459106
Length=223

 Score = 94.0 bits (232),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 69/134 (51%), Gaps = 12/134 (9%)

Query  68   ANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIW  126
            AN  K +R  +D        K    +CG+TDP   PQ  PT G+   S G  H GPCEIW
Sbjct  73   ANNVKDIRTMIDSD-----TKLYGEDCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEIW  127

Query  127  IDDVMVKSGKNCH--YDISEKAFTDK---IDYSAC-KGKCMLKWYWLGIRPMGKKYSWQI  180
            +DD MV    +C   Y    KA       +DYS+C  G CM ++YWL ++    K  WQ+
Sbjct  128  LDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQV  187

Query  181  YKACIPLADKNGGG  194
            YK CIPL    GGG
Sbjct  188  YKNCIPLTGPAGGG  201

>PHYSO_533682
Length=278

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 72/133 (54%), Gaps = 13/133 (10%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F ++ S N +K L+  MD    Y        +CG+TDPN  PQPIPT+G+   S G  H 
Sbjct  66   FTSFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHV  119

Query  121  GPCEIWIDDVMVKSGKNCHYDI----SEKAFTDKIDYSAC-KGKCM-LKWYWLGIRPMGK  174
            GPCEIW+DD  V S  +C+        +   T  +DYS+C  G C  ++ Y LG + +  
Sbjct  120  GPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVD  179

Query  175  KYSWQIYKACIPL  187
            K  WQ YK CIPL
Sbjct  180  KTVWQSYKNCIPL  192

>PYIW_21964
Length=265

 Score = 94.4 bits (233),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 83/184 (45%), Gaps = 24/184 (13%)

Query  22   LVEAHQRVYFPEVVYTLADRKTNW-----GPQAKLENQGYK-------TTKDFNAYLSAN  69
            LV AH  +  P+  + ++D  T +     GP       G          TK F A L A+
Sbjct  21   LVSAHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKAS  80

Query  70   GYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGYT--HEGPC  123
             YK++R  +D    +   K A  ECG T P    QP+P          + G+T  H+GPC
Sbjct  81   TYKSMRALVDDKAVFI--KEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPC  138

Query  124  EIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKA  183
            E+W DD +  + +NC  D +       ID++ C G  +LK  WL +       +WQIY  
Sbjct  139  EVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SSTWQIYIN  194

Query  184  CIPL  187
            C PL
Sbjct  195  CAPL  198

>PHYSO_340332
Length=295

 Score = 94.7 bits (234),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 71/133 (53%), Gaps = 13/133 (10%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F A  +AN +K L+  MD    Y A      +CG+TDPN  PQPIPT+G+   S    H 
Sbjct  66   FKALKTANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHV  119

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSAC-KGKCM-LKWYWLGIRPMGK  174
            GPCEIW+DD  V    +C      +    K    +DYS+C  G C  +++YWL  + +  
Sbjct  120  GPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDG  179

Query  175  KYSWQIYKACIPL  187
            K  WQ YK CIPL
Sbjct  180  KTVWQSYKDCIPL  192

>PHYCA_531163
Length=314

 Score = 95.1 bits (235),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 96/201 (48%), Gaps = 23/201 (11%)

Query  4    LFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQG-YKT----  58
            +F  +  + +AAL      V+AH  +Y P   +      ++W  Q + +  G + T    
Sbjct  2    VFTSVIFSTVAALAIAVENVKAHGYMYIPLAEFD-GTATSSWIVQIEPQWSGDWDTCSSD  60

Query  59   -----TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR  113
                 T  + +  S+NGY  +R  +D   +         +CGYT+ +A  +  P+ G+  
Sbjct  61   DSDCLTSVYTSLKSSNGYSDIRTLLDSDTSLYG-----ADCGYTNADATAKDPPSTGDAT  115

Query  114  TS-GYTHEGPCEIWIDDVMVKSGKNCHY-----DISEKAFTDKIDYSACK-GKCMLKWYW  166
             S G  H GPCEIW+DD MV S  +C        +  K+    +DYS+C    CML++YW
Sbjct  116  FSRGMVHVGPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYW  175

Query  167  LGIRPMGKKYSWQIYKACIPL  187
            L  + +     WQ+YK C+PL
Sbjct  176  LAFQGVDSAIVWQVYKDCVPL  196

>PYIR_19612
Length=260

 Score = 94.0 bits (232),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 79/140 (56%), Gaps = 18/140 (13%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS  115
            +K  K+F       G+ TLR +++       +KGAT  CG+TDPN  P+ IP + + R S
Sbjct  57   WKDPKNFATAAKEKGFATLRSYLE-------DKGAT--CGFTDPNVAPRAIPADRKVRFS  107

Query  116  -GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGK  174
               +H GPCE+WIDD  V    +C    +    +  +D++ C GKCM+++YWL ++  G 
Sbjct  108  RDISHPGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQASGT  167

Query  175  KYSWQIYKA------CIPLA  188
            +  WQ+Y++      C+P++
Sbjct  168  R--WQVYRSELTRDLCVPVS  185

>PHYRA_73607
Length=343

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 97/203 (48%), Gaps = 30/203 (15%)

Query  7    VLGATAI---AALTAPSVLVEAHQRVYFPEVVYTLADRKTN-WGPQAK----------LE  52
            VL ++ +   AAL A    V AH  +Y P   +T  D +T+ W  Q +            
Sbjct  2    VLSSSIVSVAAALVALVGQVNAHGYMYIPLAEFT--DSETSAWVVQIEPQWSGDWDSCSS  59

Query  53   NQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF  112
            +     T  +++  S+NGY  +R  +D   +         +CG+T+P+A  +  PT G+ 
Sbjct  60   DDSDCLTTLYSSLKSSNGYSDIRTLLDSDTSLYG-----ADCGFTNPDATAKDPPTTGDA  114

Query  113  RTS-GYTHEGPCEIWIDDVMVKSGKNCHYDISE------KAFTDKIDYSACKGK-CMLKW  164
              S G  H GPCEIW+DD  V S  NC     +        FT  +DYS+C    CML++
Sbjct  115  TFSRGMVHVGPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFT-PVDYSSCSTSGCMLRF  173

Query  165  YWLGIRPMGKKYSWQIYKACIPL  187
            YWL  + +     WQ+YK C+PL
Sbjct  174  YWLAFQGVDSSMVWQVYKNCVPL  196

>PHYRA_78175
Length=319

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 90/207 (43%), Gaps = 25/207 (12%)

Query  7    VLGATAIAALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK------  57
            VLG  + AA+   ++L   V+ H  +  P+V +T     T +         G+       
Sbjct  2    VLGKASFAAIVGSAMLSATVQGHGSMSVPKVEFTFVGDTTQYMGTIDSSTSGFTGTFGGS  61

Query  58   ---TTKDFNAYLSANGYKTLRDFM-DKPGAYKANKGATVECGYTDPNAPPQPIP------  107
                T +FN   +A+ Y +L++FM DK      NK  T ECGYT+P+   QP+P      
Sbjct  62   PTDNTANFNKGFAASKYSSLKEFMADK--LVLVNKEFTKECGYTNPDEAAQPVPKTYVEW  119

Query  108  TNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWL  167
            ++G+      +HEGPCE+W DD  V    NC  +          D  AC G   L  YW+
Sbjct  120  SHGDGEGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWI  179

Query  168  GIRPMGKKYSWQIYKACIPLADKNGGG  194
             +       SWQ+Y  C  L      G
Sbjct  180  ALH----SASWQVYINCAALEKTTSSG  202

>PHYSO_340333
Length=284

 Score = 94.4 bits (233),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 71/133 (53%), Gaps = 13/133 (10%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F A  +AN +K L+  MD    Y A      +CG+TDPN  PQPIPT+G+   S    H 
Sbjct  66   FKALKTANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHV  119

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSAC-KGKCM-LKWYWLGIRPMGK  174
            GPCEIW+DD  V    +C      +    K    +DYS+C  G C  +++YWL  + +  
Sbjct  120  GPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDG  179

Query  175  KYSWQIYKACIPL  187
            K  WQ YK CIPL
Sbjct  180  KTVWQSYKDCIPL  192

>PHYSO_484051
Length=285

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 96/204 (47%), Gaps = 31/204 (15%)

Query  7    VLGATAIAALTAPSVL----VEAHQRVYFPEVVYTLADRKTN-WGPQAKLENQG------  55
            ++ +TAI ++ A  V     V AH  +Y P   +T  D  T+ W  Q + +  G      
Sbjct  1    MMSSTAILSVVAGCVASLSQVSAHGYMYIPLAEFT--DSVTSAWIVQIEPQWTGDWDSCS  58

Query  56   ----YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGE  111
                   T  +     +NGY  +R  +D   +         +CG+T+P+A P+  PT G+
Sbjct  59   SSDDDCLTTLYALLKESNGYSDIRTLLDSDTSLYG-----ADCGFTNPDASPKDPPTTGD  113

Query  112  FRTS-GYTHEGPCEIWIDDVMVKSGKNCHYDISE------KAFTDKIDYSACKGK-CMLK  163
               S    H  PCEIW+DD MV S  +C     +        FT  +DYS+C    CML+
Sbjct  114  PTFSRCMVHASPCEIWLDDTMVLSNDDCQTAYGDGTQETASVFT-PVDYSSCSTSGCMLR  172

Query  164  WYWLGIRPMGKKYSWQIYKACIPL  187
            +YWL  + +  K  WQ+YK C+PL
Sbjct  173  FYWLAFQGVDSKMVWQVYKDCVPL  196

>PHYRA_78689
Length=296

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 75/145 (52%), Gaps = 13/145 (9%)

Query  50   KLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN  109
            K +    ++   F +  +AN +K L+  MD    Y A      +CG+TDP+  PQPIPT+
Sbjct  54   KWDGNNPQSVDTFKSLKTANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTD  107

Query  110  GEFRTS-GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSACK-GKC-ML  162
            G+   S    H GPCEIW+DD  V    +C      +    K    +DYS+C  G C  +
Sbjct  108  GKATFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQM  167

Query  163  KWYWLGIRPMGKKYSWQIYKACIPL  187
            ++YWL  + +  K  WQ YK CIPL
Sbjct  168  RFYWLAFQGLDSKTVWQSYKDCIPL  192

>PHYKE_2809
Length=291

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 74/135 (55%), Gaps = 12/135 (9%)

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
            +AN  K +R  +D        K    +CG+TDP A P+  PT+G    S G  H GPCEI
Sbjct  59   AANNVKDIRTMLDS-----DTKLYGQDCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEI  113

Query  126  WIDDVMVKSGKNCHY---DISEKAFT--DKIDYSACK-GKCMLKWYWLGIRPMGKKYSWQ  179
            W+DD MV    +C     D +++  +    +DYS+C  G CM ++YWL ++ +  K  WQ
Sbjct  114  WLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQ  173

Query  180  IYKACIPLADKNGGG  194
            +YK C+PL+    GG
Sbjct  174  VYKNCVPLSGPGSGG  188

>PHYKE_2937
Length=366

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (53%), Gaps = 14/137 (10%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GY  117
            T  + +  S+NGY  +R  +D   +         +CGYT+P+A  +  PT G+   S G 
Sbjct  70   TTLYTSLKSSNGYSDIRTLLDSDTSLYG-----ADCGYTNPDATAKDPPTTGDATFSRGM  124

Query  118  THEGPCEIWIDDVMVKSGKNCHYDISE------KAFTDKIDYSACKGK-CMLKWYWLGIR  170
             H GPCEIW+DD MV S  +C     +        FT  +DYS+C    CML++YWL  +
Sbjct  125  VHVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFT-PVDYSSCSSSGCMLRFYWLAFQ  183

Query  171  PMGKKYSWQIYKACIPL  187
             +     WQ+YK C+PL
Sbjct  184  GVDSSMVWQVYKDCVPL  200

>PHYRA_73583
Length=630

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 77/136 (57%), Gaps = 14/136 (10%)

Query  67   SANGYKTLRDFMDKPGA-YKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCE  124
            ++N  K +R  +D     Y AN      CGYT+P+A P+  P+ G+   S G  H GPCE
Sbjct  72   ASNNAKDIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCE  125

Query  125  IWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYWLGIRPMGKKYSW  178
            IW+DD MV    +C     D +++  +    +DYS+C  G CM ++YWL ++ +  K  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWW  185

Query  179  QIYKACIPLADKNGGG  194
            Q+YK CIPL+   GGG
Sbjct  186  QVYKNCIPLSGPAGGG  201

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 72/135 (53%), Gaps = 12/135 (9%)

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
            ++N  K +R  +D        K    +CG+TDP A P+  P+ G+   S G  H GPCE+
Sbjct  373  ASNNIKDIRTMIDS-----DTKLYGADCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEV  427

Query  126  WIDDVMVKSGKNCH--YDISEKAFTDK---IDYSAC-KGKCMLKWYWLGIRPMGKKYSWQ  179
            W+DD MV    +C   Y    KA       IDYS+C  G CM +++WL ++    K  WQ
Sbjct  428  WLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQ  487

Query  180  IYKACIPLADKNGGG  194
            +YK C+PL+   GGG
Sbjct  488  VYKNCVPLSGPAGGG  502

>PHYRA_86016
Length=236

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 57/105 (54%), Gaps = 15/105 (14%)

Query  94   CGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHY------DI  142
            CGYT  +  PQPIPT+G+ +       G+TH GPCEI+IDD MV  G +C        D 
Sbjct  22   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  81

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            S K     +DYS+C G+C L  YWL  +       WQ Y  C+PL
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAFQ----NAQWQAYVNCVPL  122

>H310_06362
Length=197

 Score = 90.5 bits (223),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 75/139 (54%), Gaps = 23/139 (17%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF------  112
            TK F+  + A G+KTLR  +D  G          +CGYT  N P +PIPT+G+       
Sbjct  41   TKAFSDQM-ATGFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPD  90

Query  113  RTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGKCMLKWYWLGI  169
               G+  +H GPCEIW+D+  V   +NC  +  EK A    +D+S+C G C +++YWL +
Sbjct  91   TGEGFVPSHTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL  150

Query  170  RPMGKKYSWQIYKACIPLA  188
                 +  WQ+YK C PL 
Sbjct  151  H----EDLWQVYKNCAPLV  165

>PHYCA_123316
Length=316

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 69/139 (50%), Gaps = 10/139 (7%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR---TS  115
            T+ F A  +++ Y +++DF+   G   AN GAT+ECG TDPN  PQ +P   E+    T 
Sbjct  66   TEAFWAAFNSSKYSSIKDFVTDKGQIVAN-GATIECGLTDPNETPQSLPAELEWTHSDTE  124

Query  116  GYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            G+T  HEGPCE W DD  V    NC    +        D + C G   L +YWL +    
Sbjct  125  GFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH---  181

Query  174  KKYSWQIYKACIPLADKNG  192
               +WQIY  C  L    G
Sbjct  182  -SSTWQIYVNCAALEGSTG  199

>PPTG_07507
Length=299

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 59/106 (56%), Gaps = 15/106 (14%)

Query  93   ECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDI-----  142
            +CGYT  +  P+PIP +G+ +       G+TH GPCE++IDD MV  G NC  D      
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  143  -SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             SEK     +D+S+C GKC L  YWLG +       WQ Y  C+PL
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQ----NAQWQAYVNCVPL  185

>PPTG_07509
Length=299

 Score = 91.7 bits (226),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 59/106 (56%), Gaps = 15/106 (14%)

Query  93   ECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDI-----  142
            +CGYT  +  P+PIP +G+ +       G+TH GPCE++IDD MV  G NC  D      
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  143  -SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             SEK     +D+S+C GKC L  YWLG +       WQ Y  C+PL
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQ----NAQWQAYVNCVPL  185

>PHYRA_79140
Length=424

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 94/212 (44%), Gaps = 49/212 (23%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNW-------------GP  47
            M    A+  A A+  LT+P     AH  +  P+  +T       W             G 
Sbjct  1    MLSGLALSAAVALVVLTSP---ANAHGYLEEPKPSWTSGSANPGWITMVDNYWDIGSGGD  57

Query  48   QAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP  107
            Q  L    YKT       ++A    T+RD +         KG   +CG TD +A PQPIP
Sbjct  58   QCGL----YKT-------MAAEKKMTVRDVV-----LDIVKGQ--KCGNTDDSASPQPIP  99

Query  108  TNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCH-----YDISEKAFTDK-IDYSAC  156
            ++G+ +       G+TH GPCEI++DD MV    NC       D+     +D  +DYS+C
Sbjct  100  SDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSC  159

Query  157  KGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
             GKC L  YWL  +       WQ Y  C+PL+
Sbjct  160  NGKCTLTIYWLAFQ----NAQWQAYVNCVPLS  187

>PHYRA_86752
Length=300

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 57/105 (54%), Gaps = 15/105 (14%)

Query  94   CGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHY------DI  142
            CGYT  +  PQPIPT+G+ +       G+TH GPCEI+IDD MV  G +C        D 
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            S K     +DYS+C G+C L  YWL  +       WQ Y  C+PL
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQ----NAQWQAYVNCVPL  186

>PHALS_02044
Length=237

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 92/208 (44%), Gaps = 24/208 (12%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLEN-------  53
            M   F  + A  IA L A +   +AH ++  P   +       N  P   ++        
Sbjct  1    MVASFTTISALTIAVLAAST---KAHNQMTVPLATWPEGFYNKN-SPSGTIDAAAALPIP  56

Query  54   QGYKTTKD----FNAY---LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPI  106
            QG   T D      AY    +A+ YKTL++F       K  KGA+ ECG++  +  PQ +
Sbjct  57   QGMSYTTDSASNVKAYWTAFNASKYKTLKEFAW--ATQKLEKGASNECGFSLVDGQPQEL  114

Query  107  PTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYW  166
            P   E+    Y+H GPCE+W DD  V    NC  D +E       D ++C+G  +L  YW
Sbjct  115  PEMVEWDAFSYSHMGPCEVWCDDKRVFQNWNCGVDYTETPAKLPYDKASCEGAAVLSCYW  174

Query  167  LGIRPMGKKYSWQIYKACIPLADKNGGG  194
            + +  +     WQIY  C P+     GG
Sbjct  175  IAVHTV----PWQIYTNCAPIKGGGAGG  198

>PHYKE_3913
Length=321

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 71/134 (53%), Gaps = 12/134 (9%)

Query  68   ANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIW  126
            AN  K +R   D   +          CG+T+P+A P+  PT+G    S G  H GPCEIW
Sbjct  100  ANNAKDIRTLFDSDTSLYGEN-----CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIW  154

Query  127  IDDVMVKSGKNCHY---DISEKAFT--DKIDYSACK-GKCMLKWYWLGIRPMGKKYSWQI  180
            +DD MV    +C     D +++  +    +DYS+C  G CM ++YW+ ++ +  K  WQ+
Sbjct  155  LDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQV  214

Query  181  YKACIPLADKNGGG  194
            YK C+PL     GG
Sbjct  215  YKNCVPLTGPGSGG  228

>PYU1_G001527
Length=278

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGYT--HEGPCE  124
            YK++R  +D  G ++   G   ECG T P    QP+P          + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQ--PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W D+V+  S  NC  +          D S C GK MLK+YWL +       +WQ Y AC
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  185  IPLADKNGGG  194
             PLA  + GG
Sbjct  197  APLAGGSSGG  206

>PYU1_G001523
Length=278

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGYT--HEGPCE  124
            YK++R  +D  G ++   G   ECG T P    QP+P          + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQ--PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W D+V+  S  NC  +          D S C GK MLK+YWL +       +WQ Y AC
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  185  IPLADKNGGG  194
             PLA  + GG
Sbjct  197  APLAGGSSGG  206

>PITG_04947
Length=298

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 12/127 (9%)

Query  68   ANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIW  126
            +N  K +R  +D             +CG TDP A P+  PT G+   S G  H GPCEIW
Sbjct  48   SNNIKDIRTMIDGDAKLYGE-----DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCEIW  102

Query  127  IDDVMVKSGKNCHY---DISEKAFT--DKIDYSACK-GKCMLKWYWLGIRPMGKKYSWQI  180
            +DD MV    +C     D ++K  +    +DYS+CK G CM ++YWL ++   +K  WQ+
Sbjct  103  LDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLWQV  162

Query  181  YKACIPL  187
            YK CIPL
Sbjct  163  YKNCIPL  169

>CCI47381
Length=211

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 73/149 (49%), Gaps = 21/149 (14%)

Query  48   QAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP  107
              K +      T  F    +++ ++TLRDF+   G Y         CG T+PNA P+PIP
Sbjct  49   SGKFDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIP  99

Query  108  TNGEF------RTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGK  159
             +            G+  +H GPCE+W+ +  V    NC    +       I++S+C G 
Sbjct  100  ADNAIVWENPDTREGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGG  159

Query  160  CMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            C+L+++WL +     +  WQ+YK CIP+A
Sbjct  160  CLLQFFWLALH----EPQWQVYKNCIPIA  184

>PYU1_G005868
Length=267

 Score = 89.4 bits (220),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 124/279 (44%), Gaps = 38/279 (14%)

Query  12   AIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQA-----------KLENQGYKTTK  60
            A+A+L   +  V AH  +  P   +     +TN+               K  +      K
Sbjct  5    AVASLALAAQQVSAHGYISSPAARFQPGAMQTNYVKTISESINPAFAGKKWNDNPEANAK  64

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT------NGEFRT  114
             F    +++ YK+LR+ +D          A  +CG+T  +  P  + +        +   
Sbjct  65   MFTTAFASSSYKSLREMLD---------SAVPDCGFTLTDGTPVDVSSLKSMKWQNDQEQ  115

Query  115  SGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPM  172
             G+  +H GPCE+WIDD  +    +C  D +       +DYS CKGKC L +YWL +   
Sbjct  116  KGFIDSHHGPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLALH--  173

Query  173  GKKYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKD--DDA  230
              + +WQIYK C+P+ + +GGG++ T   T    +  KP          A  G D  DD 
Sbjct  174  --EPNWQIYKQCVPIQNGSGGGSSSTPATTTKAPSTNKPAATTVAP---ATGGDDEYDDE  228

Query  231  KETPKPET-SKPAAASPKPTEPATLKPSQKPPSCNRRRD  268
              TP P T + PAAA+P  T+ A    S++     R++D
Sbjct  229  YSTPAPSTQTPPAAATPSATKKACKGKSRRMTENLRKQD  267

>PHYCA_534473
Length=1050

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 16/129 (12%)

Query  68   ANGYKTLRDFMDK-PGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
            +NGY  +R  +D     Y AN      CG+TDP+   +  PT G+   S G  H GPCEI
Sbjct  847  SNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVHAGPCEI  900

Query  126  WIDDVMVKSGKNCHY----DISEKA--FTDKIDYSACK-GKCMLKWYWLGIRPMGKKYSW  178
            W+DD  V S  +C         EKA  FT  +DYS+C    CML++YWL  + +  K  W
Sbjct  901  WLDDTKVLSNDDCQTAYGDGTQEKASVFT-PVDYSSCSTSGCMLRFYWLAFQGVDSKIVW  959

Query  179  QIYKACIPL  187
            Q+YK C+PL
Sbjct  960  QVYKDCVPL  968

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 67/128 (52%), Gaps = 14/128 (11%)

Query  68   ANGYKTLRDFMD-KPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
            +N  K +R  +D  P  Y        +CG TDP A P+  P+ G+   S G  H GPCEI
Sbjct  542  SNNVKDIRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEI  595

Query  126  WIDDVMVKSGKNCH--YDISEKAFTDK---IDYSACK-GKCMLKWYWLGIRPMGKKYSWQ  179
            W+DD MV    +C   Y    KA       +DYS+C  G CM ++YWL ++    K  WQ
Sbjct  596  WLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQ  655

Query  180  IYKACIPL  187
            +YK CIPL
Sbjct  656  VYKNCIPL  663

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 86/190 (45%), Gaps = 30/190 (16%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTN-WGPQAKLENQ---GY  56
            M    ++L   A  A T     V+AH  +  P   +   D++TN W    ++E Q   G+
Sbjct  1    MVSTTSILALVAAVATTVD--YVQAHGYIAKPAPSW--KDKETNDW--VVEIEPQWKGGW  54

Query  57   KTTK-------DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN  109
              +K        F    + N YK +R  MD    Y        +CG+TDP   P   PT+
Sbjct  55   DESKGDPGLLSTFKELAAKNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTD  108

Query  110  GEFRTS-GYTHEGPCEIWIDDVMVKSGKNCHYDISEK-----AFTDKIDYSAC-KGKCML  162
            G    S G  H GPCEIW+DD MV    +C     +      A    +DYS+C  G CML
Sbjct  109  GTATFSRGIVHAGPCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCML  168

Query  163  KWYWLGIRPM  172
            ++YWL ++ +
Sbjct  169  RFYWLALQRL  178

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 62/113 (55%), Gaps = 12/113 (11%)

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
            ++N  K +R  +D        K    +CGYT+P+  P+  PT+G    S G  H GPCEI
Sbjct  278  ASNNAKDIRTLLDS-----DTKLYGADCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  332

Query  126  WIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYWLGIRPM  172
            W+DD MV S  +C     D +++  +    +DYS+C  G CM ++YWL ++ +
Sbjct  333  WLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

>PHYRA_85794
Length=230

 Score = 88.6 bits (218),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 83/190 (44%), Gaps = 29/190 (15%)

Query  15   ALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLEN-----QGYKTTKDFNAYLSAN  69
            AL A +   EAH  +  P+  +       NW  Q  ++N      G      +    +  
Sbjct  12   ALLAFATRAEAHGHLNQPQPTFQDGASTVNWVVQ--IDNYWDIGSGGDQVGKYKTMAAEK  69

Query  70   GYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF-----RTSGYTHEGPCE  124
            G       +D  GA K       +CG+T  +  PQP+PTNG+         GYTH GPCE
Sbjct  70   GVSVRDVVLDMVGADK-------KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCE  122

Query  125  IWIDDVMVKSGKNCHYDI----SEKAFTDK--IDYSACKGKCMLKWYWLGIRPMGKKYSW  178
            ++IDD MV    NC  D     ++     +  +DYS+C G C    YWLG     +   W
Sbjct  123  LYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQW  178

Query  179  QIYKACIPLA  188
            Q Y  C+PL+
Sbjct  179  QAYINCVPLS  188

>PITG_08202
Length=191

 Score = 87.4 bits (215),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 89/191 (47%), Gaps = 31/191 (16%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQA-------KLEN  53
            +T   A +   A+ A + P+V  +AH  +  PE  +      + W  Q        K + 
Sbjct  2    LTTAAAFVSTAALLAASIPNV--DAHGYMLIPESQFK-GSANSAWIVQIDPVWASDKWDG  58

Query  54   QGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR  113
               K+   F +  +AN +K LR  MD    Y A      +CG+T+PN  PQPIP++G+  
Sbjct  59   NNAKSVDTFKSLKAANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKAT  112

Query  114  TS-GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSAC-KGKC-MLKWYWLGIR  170
             S    H GPC IW+DD M         DI        +DYS+C  G C  +++YWL  +
Sbjct  113  FSRALVHHGPCGIWLDDKM---------DIKS---IFPVDYSSCSNGGCKQMRFYWLAFQ  160

Query  171  PMGKKYSWQIY  181
             + KK  WQ Y
Sbjct  161  GLNKKTVWQSY  171

>PHALS_03176
Length=207

 Score = 87.8 bits (216),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 81/148 (55%), Gaps = 19/148 (13%)

Query  57   KTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-  115
            K+ K F    +AN +K L+  MD   A+ A      +CG++DP   PQPIP +G+   S 
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMDTS-AFGA------KCGFSDPKGKPQPIPKDGKATFSR  113

Query  116  GYTHEGPCEIWIDDVMVKSGKNCH-----YDISEKAFTDKIDYSAC-KGKCM-LKWYWLG  168
               H GPCEIW+D+  V    +C+      D++ K+    +DYS+C  G C  +++YWL 
Sbjct  114  AIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVF-PVDYSSCANGGCKEMRFYWLA  172

Query  169  IRPMGKKYSWQIYKACIPL---ADKNGG  193
             + +  K  WQ YK CIPL   + KNGG
Sbjct  173  FQGVNGKTVWQSYKNCIPLQGSSGKNGG  200

>PHYCA_534296
Length=309

 Score = 89.7 bits (221),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 13/133 (10%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F +  SAN +K L+  MD    Y A      +CG+T+P+   QPIPT+G+   S    H 
Sbjct  40   FKSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHV  93

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSAC-KGKCM-LKWYWLGIRPMGK  174
            GPCEIW+DD  V    +C+     +    K    +DYS+C  G C  +++YWL  + +  
Sbjct  94   GPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDG  153

Query  175  KYSWQIYKACIPL  187
            K  WQ YK CIPL
Sbjct  154  KTVWQSYKDCIPL  166

>PYVX_14662
Length=540

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 92/194 (47%), Gaps = 27/194 (14%)

Query  11   TAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTN-WGPQAKLENQGYKTTKDFNAYLSAN  69
            +A  AL+A    V  H  +  PE  +   D  T+ W  Q  +E Q    + D N   S +
Sbjct  10   SAAVALSATIARVRGHGYMLVPESQF--KDSTTSAWVVQ--IEPQWASDSWDGNNQGSVD  65

Query  70   GYKTL---------RDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTH  119
             YK+L         R  +D    Y  +      CG+TDP+   Q IPT+G+   S G  H
Sbjct  66   TYKSLAAEKGVTEIRSLLDDTSIYGQD------CGFTDPDGTAQDIPTDGKATFSRGMVH  119

Query  120  EGPCEIWIDDVMVKSGKNCHY----DISEKAFTDKIDYSACK-GKCM-LKWYWLGIRPMG  173
             GPCEIW+DD MV    +C+     D  +      +DYS+C  G C  +++YWL  + + 
Sbjct  120  VGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVD  179

Query  174  KKYSWQIYKACIPL  187
                WQ+YK CIPL
Sbjct  180  GDTVWQVYKNCIPL  193

>PHYSO_533747
Length=206

 Score = 87.4 bits (215),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 85/178 (48%), Gaps = 22/178 (12%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAK-------LENQGYKTTKDFNAYLSANGYKTLR  75
            V+AH  +Y P+  +      + W  Q               K+ + F +   AN +K L+
Sbjct  22   VDAHGYIYVPQSQFK-GGENSQWLVQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDLK  80

Query  76   DFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGE-FRTSGYTHEGPCEIWIDDVMVKS  134
              +D    Y        +CG+TDPN  PQPIPT+G+   + G  H GPCE W+DD  V  
Sbjct  81   TMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  135  GKNCHYDISEKAFTDK----IDYSACK-GKC-MLKWYWLGIRPM-GKKYSWQIYKACI  185
              +C+ +        K    IDYS+C+ G C M+++YWLG + +  KK  WQ Y   +
Sbjct  135  ADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYSTLL  192

>PHYRA_77971
Length=230

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 83/190 (44%), Gaps = 29/190 (15%)

Query  15   ALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLEN-----QGYKTTKDFNAYLSAN  69
            AL A +   EAH  +  P+  +       NW  Q  ++N      G      +    +  
Sbjct  12   ALLAFATRAEAHGHLDQPQPTFQDGASTVNWVVQ--IDNYWDIGSGGDQVGKYKTMAAEK  69

Query  70   GYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF-----RTSGYTHEGPCE  124
            G       +D  GA K       +CG+T  +  PQP+PTNG+         GYTH GPCE
Sbjct  70   GVSVRDVVLDMVGADK-------KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCE  122

Query  125  IWIDDVMVKSGKNCHYDI----SEKAFTDK--IDYSACKGKCMLKWYWLGIRPMGKKYSW  178
            ++IDD MV    NC  D     ++     +  +DYS+C G C    YWLG     +   W
Sbjct  123  LYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQW  178

Query  179  QIYKACIPLA  188
            Q Y  C+PL+
Sbjct  179  QAYINCVPLS  188

>PHYRA_78625
Length=434

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 78/175 (45%), Gaps = 53/175 (30%)

Query  24   EAHQRVYFPEVVYTLADRKTN-----WGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFM  78
            EAHQ VY P   +T ++  ++     W P + LE +G++T ++F  +   NGY +LRDF+
Sbjct  239  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  298

Query  79   DKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNC  138
            DK   YK                                             +  S  NC
Sbjct  299  DK-AKYK---------------------------------------------LALSYLNC  312

Query  139  HYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGG  193
            H  I+++ F  K+DYS C   C+L WYWLG R +   YSWQ+YK CI L   +G 
Sbjct  313  HESITDQTF--KLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGSGA  365

>SPRG_19916
Length=305

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 93/200 (47%), Gaps = 27/200 (14%)

Query  1    MTRLFAVLGATAIAA-LTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTT  59
            M    AV+   A+AA L A   ++      + P V+ T    +       K ++      
Sbjct  1    MVSANAVVSLFALAAPLVAGHGIISNPLAEFTPNVMRTTYVTRIQANFPGKFDDSPQTNV  60

Query  60   KDFN-AYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-----  113
             +FN A+ +   +KTLRD +D  G          +CG T  N   + IPTNG        
Sbjct  61   ANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  114  -TSGY--THEGPCEIWIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGK-CMLKWYWLG  168
               G+  +H GPCE+WIDD  V    +C  +   K A    IDYS+C G  CML++YWL 
Sbjct  112  TGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLA  171

Query  169  IR-PMGKKYSWQIYKACIPL  187
            +  PM     WQ+YK C+PL
Sbjct  172  LHEPM-----WQVYKNCVPL  186

>PHYRA_78626
Length=473

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 78/175 (45%), Gaps = 53/175 (30%)

Query  24   EAHQRVYFPEVVYTLADRKTN-----WGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFM  78
            EAHQ VY P   +T ++  ++     W P + LE +G++T ++F  +   NGY +LRDF+
Sbjct  278  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  337

Query  79   DKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNC  138
            DK   YK                                             +  S  NC
Sbjct  338  DK-AKYK---------------------------------------------LALSYLNC  351

Query  139  HYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGG  193
            H  I+++ F  K+DYS C   C+L WYWLG R +   YSWQ+YK CI L   +G 
Sbjct  352  HESITDQTF--KLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGSGA  404

>PHYRA_83494
Length=224

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 56/105 (53%), Gaps = 15/105 (14%)

Query  94   CGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCH-----YDIS  143
            CG TD +A PQ +PT+G+ +       G+TH GPCEI+IDD MV  G NC       D+ 
Sbjct  23   CGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDVG  82

Query  144  EKAFTDK-IDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
                +D  +DYS+C G C    YWL  +       WQ Y  C+PL
Sbjct  83   STVTSDMPVDYSSCNGDCTFTIYWLAFQ----NAQWQAYVNCVPL  123

>PYIW_16810
Length=216

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 83/176 (47%), Gaps = 18/176 (10%)

Query  23   VEAHQRVYFPEVVYTL-ADRKTNWGPQA--KLENQGYKTTKDFNAYLSANGYKTLRDFM-  78
            V+AH R+  P   +   A  K N+        +N    T   F A    NG+K+LR F+ 
Sbjct  23   VDAHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRATAATFAANYKKNGFKSLRAFIM  82

Query  79   --DKPGAYKAN-KGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVK--  133
                PG Y     G T ECG+TDPN  PQP+P    +    + HEGPCE W DDV+V   
Sbjct  83   DNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCDDVLVMPF  142

Query  134  SGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG--IRPMGKKYSWQIYKACIPL  187
            +     Y+   KA     D + C GK ML +YWL   + P      +Q Y  C+P+
Sbjct  143  TASCKSYEGGAKA-QMPYDKAKCAGKKMLHFYWLATFVSP------FQAYTNCVPI  191

>PYIR_20481
Length=277

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 88/191 (46%), Gaps = 33/191 (17%)

Query  14   AALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKT  73
            AA   P V+   + +V    V      +K N  P+A         TK F +  +  GYK+
Sbjct  26   AAKFQPGVMTTNYVKVITESVNDAFKGKKWNDNPEAN--------TKMFTSAFANTGYKS  77

Query  74   LRDFMD--KPGAYKANKGATVECGYTDPNAPP------QPIPTNGEFRTSGY--THEGPC  123
            L++ +D   PG           CG+T  +  P      + +    +    G+  +H GPC
Sbjct  78   LKEMLDLSVPG-----------CGFTLTDGAPVDVSGLKSMKWQNDQEQKGFIDSHHGPC  126

Query  124  EIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKA  183
            E+WID+  +    +C  D +       +DYS CKGKC L +YWL +     + +WQIYK 
Sbjct  127  EVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLALH----EPNWQIYKQ  182

Query  184  CIPLADKNGGG  194
            C+P+ + +G G
Sbjct  183  CVPIQNGSGSG  193

>PPTG_04620
Length=342

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 12/128 (9%)

Query  68   ANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIW  126
            +N  K +R  +D             +CG TDP A P+  P+ G+   S G  H GPCEIW
Sbjct  75   SNNVKDIRTMIDGDAKLYGE-----DCGNTDPKATPKDPPSTGDATFSRGIVHAGPCEIW  129

Query  127  IDDVMVKSGKNCHY---DISEKAFT--DKIDYSACK-GKCMLKWYWLGIRPMGKKYSWQI  180
            +DD MV    +C     D ++K  +    +DYS+CK G CM ++YWL ++    K  WQ+
Sbjct  130  LDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLWQV  189

Query  181  YKACIPLA  188
            YK CIPL+
Sbjct  190  YKNCIPLS  197

>PHYKE_3912
Length=252

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 66/122 (54%), Gaps = 11/122 (9%)

Query  74   LRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIWIDDVMV  132
            L D    P +  +  GA   CG+TDPNA P+  PT G+   S G  H G CEIW+DD MV
Sbjct  57   LHDIRTLPDSDNSLYGA--NCGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDTMV  114

Query  133  KSGKNCHY----DISEKA--FTDKIDYSACKGKC-MLKWYWLGIRPMGKKYSWQIYKACI  185
             S  +C      D  EKA  FT  ID S C     ML++YWL  + +  K  WQ+YK C+
Sbjct  115  LSSDDCQAAYRDDTQEKASVFT-PIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCV  173

Query  186  PL  187
            PL
Sbjct  174  PL  175

>PHYCA_69583
Length=224

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/212 (32%), Positives = 88/212 (42%), Gaps = 32/212 (15%)

Query  2    TRLFAVLGATAIAALTAPSVLVEAHQRVYFPE-----------VVYTLADRKTNWGPQAK  50
            T LFA         LTA    V+AH  +Y P            +V      + NW   A 
Sbjct  5    TPLFAATAVAVAGCLTA----VQAHGYMYIPLTEFKGTPTGAWIVQITPQLQANWESVAN  60

Query  51   LENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNG  110
             E       +       AN  + L D       Y AN      CG+++P+A  +  P++G
Sbjct  61   DEELIALYVEKAKEAGYANNIRKLLD--SDTNLYGAN------CGFSNPDAKAKDPPSDG  112

Query  111  EFRTS-GYTHEGPCEIWIDDVMVKSGKNCHYD------ISEKAFTDKIDYSACKGK-CML  162
                  G  H GPCEIW+DD MV    +C         +S K+    IDYS+C    CM 
Sbjct  113  TATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMF  172

Query  163  KWYWLGIR-PMGKKYSWQIYKACIPLADKNGG  193
            ++YWL  +     KY WQIYK CIPL     G
Sbjct  173  RFYWLAFQGSTSGKYVWQIYKDCIPLTGPGAG  204

>PHYCA_19611
Length=531

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 80/187 (43%), Gaps = 20/187 (11%)

Query  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK---------TTKDFNAYLSANGYKT  73
            V+ H  +  P+V +T     T +         G+           T +FN  ++A+ Y +
Sbjct  228  VKGHGYMSVPKVEFTFVGDTTQYMATIDSSTSGFSGQFGGSPADNTANFNKGMAASKYTS  287

Query  74   LRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP------TNGEFRTSGYTHEGPCEIWI  127
            L++FM+       NK  T ECGYT+P   PQP+P      ++G+      +HEGPCE+W 
Sbjct  288  LKEFMNDKMVL-VNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSHEGPCEVWC  346

Query  128  DDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            DD  V    NC  +          D  AC G   L  YW+ +       SWQ+Y  C  L
Sbjct  347  DDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH----SPSWQVYINCAAL  402

Query  188  ADKNGGG  194
                  G
Sbjct  403  EKTTSTG  409

 Score = 32.7 bits (73),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 18/43 (42%), Gaps = 4/43 (9%)

Query  152  DYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGG  194
            D  AC G   L +YWL +       +WQ+Y  C  L      G
Sbjct  109  DRDACLGASRLTFYWLALH----SSTWQVYTNCAALEKTTSTG  147

>PYU1_G001526
Length=334

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGYT--HEGPCE  124
            YK++R  +D  G ++   G   ECG T P    QP+P          + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQ--PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W D+V+  S  NC  +          D S C GK MLK+YWL +       +WQ Y AC
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  185  IPLADKNGGG  194
             PLA  + GG
Sbjct  197  APLAGGSSGG  206

>PYIR_22134
Length=300

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 83/183 (45%), Gaps = 24/183 (13%)

Query  23   VEAHQRVYFPEVVYTLADRKTNW-----GPQAKLENQGYKTTKD-------FNAYLSANG  70
            V+AH  +  P+  +T++   T +     GP       G   T D       F A L A+ 
Sbjct  26   VDAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKAST  85

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGYT--HEGPCE  124
            Y ++R  ++  G + +  GAT ECG T      QP+P          + G+T  H+GPCE
Sbjct  86   YDSVRALVEAKGVFIS--GATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCE  143

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            +W D+  V S +NC  +         ID++ C G  +LK  WL +       +WQIY  C
Sbjct  144  VWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH----SSTWQIYINC  199

Query  185  IPL  187
             PL
Sbjct  200  APL  202

>PHYRA_83500
Length=394

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 58/106 (55%), Gaps = 15/106 (14%)

Query  94   CGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCH-----YDIS  143
            CG TD +A PQPIP++G+ +       G+TH GPCEI++DD MV    NC       D+ 
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  144  EKAFTDK-IDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
                +D  +DYS+C GKC L  YWL  +       WQ Y  C PL+
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQ----NAQWQAYVNCAPLS  187

>PHYCA_12943
Length=287

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 58/106 (55%), Gaps = 15/106 (14%)

Query  93   ECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHY------D  141
            +CGYT  +  PQPIP++G  +       G+TH GPCEI+IDD MV  G +C        D
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPD  146

Query  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             S+K     +D+S+C GKC L  YWL  +       WQ Y  C+PL
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQ----NEQWQSYVNCVPL  188

>PYIR_24743
Length=357

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 100/213 (47%), Gaps = 48/213 (23%)

Query  2    TRLFAVLGATAIAALTAPSVL-----VEAHQRVYFPEVVYTLADRKTNWGP---------  47
            TR F   GA  +A   A +VL     V+AH  V  P     LA+ K    P         
Sbjct  8    TRHFN--GALVLATAAASNVLLLGSMVDAHGYVSSP-----LAEFKDGVMPTKYTATMSP  60

Query  48   --QAKLENQGYKTTKDFN-AYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQ  104
              Q K  +        F  A+   + +KTLRD +   GA         +CG + P+A  +
Sbjct  61   AFQGKFNDNPQANVDTFTKAFQGQSEFKTLRDLLKDHGA---------DCGDSKPDASRK  111

Query  105  PIPTNGEF------RTSGY--THEGPCEIWIDDVMVKSGKNC--HYDISEKAFTDKIDYS  154
             IP +G+          G+  +H GPCEIW+DD  V S +NC  H+    KA    +D+S
Sbjct  112  AIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKA-ELPVDFS  170

Query  155  ACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            +CK  CML++YWL +     + +WQ+YK C+PL
Sbjct  171  SCKENCMLRFYWLALH----EPTWQVYKNCVPL  199

>PPTG_03145
Length=301

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 91/203 (45%), Gaps = 26/203 (13%)

Query  11   TAIAALTAPSVLV---EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY--  65
            T+ A   A S+LV   EAH  +  P   +++    TN+     ++ Q Y    D  +Y  
Sbjct  5    TSTAVAVAASMLVATTEAHSYMSDPMPTWSVGYPTTNYA--GLIDGQDYLPVPDGMSYGG  62

Query  66   ------------LSANGYKTLRDFMDKPGAYKANK---GATVECGYTDPNAPPQPIPTNG  110
                         +A+ Y +L+D  DK    ++      AT ECG++ PN   + +P   
Sbjct  63   TPEGNTEAYWTAFNASKYTSLKDLADKTMVLQSLNPFGKATKECGFSIPNGSKRNLPAQV  122

Query  111  EFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIR  170
            +++  GY+H+GPCE+W DD +     NC     E       D   C G  M++ YW+ + 
Sbjct  123  QWKDFGYSHQGPCEVWCDDKLAFMDTNCALHYPEVPAFLPYDIDVCIGAKMIQSYWIALH  182

Query  171  PMGKKYSWQIYKACIPLADKNGG  193
             +     WQ+Y  C+PL  K  G
Sbjct  183  GL----PWQLYLNCVPLTGKTNG  201

>PHYCA_97965
Length=288

 Score = 86.7 bits (213),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 58/106 (55%), Gaps = 15/106 (14%)

Query  93   ECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDI-----  142
            +CGYT  +  PQPIP++G  +       G+TH GPCEI+IDD MV  G +C  +      
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAK  146

Query  143  -SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
             S+K     +D+S+C GKC L  YWL  +       WQ Y  C+PL
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQ----NEQWQSYVNCVPL  188

>PYIW_15526
Length=256

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 92/203 (45%), Gaps = 36/203 (18%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLE-NQGY---------  56
            ++   A+AAL   S   EAH  +  P+  YT     T++  +   + N+G+         
Sbjct  4    LIATVALAALAPQST--EAHGFISEPKATYTGGGSYTSFSAEIGADVNKGFSGRIFNRSP  61

Query  57   -KTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP-------T  108
             +   +F A     GY +L++ +DK         +   CGYT+PNA P  +         
Sbjct  62   EQNAAEFTAAWPKTGYTSLKEMLDK---------SVSGCGYTNPNAAPVDVSGLKSMKYQ  112

Query  109  NGEFRTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYW  166
            N E++  G+  +H GPCE WID+  +    +C         T  +DYS CKG C L +YW
Sbjct  113  NNEYK-EGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYW  171

Query  167  LGIRPMGKKYSWQIYKACIPLAD  189
            L +        WQ+YK C+ + +
Sbjct  172  LAVHSP----KWQVYKGCVAIKN  190

>PPTG_03138
Length=294

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 95/210 (45%), Gaps = 29/210 (14%)

Query  2    TRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD  61
            T  F+V+ ATA+ A       V AH  +  P V +   +  T +   A +E+     T  
Sbjct  5    TTCFSVMLATAMLAAN-----VYAHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGT  57

Query  62   FNAY-----------LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP-TN  109
            FN               ++ + +L++ +++      +  AT+ CG  DP+   QP+P T 
Sbjct  58   FNGAPADNTAAFTKAFESSSFSSLKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTY  116

Query  110  GEFRTS---GYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKW  164
             E+  S   G+T  HEGPCEIW DDV V  G +C  D +        D+ AC G  +L +
Sbjct  117  VEWAHSDSEGFTASHEGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTF  176

Query  165  YWLGIRPMGKKYSWQIYKACIPLADKNGGG  194
            YWL +       +WQ+Y  C PL      G
Sbjct  177  YWLALH----SSTWQVYVNCAPLESTTSTG  202

>PHYCA_98479
Length=276

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 60/110 (55%), Gaps = 15/110 (14%)

Query  89   GATVECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCH----  139
            G+  ECG+T  +   QP+PT+G  +       G+TH GPCEI+IDD MV  G NC     
Sbjct  81   GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYP  140

Query  140  -YDISEKAFTDK-IDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
              D+     +D  +DYS+CKG C L  YWLG     +   WQ Y  C+PL
Sbjct  141  GGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGF----QNAQWQAYINCVPL  186

>PHYRA_73581
Length=293

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 101/203 (50%), Gaps = 28/203 (14%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVV----YTLADRKTNWGPQAKLENQG-YKTTKD  61
            +L ATA+AA+   +  V+AH  +Y P  V    Y    + ++W  Q   + +  + +  D
Sbjct  7    LLVATAVAAVGCLTSQVQAHGYMYLPLAVPLAKYKKGKQISSWIVQIDPQLEADWNSISD  66

Query  62   FNAYLSA-------NGYKT-LRDFMDK-PGAYKANKGATVECGYTDPNAPPQPIPTNGEF  112
              A ++        +GY+  +R  +D     Y A+      CGY+DP+A P+  PT+G  
Sbjct  67   DTALIALYADKAKESGYENDVRKLLDSDANLYGAD------CGYSDPDADPKDPPTDGTA  120

Query  113  RTS-GYTHEGPCEIWIDDVMVKSGKNCHYDI------SEKAFTDKIDYSACKGK-CMLKW  164
              S G  H GPCEIW+DD MV    +C          + K+    IDYS+C    CML++
Sbjct  121  TFSRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRF  180

Query  165  YWLGIRPMGKKYSWQIYKACIPL  187
            YWL  +     Y WQIYK C+PL
Sbjct  181  YWLAFQGSNDGYVWQIYKHCVPL  203

>PYAP_18221
Length=226

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 88/203 (43%), Gaps = 43/203 (21%)

Query  12   AIAALTAPSVLV---EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGY------------  56
             ++AL A + LV   EAH  +  P   +      T++  +   +  G             
Sbjct  6    VLSALVAATALVNNAEAHGYISNPRPDFVPGKMYTDFNAEFTAQQTGIAAFQGKPFNRSP  65

Query  57   -KTTKDFNAYLSANGYKTLRDFMDK--PGAYKANKGATVECGYTDPNAPPQPIP------  107
             + T+ F      +G K+LR+ MDK  PG           CG T+PN  P+ +       
Sbjct  66   EQNTQVFTDAFKQSGLKSLRELMDKYVPG-----------CGNTNPNTTPRDVTKLKTMT  114

Query  108  -TNGEFRTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKW  164
              N E++  G+  +H GPCE+WID+  V    +C  +         +DYS CKG C L +
Sbjct  115  YQNNEYK-EGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAALPVDYSKCKGTCRLTF  173

Query  165  YWLGIRPMGKKYSWQIYKACIPL  187
            YWL +        WQ YK C+P+
Sbjct  174  YWLALHSQ----KWQAYKQCVPI  192

>PHYRA_83499
Length=473

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 79/188 (42%), Gaps = 42/188 (22%)

Query  94   CGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHY------DI  142
            CGYT  +  PQPIPT+G+ +       G+TH GPCEI+IDD MV  G +C        D 
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGGnnktkvpt  202
            S K     +DYS+C G+C L  YWL  +       WQ Y  C+ L    G G+       
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQ----NAQWQAYVNCVSL---KGSGSATQTQTQ  198

Query  203  ptnkapakptkapapkkDDAEVGKDDDAKETPKPETSKPAAAS--------PKPTEPATL  254
             ++                AE   D    E P  ET   A +S        P  T  +T 
Sbjct  199  TSS----------------AESSADQQTTEAPSTETQSAAGSSTGNESTDAPAATTQSTE  242

Query  255  KPSQKPPS  262
             PS +  S
Sbjct  243  APSTETQS  250

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 36/67 (54%), Gaps = 10/67 (15%)

Query  121  GPCEIWIDDVMVKSGKNCHYDISEKA-----FTDK-IDYSACKGKCMLKWYWLGIRPMGK  174
            GPCEI++DD M+  G NC  + S  A      +D  IDYS+C G C L  YWLG +    
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQ----  406

Query  175  KYSWQIY  181
               WQ Y
Sbjct  407  NEQWQAY  413

>PHYKE_10296
Length=512

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 96/202 (48%), Gaps = 26/202 (13%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGY----  56
            M  L +VL   ++AA       +   +  Y P  +YT  ++ T        +   Y    
Sbjct  1    MKVLASVLLFASLAASVQSHGYISKPKASYKPNTIYTTYNKLTGASINKGFDGGHYNWSP  60

Query  57   -KTTKDFNAYLSANGYKTLRDFMD--KPG-AYKANKGATVEC-GYTDPNAPPQPIPTNGE  111
             +  + F  + +A GYK+LRD +D   PG  +       V   GYT      +    N E
Sbjct  61   TQNAQAFKDHWNATGYKSLRDMLDPIAPGYGFSLETADPVNVAGYT------EMWWQNDE  114

Query  112  FRTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWL  167
            ++  G+  +HEGPCE WIDD+MV    NC      K++  KI  DYS+CKG C+  +YWL
Sbjct  115  YK-EGFIASHEGPCEGWIDDIMVFHHDNCAAQF--KSYPAKIPTDYSSCKGDCLFVFYWL  171

Query  168  GIRPMGKKYSWQIYKACIPLAD  189
             +     +  WQIYK C+P+ +
Sbjct  172  ALH----QAEWQIYKQCVPITN  189

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 84/200 (42%), Gaps = 37/200 (19%)

Query  15   ALTAPSVLVEAH-----QRVYFPEVVYTLADRKTNWGPQAKLENQGY-----KTTKDFNA  64
            A TAP   V A      +  Y P  +YT  +R TN           Y     +  + F  
Sbjct  290  ATTAPVATVAATDSGKPKASYKPNTIYTTYNRLTNASVNKGFSGGHYNWSPEQNVQAFTD  349

Query  65   YLSANGYKTLRDFMD--KPGAYKANKGATVECGYTDPNAPPQPIPT-------NGEFRTS  115
            +  A GYK+LRD +D   PG            G++   A P  +         N E++  
Sbjct  350  HWKATGYKSLRDMLDPLSPGY-----------GFSLETADPVDVSNIKEMWWQNDEYK-E  397

Query  116  GY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            G+  +H GPCE WID  MV    +C             DYS+CKG C+  +YWL +    
Sbjct  398  GFLESHHGPCEGWIDGKMVFHYDDCVAKFPSYPAKIPTDYSSCKGDCLFVFYWLALH---  454

Query  174  KKYSWQIYKACIPLADKNGG  193
             +  WQIYK C+P+ +   G
Sbjct  455  -QADWQIYKQCVPITNGGSG  473

>SPRG_22161
Length=300

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 112/281 (40%), Gaps = 70/281 (25%)

Query  1    MTRLFAVLGATAIAA-LTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTT  59
            M    AV+   A+AA L A   ++      + P V+ T    +       K ++      
Sbjct  1    MVGFNAVVSLFALAAPLVAGHGIISNPLAEFTPNVMRTTYVTRIQANFPGKFDDSPQTNV  60

Query  60   KDFN-AYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR-----  113
             +FN A+ +   +KTLRD +D  G          +CG T  N   + IPTNG        
Sbjct  61   ANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  114  -TSGY--THEGPCEIWIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGK-CMLKWYWLG  168
               G+  +H GPCE+WID+  V    +C  +   K A    +DYS+C    CML++YWL 
Sbjct  112  TGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLA  171

Query  169  IR-PMGKKYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKD  227
            +  PM     WQ+YK C+PL                                     G  
Sbjct  172  LHEPM-----WQVYKNCVPLK------------------------------------GNG  190

Query  228  DDAKETPKPETSKPAAASPKPTEPA------TLKPSQKPPS  262
                  PKP T+KP   +PKP  P       T KP+ KP S
Sbjct  191  QQPTSAPKP-TAKPVNPTPKPVNPTPKPVNPTTKPTTKPMS  230

>PYIR_25999
Length=344

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 82/195 (42%), Gaps = 23/195 (12%)

Query  10   ATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQA-----------KLENQGYKT  58
            A  +A L A    V+AH  +  P+  +T+    T +                        
Sbjct  11   ACVLATLVAVPGAVDAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESN  70

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRT  114
            TK F A +  + YK++RD ++  G   A  GAT +CG T     PQP+P          +
Sbjct  71   TKAFTAAIKTSAYKSVRDLINAKGVMMA--GATKQCGITSATGTPQPLPAKYVEWSHGAS  128

Query  115  SGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPM  172
             G+T  H+GPCE+W DD +  +  NC  +         ID+S C GK +L   WL +   
Sbjct  129  EGFTPSHQGPCEVWCDDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLALH--  186

Query  173  GKKYSWQIYKACIPL  187
                +WQ Y  C  L
Sbjct  187  --SPTWQAYINCAVL  199

>H257_13550
Length=266

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 94/198 (47%), Gaps = 31/198 (16%)

Query  5    FAVLGATAIAALTAPSVLVEAHQRVYFPEVVYT--LADRKTNWGPQAKLENQGYKTTKDF  62
            FAV  AT  A + A   ++   +  + P V+ T  +A  + N+    K  +   K    F
Sbjct  40   FAV--ATIFATMVAGHGIMSVPKAEFDPTVMRTTYVATIQANF--PGKFNDSPDKNVAAF  95

Query  63   NAYL---SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEF------R  113
            N       A G+KTLR  +D  G          +CGY+  + P +PIP++G         
Sbjct  96   NKAFRDQQATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDS  146

Query  114  TSGY--THEGPCEIWIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGKCMLKWYWLGIR  170
              G+  +H GPCEIW+D+  V    +C  +  EK A    +D+++C G C +++YW+ + 
Sbjct  147  GEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALH  206

Query  171  PMGKKYSWQIYKACIPLA  188
                +  WQ+YK C PL 
Sbjct  207  ----QDLWQVYKNCAPLV  220

>PHYCA_120062
Length=212

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 97/209 (46%), Gaps = 20/209 (10%)

Query  65   YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR--TSGYTHEGP  122
            + + N   +++D++ K   Y ++     ECG T  N  PQP+PT+G  +  + G +H GP
Sbjct  17   WFTKNNVDSVKDYVTK---YASD---IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGP  70

Query  123  CEIWIDDVMVKSGKNCHYDISEKAFTD-KIDYSACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            CEIW DD  V    NC  + + +  T   ID   CK    L +YWL +        WQ+Y
Sbjct  71   CEIWCDDTRVFHNTNCAGEYAGQVPTSLPIDLDTCKSSSELVFYWLALHVQ----PWQVY  126

Query  182  KACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDDDAKETPKPETSKP  241
              C+ L      G +K+   +  +K    PT       DD  VG + D +     ET++ 
Sbjct  127  INCVTLDGSAAAGKSKSNSTSSASKTTTAPTFTFGETLDDDSVGGEADEEV----ETTEV  182

Query  242  AAASPKP---TEPATLKPSQKPPSCNRRR  267
             AA+P P     PAT  PS     C RRR
Sbjct  183  PAATPAPETNVPPATTAPSISSSKCLRRR  211

>CCA17179
Length=185

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 70/149 (47%), Gaps = 21/149 (14%)

Query  48   QAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP  107
              K +      T  F    +++ ++ LRDF+   G Y         CG T+PNA P+PIP
Sbjct  23   SGKFDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIP  73

Query  108  TNGEF------RTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGK  159
             +            G+  +H GPCE+W+++  V    NC            ID+S C   
Sbjct  74   ADHAIVWENPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNG  133

Query  160  CMLKWYWLGIRPMGKKYSWQIYKACIPLA  188
            C+L+++WL +     +  WQ+YK CIP+A
Sbjct  134  CLLQFFWLALH----EPQWQVYKNCIPIA  158

>HYAP_11923
Length=606

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 61/127 (48%), Gaps = 10/127 (8%)

Query  71   YKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGY-----THEGPCEI  125
            + +++D     G   A KGAT+ECG TDPN  PQPIP   E+  SG      +HEGPCE 
Sbjct  79   FSSIKDLATSLGQIVA-KGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEA  137

Query  126  WIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACI  185
            W DD  V   +NC    +        D + C G     +YWL +       +WQ+Y  C 
Sbjct  138  WCDDTQVFQDENCAAHFTTAPAKMPYDKAKCSGASRFTFYWLALH----SSTWQVYVNCA  193

Query  186  PLADKNG  192
             L   +G
Sbjct  194  ALEGGSG  200

>PHYRA_78176
Length=312

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 11/142 (8%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRT  114
            T  F     ++ Y +L++F+D          AT+ CG  DP+   QP+P          +
Sbjct  67   TAAFTTAFESSSYSSLKEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDS  125

Query  115  SGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPM  172
             G+T  HEGPCE+W DDV V    +C  D +        D+ AC G  +L +YWL +   
Sbjct  126  EGFTASHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH--  183

Query  173  GKKYSWQIYKACIPLADKNGGG  194
                +WQ+Y  C PL      G
Sbjct  184  --SSTWQVYVNCAPLESSTSTG  203

>PHALS_04411
Length=262

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 85/208 (41%), Gaps = 40/208 (19%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F    + N YK +R  MD       N     +CG+TDP   P   P++G    S G  H 
Sbjct  67   FKELAAKNNYKNVRTLMD------GNPAFGEDCGFTDPKGKPVDPPSDGTATFSRGIVHA  120

Query  121  GPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSAC-KGKCMLKWYWLGIRPMGK  174
            GPCE+W +D M+    +C     D +++  T    + YS C  G  +L++YWL ++ +  
Sbjct  121  GPCELWCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQG  180

Query  175  KYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDD--DAKE  232
            K  WQ YK CIPL     GG                          D+  GKD   D+  
Sbjct  181  KVVWQAYKNCIPLTGPGSGGG-------------------------DSNAGKDSYGDSDP  215

Query  233  TPKPETSKPAAASPKPTEPATLKPSQKP  260
            T  P    P   SP P   +    S+ P
Sbjct  216  TQTPYEEDPTQVSPTPNNDSKSPSSESP  243

>PHYSO_255056
Length=269

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 94/205 (46%), Gaps = 26/205 (13%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLE-NQGYKTT  59
            M  + + + ATA+A +   +  V+AH  +  P   +        W  Q   + N  ++  
Sbjct  1    MVSVASFISATAVAVVGCLTTQVQAHGYMLIPLTEFK-GTATGAWIVQISPQFNANWEFV  59

Query  60   KDFNAYLSA-------NGY-KTLRDFMDK-PGAYKANKGATVECGYTDPNAPPQPIPTNG  110
             D    ++         GY   +R  +D     Y A      +CG+++P+A P+  PT+G
Sbjct  60   ADDTELIALYVEKAKEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDG  113

Query  111  EFRTS-GYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGI  169
                  G  H GPCEIW+DD MV      H D   KAF+ + DY +  G CM ++YWL  
Sbjct  114  TATFERGLAHHGPCEIWLDDTMV-----LHNDDCAKAFSVE-DYMSING-CMFRFYWLAF  166

Query  170  R-PMGKKYSWQIYKACIPLADKNGG  193
            +     KY WQIYK CIPL     G
Sbjct  167  QGSTSGKYVWQIYKNCIPLTGPGAG  191

>PHALS_03179
Length=372

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 91/202 (45%), Gaps = 22/202 (11%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNW----GPQAKLENQGYKTTKD  61
            AV+ +T +   T  S  +E+H  V  P+  +        W     P  K  +    T + 
Sbjct  45   AVIASTILILATLMSS-IESHGYVLIPQTQFKGLPGNEAWIVQIDPLWKSSDWNGNTEQS  103

Query  62   FNAYLS---ANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GY  117
              AY S   AN +K L+  M+             ECG++DP   PQPIP +G+   S   
Sbjct  104  VKAYQSLKAANNFKDLKTLME-------THALGPECGFSDPKGKPQPIPKDGKATLSRAI  156

Query  118  THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDK----IDYSAC-KGKCM-LKWYWLGIRP  171
             H GPCE+W+D+  V    +C+     +    K    +DYS+C  G C  +++YWL  + 
Sbjct  157  VHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQG  216

Query  172  MGKKYSWQIYKACIPLADKNGG  193
            +     WQ YK CIPL    GG
Sbjct  217  IKGITFWQSYKNCIPLQGSGGG  238

>PYIW_18790
Length=86

 Score = 80.1 bits (196),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 48/79 (61%), Gaps = 1/79 (1%)

Query  29   VYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANK  88
            V  PE  +T+  R   + P A LENQG+KTT DF AY    GYKTLRDFMD   AYK + 
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVD-  63

Query  89   GATVECGYTDPNAPPQPIP  107
            G   ECG++     PQPIP
Sbjct  64   GGDFECGWSTLKGTPQPIP  82

>PYU1_G005985
Length=200

 Score = 83.2 bits (204),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 94/209 (45%), Gaps = 37/209 (18%)

Query  4    LFAVLGATAIAALTAPSV-LVEAHQRVYFPEVVYTLADRKTNWGPQA-----------KL  51
            +F++   + +  +   S+  VEAH  +  P+  Y     KT++               K 
Sbjct  1    MFSITSLSVLLGILVASIPQVEAHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKW  60

Query  52   ENQGYKTTKDFNAYLSANGYKTLRDFMD--KPGAYKANKGATVECGYTDPNAPPQPIPTN  109
            +    + T+ F +   A GY +L+  +D   PG           CG +  + PP  +   
Sbjct  61   DGSPQENTQQFTSGFHAAGYSSLKALLDPVAPG-----------CGNSRVDVPPVGVSRL  109

Query  110  G--EFRTSGY------THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCM  161
               EFR   +      +H GPCE+WID+  +  G +C    +    T  +++S C+GKC 
Sbjct  110  AAMEFRNDEFHEGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCT  169

Query  162  LKWYWLGIRPMGKKYSWQIYKACIPLADK  190
            L +YWL +     + +WQ+YK C+P+ ++
Sbjct  170  LTFYWLALH----EPTWQVYKQCVPIENQ  194

>PHYSO_488921
Length=296

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 99/199 (50%), Gaps = 36/199 (18%)

Query  16   LTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLE-NQGY----------KTTKDF  62
            L A S++  V AH  +  P+  Y      T +        N+G+             K F
Sbjct  8    LAAASLMATVHAHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAF  67

Query  63   NAYLSANGYKTLRDFMD--KPGAYKANKGAT-VEC-GYTDPNAPPQPIPTNGEFRTSGY-  117
            N + +A GYK+LR+ +D   P    + K AT V+  GYT      +    N E++  G+ 
Sbjct  68   NDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDVTGYT------EMWWQNDEYK-EGFI  120

Query  118  -THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWLGIRPMGK  174
             +H GPCE WIDDV +    NC  +   K++  K+  DYS+CKG C+L +YWL +     
Sbjct  121  NSHSGPCEAWIDDVKIFHHDNCAAEF--KSYPAKVPADYSSCKGDCLLVFYWLALH----  174

Query  175  KYSWQIYKACIPLADKNGG  193
            + +WQIYK C+P+   NGG
Sbjct  175  EPNWQIYKQCVPIT--NGG  191

>PHYCA_10471
Length=309

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 86/192 (45%), Gaps = 24/192 (13%)

Query  20   SVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKD---------------FNA  64
            +V  EAH  +  P   +++    TN+     ++ Q Y    D               + A
Sbjct  16   TVTTEAHSYMTDPMPTWSVGYPTTNYA--GLIDGQDYLPVPDGMSYGGTPEGNTEAYWTA  73

Query  65   YLSANGYKTLRDFMDKPGAYKANK---GATVECGYTDPNAPPQPIPTNGEFRTSGYTHEG  121
            + ++  Y +L+D  DK    ++      AT ECG++ PN   + +P   +++  GY+H+G
Sbjct  74   FNASKKYSSLKDLADKTMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFGYSHQG  133

Query  122  PCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            PCE+W DD +  S  NC     E       D   C G  M++ YW+ +  +     WQ+Y
Sbjct  134  PCEVWCDDKLAFSDTNCALHYPEVPANLPYDVDVCTGAKMMQSYWIALHGL----PWQLY  189

Query  182  KACIPLADKNGG  193
              C+ L+ K  G
Sbjct  190  LNCVRLSGKTNG  201

>PYIR_25334
Length=272

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 65/131 (50%), Gaps = 9/131 (7%)

Query  63   NAYLSA----NGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYT  118
            NAYL+       YK+L+D      A K   GA+ ECGY+      QP+P   ++     +
Sbjct  69   NAYLAGFKAQTKYKSLKDLATS-AAVKLEAGASKECGYSSVTGTAQPLPDTVQWDRFDSS  127

Query  119  HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSW  178
            H GPCE+W DDV+     NC   ++      K D S C GK ML  +W+ +       +W
Sbjct  128  HMGPCEVWCDDVLAFEDDNCSVHMTTTPAVLKYDKSKCVGKKMLTSFWIALH----VPTW  183

Query  179  QIYKACIPLAD  189
            QIY  C P+A+
Sbjct  184  QIYTNCAPIAE  194

>PHYRA_77290
Length=309

 Score = 85.1 bits (209),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 98/202 (49%), Gaps = 30/202 (15%)

Query  7    VLGATAIAALTAPSVLVEAHQRV------YFPEVVYTLADRKTNWGPQAKLENQGY----  56
            VL  ++I A+ + +  V  H  +      Y P  +YT  ++ T     +  +   Y    
Sbjct  3    VLSPSSILAIASLAAGVHGHGYISQPKATYEPNTIYTTYNKLTTASINSGFDGGHYNWSP  62

Query  57   -KTTKDFNAYLSANGYKTLRDFMD--KPGAYKANKGATVECGY-TDPNAPPQPIPTNGEF  112
             +  + F  + +A GYK+LRD +D   PG      G ++E     D +   +    N E+
Sbjct  63   TQNAQAFIDHWNATGYKSLRDMLDPIAPG-----YGHSLETADPVDVSGYKEMWWQNDEY  117

Query  113  RTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWLG  168
            +  G+  +HEGPCE W+DDV +    NC      K +  K+  D+S+CKG C+  +YWL 
Sbjct  118  K-EGFIASHEGPCEAWVDDVQIFHHDNCAAQF--KTYPAKVPADFSSCKGDCLFVFYWLA  174

Query  169  IRPMGKKYSWQIYKACIPLADK  190
            +     + +WQIYK C+P+ + 
Sbjct  175  LH----EPNWQIYKQCVPITNS  192

>PHYKE_6002
Length=197

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 84/180 (47%), Gaps = 24/180 (13%)

Query  13   IAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQ-------AKLENQGYKTTKDFNAY  65
            I A + P V   AH  +  PE  +   D+ + W  Q       +  +    ++   F++ 
Sbjct  13   IMAASIPQV--NAHGYMLIPESQFK-GDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSL  69

Query  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCE  124
              AN +  L+  MD    Y A      +CG+TDP+  PQPIP++G+   S    H GPCE
Sbjct  70   KKANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCE  123

Query  125  IWIDDVMVKSGKNCHYDISEKAFTDKIDYSACK-GKCM-LKWYWLGIRPMGKKYSWQIYK  182
            IW+D     S  NC         T  +DYS+C  G C  +++YWL  + +  K  WQ Y+
Sbjct  124  IWLDSTKAFSKDNC-----ADMETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PYIR_24421
Length=213

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 12/139 (9%)

Query  60   KDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTS  115
            K F A L ++ YK++RD ++   ++ +  GA+ ECG +  +   QP+P          + 
Sbjct  40   KAFTAALKSSSYKSVRDLVNAKASFIS--GASKECGISSSSGAKQPLPAQYVEWAHSSSE  97

Query  116  GYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            G+T  HEGPCE+W D+ +  S  NC  +          D S C G  ML++YW+ +    
Sbjct  98   GFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVALH---  154

Query  174  KKYSWQIYKACIPLADKNG  192
               +WQ+Y  C PL+   G
Sbjct  155  -SSTWQVYINCAPLSGAKG  172

>PITG_11937
Length=305

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 68/139 (49%), Gaps = 10/139 (7%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR---TS  115
            T+ F    S++ + ++++F+   G   A  GA ++CG TDPN  PQP+P   E+    T 
Sbjct  60   TETFWTAFSSSKFTSIKEFVTALGQVVAT-GANLQCGLTDPNETPQPLPEQIEWTHSDTE  118

Query  116  GYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            G+T  HEGPCE W DD  V    NC    +        + +AC G   L +YWL +    
Sbjct  119  GFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKLPYNKAACSGASRLAFYWLALH---  175

Query  174  KKYSWQIYKACIPLADKNG  192
               +WQ+Y  C  L    G
Sbjct  176  -SSTWQVYANCAALEGAGG  193

>PPTG_07516
Length=294

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 94/207 (45%), Gaps = 52/207 (25%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY  65
            AV  +  + ALT+    VEAH  +  P         K +W  +    N G+ T  D    
Sbjct  5    AVFSSAIVLALTS---RVEAHGYLEQP---------KPSWKDKP---NVGWITMVDNYWD  49

Query  66   LSANGYKTLRDFMDKPGAYKA---NKGATVE-----------CGYTDPNAPPQPIPTNGE  111
            + + G        D+ G +KA    KG +V+           CG T  N  PQPIP +G+
Sbjct  50   IGSGG--------DQIGKFKAMAKEKGMSVKDVVLDMVKDQKCGNTLENGDPQPIPADGK  101

Query  112  FR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDI------SEKAFTDKIDYSACKGKC  160
             +       G+TH GPCEI++DD MV  G +C  +       S++     +D+S+C GKC
Sbjct  102  VKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKC  161

Query  161  MLKWYWLGIRPMGKKYSWQIYKACIPL  187
            +L  YWL  +       WQ Y  C+PL
Sbjct  162  LLTIYWLAFQ----NAQWQTYVNCVPL  184

>PPTG_07520
Length=294

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 94/207 (45%), Gaps = 52/207 (25%)

Query  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY  65
            AV  +  + ALT+    VEAH  +  P         K +W  +    N G+ T  D    
Sbjct  5    AVFSSAIVLALTS---RVEAHGYLEQP---------KPSWKDKP---NVGWITMVDNYWD  49

Query  66   LSANGYKTLRDFMDKPGAYKA---NKGATVE-----------CGYTDPNAPPQPIPTNGE  111
            + + G        D+ G +KA    KG +V+           CG T  N  PQPIP +G+
Sbjct  50   IGSGG--------DQIGKFKAMAKEKGMSVKDVVLDMVKDQKCGNTLENGDPQPIPADGK  101

Query  112  FR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDI------SEKAFTDKIDYSACKGKC  160
             +       G+TH GPCEI++DD MV  G +C  +       S++     +D+S+C GKC
Sbjct  102  VKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKC  161

Query  161  MLKWYWLGIRPMGKKYSWQIYKACIPL  187
            +L  YWL  +       WQ Y  C+PL
Sbjct  162  LLTIYWLAFQ----NAQWQTYVNCVPL  184

>PHYSO_329293
Length=310

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 99/199 (50%), Gaps = 36/199 (18%)

Query  16   LTAPSVL--VEAHQRVYFPEVVYTLADRKTNWGPQAKLE-NQGY----------KTTKDF  62
            L A S++  V AH  +  P+  Y      T +        N+G+             K F
Sbjct  8    LAAASLMATVHAHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAF  67

Query  63   NAYLSANGYKTLRDFMD--KPGAYKANKGAT-VEC-GYTDPNAPPQPIPTNGEFRTSGY-  117
            N + +A GYK+LR+ +D   P    + K AT V+  GYT      +    N E++  G+ 
Sbjct  68   NDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDVTGYT------EMWWQNDEYK-EGFI  120

Query  118  -THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWLGIRPMGK  174
             +H GPCE WIDDV +    NC  +   K++  K+  DYS+CKG C+L +YWL +     
Sbjct  121  NSHSGPCEAWIDDVKIFHHDNCAAEF--KSYPAKVPADYSSCKGDCLLVFYWLALH----  174

Query  175  KYSWQIYKACIPLADKNGG  193
            + +WQIYK C+P+   NGG
Sbjct  175  EPNWQIYKQCVPIT--NGG  191

>PYAP_23672
Length=257

 Score = 83.6 bits (205),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 124/274 (45%), Gaps = 29/274 (11%)

Query  4    LFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTL--ADRKTNWGPQAKLENQGYKTTKD  61
            +FA + A  + +    S  VEAH  +  P   Y        +   P            + 
Sbjct  1    MFARVSAAVVLSTLVVSN-VEAHGELMLPRPTYPKWGGGVTSTISPSVLPFAWRQDFPQA  59

Query  62   FNAYLSANGYKTLRDFMDK----PGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGY  117
            F+  ++  G  +L+DF+ K     GA  ++ G+T ECGY+DP   PQP+P   +F T G+
Sbjct  60   FDEAITKTGL-SLKDFIMKYQNMSGA--SDTGSTPECGYSDPKGTPQPLPEKIQFHT-GF  115

Query  118  THEGPCEIWIDDVMV-KSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKY  176
             H GPCE + D+V+V K   +C       A     D + C GK   K+YWLG+   G   
Sbjct  116  MHWGPCEAYCDNVLVTKHAADCKVAYPGGAV--PYDKAKCAGKKQFKFYWLGMD-SGNSA  172

Query  177  SWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEVGKDDDAKETPKP  236
             WQ Y  C+PL   +G G +     +  +  PA  T A +             AK+TP  
Sbjct  173  PWQAYVNCVPL---SGAGASSDSNASDADDEPASSTPAVSK-------ASKAPAKDTPA-  221

Query  237  ETSKPAAASPKPTEPATLKPSQKP-PS--CNRRR  267
             T+KP  ++PKPT    +  S  P PS  C RR+
Sbjct  222  TTNKPITSAPKPTNSEPMPSSSAPAPSGKCIRRQ  255

>PHYKE_6076
Length=272

 Score = 83.6 bits (205),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 90/208 (43%), Gaps = 27/208 (13%)

Query  7    VLGATAIAALTAPSVLV---EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK------  57
            V   ++ +A+ A + LV    AH  +  P+V +T     T +    +    G+       
Sbjct  2    VASKSSFSAMVAAATLVASVNAHGYMSVPKVEFTFVGDTTQFMATIEASATGWSGSFGGS  61

Query  58   ---TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP-TNGEFR  113
                T  F     ++ Y +L++ +   G   +    T ECGYT+P+   QP+P T  E+ 
Sbjct  62   PADNTAAFTTAFESSKYSSLKELVTDLGKLTSTS-YTTECGYTNPDETAQPLPDTYVEWA  120

Query  114  TS---GYT--HEGPCEIWIDDVMVKSGKNC--HYDISEKAFTDKIDYSACKGKCMLKWYW  166
             S   G+T  HEGPCE+W DDV V    +C  HY  +        D+ AC G   L  YW
Sbjct  121  HSDSEGFTPSHEGPCEVWCDDVRVFQDDDCAAHYTTAPAKL--PYDHDACLGSSRLTLYW  178

Query  167  LGIRPMGKKYSWQIYKACIPLADKNGGG  194
            L +       +WQ+Y  C  L      G
Sbjct  179  LALHSS----TWQVYTNCAALESTTSTG  202

>PYVX_19277
Length=331

 Score = 84.3 bits (207),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 82/199 (41%), Gaps = 20/199 (10%)

Query  11   TAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK---------TTKD  61
            +AI A TA    V  H  +  P V +T+    T +    +    G+           T  
Sbjct  9    SAILAATAVVAQVNGHGYMSDPVVEFTITGDTTQFMATIESTASGFTGTFSSDPATNTAS  68

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGY  117
            F     A+ Y +LR+F++  G        T+ CGYT+PN   Q +P          T G+
Sbjct  69   FTKAFDASTYTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGF  127

Query  118  T--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKK  175
            T  HEGPCE+W D+  V    +C  + +        D  AC G   L +YWL +      
Sbjct  128  TSSHEGPCEVWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLALHSS---  184

Query  176  YSWQIYKACIPLADKNGGG  194
             +WQ+Y  C  L +    G
Sbjct  185  -TWQVYINCAALEETTSTG  202

>PHYSO_488139
Length=265

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 116/282 (41%), Gaps = 36/282 (13%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRV------YFPEVVYT----LADRKTNWGPQAK  50
            M   F   GA  +AAL +    V AH  +      Y P  +YT    L     N G    
Sbjct  1    MKTFFTPSGALTLAALVS---CVNAHGYISKPKASYKPNTIYTTYNGLTGASVNKGFDGG  57

Query  51   LEN-QGYKTTKDFNAYLSANGYKTLRDFMD--KPGAYKANKGATVECGYTDPNAPPQPIP  107
            + N +     K F  +  A GYK+LRD +D   PG  K+   AT      D ++  +   
Sbjct  58   VYNHEPENNAKQFAEHWQATGYKSLRDMIDPISPGYGKSLDTATP----IDVSSYNEMWW  113

Query  108  TNGEFRTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKG-KCMLKW  164
             N E++  G+  +H GPCE WIDD  V    +C            +DYSACKG KC+  +
Sbjct  114  QNDEYK-EGFLGSHHGPCEGWIDDTKVFHYDDCVAKFPSYPAKIPVDYSACKGDKCLFVF  172

Query  165  YWLGIRPMGKKYSWQIYKACIPLADKNGGGnnktkvptptnkapakptkapapkkDDAEV  224
            YWL +        WQIYK C+P+++   GG  +      T+         P         
Sbjct  173  YWLAVH----SPEWQIYKQCVPISNGGSGGGGEVAGEASTSVQMTPEASTPDAATAAPLT  228

Query  225  GKDDDAKETPKPETSKPAAASPKPTEPATLKPSQKPPSCNRR  266
                    TP PE S PAA S   T PAT        SC RR
Sbjct  229  TDFTQVDATPAPE-STPAAVSTMGTTPAT-------GSCKRR  262

>PHYCA_103479
Length=314

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 95/206 (46%), Gaps = 39/206 (19%)

Query  11   TAIAALTAPSVLVEAHQRV------YFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNA  64
            +AI A+ + +  V AH  +      Y P  VYT  +  T     +      Y  +   NA
Sbjct  5    SAILAVASLTASVHAHGYISKPKATYQPNTVYTTYNALTTAAVNSAFAGGKYDGSPSQNA  64

Query  65   -----YLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP-------TNGEF  112
                 + +A GYK+LR+ +D             + G++   A P  +         N E+
Sbjct  65   QVFADHWNATGYKSLREMVDP---------IATDYGFSVKTATPVDVTGYTEMWWQNDEY  115

Query  113  RTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWLG  168
            +  G+  +HEGPCE WIDD  +    NC      K +  KI  DYS+CKG C+  +YWL 
Sbjct  116  K-EGFIASHEGPCEGWIDDTRIFHYDNCAAQF--KTYPAKIPADYSSCKGDCLFSFYWLA  172

Query  169  IRPMGKKYSWQIYKACIPLADKNGGG  194
            +     + +WQIYK C+P+ + NG G
Sbjct  173  LH----EPNWQIYKQCVPITN-NGSG  193

>PHALS_10635
Length=296

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 67/133 (50%), Gaps = 14/133 (11%)

Query  62   FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHE  120
            F    + N +K LR        ++ N     ECGYTDP  PP   P +G    S G  H 
Sbjct  60   FKELGTKNNFKDLRSL------FEGNPIYGEECGYTDPKGPPADRPNDGAATFSRGILHA  113

Query  121  GPCEIWIDDVMVKSGKNCHY---DISEKAFT--DKIDYSACKGK-CMLKWYWLGIRPMGK  174
            G CEIW DD MV    +C     D ++K  +    +DY  C  + CML++YWL ++ + K
Sbjct  114  GTCEIWFDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRIDK  173

Query  175  KYSWQIYKACIPL  187
               WQ+Y+ CIPL
Sbjct  174  TV-WQVYRNCIPL  185

>PYAP_22257
Length=247

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 22/140 (16%)

Query  64   AYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP-------TNGEFRTSG  116
            A+ S   +KTL+D ++K       KG+   CG +     PQ +         N E +T G
Sbjct  64   AFKSQKTFKTLKDMVEK-----QLKGS---CGKSSGKGKPQSVEGLSDVHWENTEEKT-G  114

Query  117  Y--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGK  174
            +  +H GPCEIWIDD  V    NC            ++YS CKG+CML++YWL +     
Sbjct  115  FVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLALH----  170

Query  175  KYSWQIYKACIPLADKNGGG  194
            +  WQ+YK C+P+ +K G G
Sbjct  171  EPEWQVYKNCVPIVNKGGKG  190

>PHYKE_6078
Length=317

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 85/206 (41%), Gaps = 23/206 (11%)

Query  7    VLGATAIAALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYK------  57
            V  AT+ +A+ A +VL   V  H  +  P V +  ++  T +    +  + G        
Sbjct  2    VASATSFSAMLATAVLAAGVNGHGYMSDPAVTFLTSNDPTQFIATIEASDSGLSGTFNGA  61

Query  58   ---TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----G  110
                T  F     ++ Y +L++F++          AT+ CG  DP+   Q +P       
Sbjct  62   PADNTAAFTTAFESSSYSSLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWA  120

Query  111  EFRTSGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168
               + G+T  HEGPCE+W DD  V    +C  D +        D+ AC G   +  YWL 
Sbjct  121  HSDSEGFTASHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLA  180

Query  169  IRPMGKKYSWQIYKACIPLADKNGGG  194
            +       +WQ+Y  C PL      G
Sbjct  181  LH----SSTWQVYVNCAPLETTTSTG  202

>PHYSO_374025
Length=300

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 64/131 (49%), Gaps = 7/131 (5%)

Query  66   LSANGYKTLRDFMDKPGAYKANK---GATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGP  122
             +A+ Y +L+D  DK    ++      AT ECG++  N   + +P   E++  GY+H+GP
Sbjct  72   FNASKYTSLKDLADKTMVLQSLSPFGKATAECGFSLANGTARDLPAQVEWKDFGYSHQGP  131

Query  123  CEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYK  182
            CE+W DD +     NC     E       D   C G  M++ YW+ +  +     WQ+Y 
Sbjct  132  CEVWCDDKLAFEDDNCALHYPEVPAKLPYDVDVCAGASMIQSYWIALHGL----PWQLYL  187

Query  183  ACIPLADKNGG  193
             C+PL  K  G
Sbjct  188  NCVPLTGKVNG  198

>SDRG_08137
Length=282

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 90/191 (47%), Gaps = 30/191 (16%)

Query  14   AALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQ------AKLENQGYKTTKDF-NAYL  66
            +AL     LV  H  V  P   ++L   +T +          K +    +    F +A+ 
Sbjct  71   SALGISLALVAGHGIVSNPAAEFSLNVMRTTYVATIQANLPGKFDGSPQENVAAFTSAFK  130

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR------TSGY--T  118
            + + +KTLRD ++  G           CG + PNA  + IP++G           G+  +
Sbjct  131  AQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWRNPDTGEGFISS  181

Query  119  HEGPCEIWIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGK-CMLKWYWLGIRPMGKKY  176
            H GPCE+W+DD  V    +C  +  +K A    +DYS+C G  CML++YWL +     + 
Sbjct  182  HTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALH----QP  237

Query  177  SWQIYKACIPL  187
             WQ+YK C+PL
Sbjct  238  QWQVYKNCVPL  248

>PYVX_16138
Length=559

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 92/206 (45%), Gaps = 35/206 (17%)

Query  10   ATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQA--KLENQGYK--TTKDFNAY  65
            A+A+ A+      V+ H  +  PE  ++     ++W  Q   + E+ G+   +    + Y
Sbjct  9    ASAVFAVALCVSRVQGHGYMLIPESQFS-GTATSSWIVQIDPQWESDGWNGNSQDSVDTY  67

Query  66   LSA---NGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEG  121
            +S     G   +R  +D    Y A      +CGYTDP+   Q IPT+     S G  H G
Sbjct  68   VSLAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVG  121

Query  122  PCEIWIDDVMVKSGKNCHY----DISEKAFTDKIDYSAC--KGKCMLKWYWLGIRPMGKK  175
            PCEIW+DD MV    +C+     D  +      +DYS+C   G  M+++YWL  + +  +
Sbjct  122  PCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDE  181

Query  176  YSWQIYKA--------------CIPL  187
              WQ+Y                CIPL
Sbjct  182  TVWQVYSVMSAQLTAMRDFTEDCIPL  207

>PHYCA_14560
Length=300

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 99/203 (49%), Gaps = 33/203 (16%)

Query  11   TAIAALTAPSVLVEAHQRV------YFPEVVYTLADRKTNWGPQAKLENQGY-----KTT  59
            ++I AL +  V V+ H  +      Y P  +YT  +  T+       +   Y     +  
Sbjct  5    SSILALASVGVCVQGHGYISQPKASYEPNTIYTTYNALTSASINKGFDGGHYNWSPTQNA  64

Query  60   KDFNAYLSANGYKTLRDFMD--KPGAYKANKGAT-VEC-GYTDPNAPPQPIPTNGEFRTS  115
            + F  + +A GYK+LR+ +D   P    + K AT V+  GYT      +    N E++  
Sbjct  65   QAFTDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDVSGYT------EMWWQNDEYK-E  117

Query  116  GY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWLGIRP  171
            G+  +HEGPCE WIDD  +    NC      K +  K+  DYS+CKG C+  +YWL +  
Sbjct  118  GFIASHEGPCEAWIDDTRIFHYDNCAAQF--KTYPAKVPADYSSCKGDCLFVFYWLALH-  174

Query  172  MGKKYSWQIYKACIPLADKNGGG  194
               +  WQIYK C+P+ + NG G
Sbjct  175  ---EPDWQIYKQCVPITN-NGKG  193

>PHYKE_6069
Length=298

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 65/137 (47%), Gaps = 7/137 (5%)

Query  56   YKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKG---ATVECGYTDPNAPPQPIPTNGEF  112
            Y  T+ +    + + Y +L+D + K    +  +    AT+ECG++  N   + +P   E+
Sbjct  65   YDNTEAYWTAFNESSYTSLKDLITKTAEVQTMETFGTATLECGFSLANGTARGLPEEVEW  124

Query  113  RTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPM  172
                 +HEGPCE+W DD +V    NC  D +        D S C G  ML  YWL +  +
Sbjct  125  SQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKLPYDSSKCSGTSMLTSYWLALHGL  184

Query  173  GKKYSWQIYKACIPLAD  189
                 WQ+Y  C PL D
Sbjct  185  ----PWQVYINCAPLTD  197

>PYIW_18065
Length=308

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 95/200 (48%), Gaps = 33/200 (17%)

Query  8    LGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLS  67
            L   A+AALT    LV+AH  +  P V +     KT++       + G     +F+    
Sbjct  4    LKRVALAALTT-GALVDAHGLLSTPVVEFKEGVMKTSFVGTMTAPSDG-----NFDGKFD  57

Query  68   ANGYKTLRDFMDKPGAYKANKGATVE---------CGYTDPNAPPQPIPTNGEF------  112
             N  + L  F+   G +KA  G  V+         CG +  N  P+PIP +G+       
Sbjct  58   GNPQENLGAFL--AGYHKAYPGKPVDVSALVGGDACGNSLDNVSPKPIPADGKIVWENPD  115

Query  113  RTSGY--THEGPCEIWIDDVMVKSGKNC--HYDISEKAFTDKIDYSACKG-KCMLKWYWL  167
               G+  +H GPCE+W+D V V    NC  H+    KA    ID+S+CK   C LK+YWL
Sbjct  116  THEGFVASHTGPCELWLDGVAVFRDDNCAGHFATGSKAKI-PIDFSSCKKPGCTLKFYWL  174

Query  168  GIRPMGKKYSWQIYKACIPL  187
             ++    +  WQIYK C+PL
Sbjct  175  TLQ----EPKWQIYKNCVPL  190

>PYIR_26867
Length=163

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 59/118 (50%), Gaps = 8/118 (7%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRT  114
            TK F A L A+ YK++R  +D  G + +  GA  +CG T P    QP+P          T
Sbjct  43   TKAFTAALKASTYKSVRALVDAKGQFIS--GANKQCGVTSPTGDKQPLPAQYVEWAHSST  100

Query  115  SGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIR  170
             G+T  H+GPCE+W DD M  S +NC  +          D S C G  MLK YWL + 
Sbjct  101  EGFTPSHQGPCEVWCDDKMAFSDENCATNYPTAPAKLPYDKSKCTGASMLKIYWLALH  158

>PHYRA_78167
Length=284

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 90/200 (45%), Gaps = 29/200 (15%)

Query  8    LGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY--  65
            + A+ +AA T      EAH  +  P   +++    TN+     ++ Q Y    D  +Y  
Sbjct  1    MAASVLAAQT------EAHSYMTDPMPTWSVGYPTTNYA--GLIDGQDYLPCPDGMSYGG  52

Query  66   ------------LSANGYKTLRDFMDKPGAYKANK---GATVECGYTDPNAPPQPIPTNG  110
                         +A+ Y +L++  DK    ++      AT ECG++ PN   + +P   
Sbjct  53   TPEGNTDAYWTAFNASKYTSLKNLADKTMVLQSLNPFGKATAECGFSLPNGTARNLPAEV  112

Query  111  EFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIR  170
            ++   G +H+GPCE+W DD +    +NC  +  E   +   D   C G  M++ YW+ + 
Sbjct  113  QWHDFGLSHQGPCEVWCDDKLAFMDQNCALNYPEVPASLPYDVDVCAGASMMQSYWIALH  172

Query  171  PMGKKYSWQIYKACIPLADK  190
             +     WQ+Y  C+PL  K
Sbjct  173  GL----PWQLYLNCVPLTGK  188

>PYU1_G001516
Length=304

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 79/180 (44%), Gaps = 24/180 (13%)

Query  26   HQRVYFPEVVYTLADRKTNW-----GPQAKLENQGYKTTKD-------FNAYLSANGYKT  73
            H  +  P+V ++++   T +     GP       G   T D       F   L+ + Y +
Sbjct  27   HGYMSVPKVTFSISGDTTQFCGTIDGPSTLTAPTGMSFTTDPASNTAAFTKALANSSYTS  86

Query  74   LRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRTSGYT--HEGPCEIWI  127
            +R+ ++  G +    GAT  CG T+    PQP+P          T G+T  H+GPCE+W 
Sbjct  87   VRELVEDKGVFIT--GATKTCGITEETEDPQPLPAKYVEWSHSSTEGFTASHQGPCEVWC  144

Query  128  DDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            DD +  S +NC  D +        D + C G  +LK  WL +       +WQIY  C  L
Sbjct  145  DDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSLLKIVWLALH----SSTWQIYINCATL  200

>PHYKE_5749
Length=300

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 85/182 (47%), Gaps = 21/182 (12%)

Query  94   CGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDI------  142
            CG T P+  PQPIP++G+ +       G+TH GPCEI++DD MV    +C  +       
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  143  SEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGGnnktkvpt  202
            S +     +DYS+C GKC+   YWL  +       WQ Y  C+PL    GGG + T   +
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQ----NAQWQTYINCVPLTGSGGGGGSSTTQTS  202

Query  203  ptnkapakptkapapkkD--DAEVGKDDDAKETPKPETSKPAAASPKPTEPATLKPSQKP  260
             +  +        +   D    E        ++P+P    PAA +P P  PAT  PS   
Sbjct  203  SSTSSSTGTQSTESSSADTPSTENKSPSTGNDSPEP----PAATTPTPDSPATQAPSADS  258

Query  261  PS  262
            P+
Sbjct  259  PA  260

>PPTG_04617
Length=496

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 88/199 (44%), Gaps = 43/199 (22%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRK----TNWGPQAKLENQGY  56
            M    ++  ATA A +   S  V+AH     PE V  +  +K    ++W  Q  +E Q  
Sbjct  1    MVSTMSLFAATATAVVCLFSTHVDAHGYTLIPEAVPLVEHKKDKKISSWIVQ--IEPQ--  56

Query  57   KTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-  115
                                F+D       +K    +C Y+DP A P+  P++G    S 
Sbjct  57   --------------------FID-------SKLYGADCEYSDPKADPKTSPSDGTATFSR  89

Query  116  GYTHEGPCEIWIDDVMVKSGKNCHYD------ISEKAFTDKIDYSACK-GKCMLKWYWLG  168
            G  H GPCEIW+DD MV    +C         +++K+    IDYS+C    CM ++YW+ 
Sbjct  90   GIAHHGPCEIWLDDKMVLHDDDCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIA  149

Query  169  IRPMGKKYSWQIYKACIPL  187
             +     Y  QIY+ C+PL
Sbjct  150  FQGSDNGYVRQIYRHCVPL  168

>PPTG_18166
Length=445

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 15/110 (14%)

Query  94   CGYTDPNAPPQPIPTNGEF-----RTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFT  148
            CG T  N  P+PIP++G+      R  G+TH GPCEI++DD MV  G +C  +    +  
Sbjct  84   CGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDG  143

Query  149  DK------IDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNG  192
                    +D+S+C GKC L  YWL  +       WQ Y  C+PL+  +G
Sbjct  144  SSSGSEMPVDFSSCNGKCTLTIYWLAFQ----NAQWQTYVNCVPLSGSSG  189

>PPTG_03160
Length=379

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/215 (32%), Positives = 99/215 (46%), Gaps = 36/215 (17%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTL-ADRKTNWGPQAKLENQGYKTT  59
            M   F  L A+A+A       +V  H  +  P+V +T  A   T +    +  + G+  T
Sbjct  1    MPAPFKCLLASALAV-----SVVNGHGYMTDPKVKFTAQAGDPTQFIGSIQASDSGFSGT  55

Query  60   -----KD----FNAYLSANGYKTLRDFM-DKPGAYKANKGATVECGYTDPNAPPQPIPTN  109
                 KD    F    +++ YK+L++++ DK  A     GAT+ CG  DP   PQP+P +
Sbjct  56   FNGAPKDNVAAFTKAFTSSKYKSLKEYVTDK--AKIIVSGATLTCGSCDPKQEPQPMPKS  113

Query  110  ----GEFRTSGYT--HEGPCEIWIDDVMVKSGKNC--HYDI--SEKAFTDKIDYSACKGK  159
                    + G+T  HEGPCE+W DDV      +C  HY +  +E  F    D  AC G 
Sbjct  114  TVEWSHSDSEGFTPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPF----DRDACMGA  169

Query  160  CMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGG  194
              L +YW+ +       SWQ+Y  C PLA     G
Sbjct  170  STLTFYWMAMH----SSSWQVYVNCAPLAKTTSTG  200

>PHYSO_318683
Length=352

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 92/199 (46%), Gaps = 30/199 (15%)

Query  15   ALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGY-----------KTTK  60
            A+TA ++L   V AH  +  P V +     KT +   A +E+              + T 
Sbjct  5    AMTAAALLLSNVNAHGYLGLPAVTFPNDVDKTQF--IATIESSASGFSGSFSGSPAENTA  62

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR---TSGY  117
             F    +++ Y ++++F+   G   AN GA +ECG TDP+  PQP+P   E+    T G+
Sbjct  63   AFWTAFNSSQYSSIKEFVTDLGQIVAN-GANIECGLTDPDETPQPLPDELEWTHSDTEGF  121

Query  118  T--HEGPCEIWIDDVMVKSGKNC--HYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            T  HEGPCE W D+  V    +C  HY  +        D + C G   L +YWL +    
Sbjct  122  TSSHEGPCEAWCDNTRVFQDTDCAAHYTTAPAKM--PYDKAGCSGASRLTFYWLALH---  176

Query  174  KKYSWQIYKACIPLADKNG  192
               +WQ+Y  C  L   +G
Sbjct  177  -SSTWQVYVDCAALEGGSG  194

>SDRG_07565
Length=278

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 87/191 (46%), Gaps = 30/191 (16%)

Query  14   AALTAPSVLVEAHQRV------YFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFN-AYL  66
            +AL    VLV  H  V      + P V+ T            K +    +    F  A+ 
Sbjct  69   SALLTSLVLVAGHGIVSNPAAEFSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTTAFK  128

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR------TSGY--T  118
            + + +KTLRD ++  G           CG + PNA  + IP++G           G+  +
Sbjct  129  AQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWLNPDTGEGFISS  179

Query  119  HEGPCEIWIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGK-CMLKWYWLGIRPMGKKY  176
            H GPCE+W+DD  V    +C     +K A    +DYS+C G  CML++YWL +     + 
Sbjct  180  HTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLALH----QP  235

Query  177  SWQIYKACIPL  187
             WQ+YK C+PL
Sbjct  236  QWQVYKNCVPL  246

>PYAP_18226
Length=226

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 73/156 (47%), Gaps = 36/156 (23%)

Query  44   NWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDK--PGAYKANKGATVECGYTDPNA  101
            NW P+          T+ F      +G K+LR  MDK  PG           CG T+PN 
Sbjct  63   NWSPE--------HNTQVFTDAFKQSGLKSLRQLMDKYVPG-----------CGNTNPNT  103

Query  102  PPQPIP-------TNGEFRTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKID  152
             P+ +         N E++  G+  +H GPCE+WID+  V    +C  +      +  +D
Sbjct  104  TPRDVTKLKTMNWQNNEYK-EGFLASHRGPCEVWIDNTRVFQNNDCAGNYKSYPASLPVD  162

Query  153  YSACK-GKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
            YS CK  KCML++YWL +        WQ YK C+P+
Sbjct  163  YSKCKSSKCMLRFYWLALHSE----KWQAYKQCVPI  194

>PYAR_15391
Length=176

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 82/192 (43%), Gaps = 23/192 (12%)

Query  3    RLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDF  62
            ++  VL   A AAL+APS LV+AH  +  P+      D         +   +   TT   
Sbjct  2    KISTVLACVATAALSAPS-LVDAHGYMMLPKAQLASGD-------PTRYATEIRGTT--V  51

Query  63   NAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGP  122
                +   + +LRD ++K         +T  CG T P   PQP+P + E+     +H GP
Sbjct  52   MPVPAGGSFTSLRDLIEK------KSPSTPACGITPPGGAPQPVPDHVEWSAFADSHVGP  105

Query  123  CEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYK  182
            CE+W D   V    NC      +     I+ + C     LK+YWL +        WQIY 
Sbjct  106  CEVWCDQKRVFQEDNCAGKYPARPAKLPINAADCANAKELKFYWLALH----SQDWQIYI  161

Query  183  ACIPLADKNGGG  194
             C PL    GGG
Sbjct  162  NCAPL---KGGG  170

>PYAP_14265
Length=298

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 100/214 (47%), Gaps = 34/214 (16%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWG-----------PQA  49
            M      L A AIAA+ A +  V+AH  +  P + +T +    N+            P  
Sbjct  1    MVSTSVALSALAIAAV-ATTGSVDAHGTLAKPGLKFTGSGYGGNFHALVPMNVLKPQPGD  59

Query  50   KLENQGY--KTTKDFNAYLSANGYKTLRDFMDKP---GAYKANKGATVECGYTDPNA-PP  103
            K  N  +  K  + F     A+ YKTL+DF+ K       ++N   T ECG+TDPN+ P 
Sbjct  60   KFTNHPHADKNAEVFARAFKASQYKTLKDFLLKNMDMSKGRSNMPKTRECGFTDPNSGPV  119

Query  104  QPIPTNGEFRTSGYTHEGPCEIWIDD-VMVKSGKNCHYDISEKAFTDKIDY--SACKGKC  160
            QP+P   E+      H+GPCE+W D+ V++    NC    ++   T K +Y  +AC+GK 
Sbjct  120  QPLPNQLEWYGGQMNHDGPCEVWCDNTVVIPFTANC----AKTYPTGKFNYNKAACQGKK  175

Query  161  MLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGG  194
             L  YW     M     WQ+Y  C     K GGG
Sbjct  176  RLTMYW-----MSTLMEWQVYIDCA----KIGGG  200

>PHYRA_78172
Length=385

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 10/134 (7%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR---TS  115
            T+ F    +++ Y ++++F+   G   A+ GA +ECG TDPN  PQPIP   E+    T 
Sbjct  67   TEAFWTAFNSSKYSSIKEFVTDLGQIVAD-GANIECGLTDPNETPQPIPDELEWTHSDTE  125

Query  116  GYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
            G+T  HEGPCE W D   V    +C    +        D + C G   L +YWL +    
Sbjct  126  GFTSSHEGPCEAWCDGTQVFHDTDCAAHFTTAPAKMPYDQAGCSGASRLTFYWLALH---  182

Query  174  KKYSWQIYKACIPL  187
               +WQ+Y  C  L
Sbjct  183  -SSTWQVYVNCAAL  195

>PPTG_01153
Length=317

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 96/199 (48%), Gaps = 30/199 (15%)

Query  12   AIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGP-QAKLENQGY----------KTTK  60
            A A+LTA    V+AH  +  P+  Y      T++        N+G+          + T+
Sbjct  9    AFASLTA---CVQAHGYISKPKATYQPNTPYTDYNAITTAAVNKGFAGGKYNGSPSQNTQ  65

Query  61   DFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGY-TDPNAPPQPIPTNGEFRTSGY--  117
             F  + +A GYK+LRD  D       + G +VE     D     +    N E++  G+  
Sbjct  66   VFTEHWNATGYKSLRDMTDP---IATDYGHSVETATPVDVTGYTEMWWQNNEYK-EGFIA  121

Query  118  THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKI--DYSACKGKCMLKWYWLGIRPMGKK  175
            +HEGPCE WI +  V    NC      K++  KI  DYS+CKG C+  +YWL +     +
Sbjct  122  SHEGPCEAWIGETQVFHYDNCAARF--KSYPAKIPADYSSCKGDCLFAFYWLALH----E  175

Query  176  YSWQIYKACIPLADKNGGG  194
             +WQIYK C+P+ + NG G
Sbjct  176  PNWQIYKQCVPITN-NGSG  193

>PHYKE_1913
Length=280

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 67/134 (50%), Gaps = 29/134 (22%)

Query  79   DKPGAYK---ANKGATVE-----------CGYTDPNAPPQPIPTNGEF-----RTSGYTH  119
            D+ G YK   A KG +V+           CGYT  +A P+P+P++G+         G+TH
Sbjct  57   DQVGKYKTMAAEKGMSVKDVVLDMVKDKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTH  116

Query  120  EGPCEIWIDDVMVKSGKNCHY------DISEKAFTDKIDYSACKGKCMLKWYWLGIRPMG  173
             GPCE++I+D MV  G +C        D S K     IDYS+C G C L  YWL  +   
Sbjct  117  TGPCEVYINDKMVLHGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQ---  173

Query  174  KKYSWQIYKACIPL  187
                WQ Y  C+PL
Sbjct  174  -NAQWQAYINCVPL  186

>PHYCA_12944
Length=171

 Score = 78.6 bits (192),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 56/100 (56%), Gaps = 15/100 (15%)

Query  93   ECGYTDPNAPPQPIPTNGEFR-----TSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAF  147
            +CGYT  +APPQPIP++G  +       G+TH GPCEI IDD M   G++      + + 
Sbjct  82   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHSGPCEICIDDKM-GDGQD-----PDDSL  135

Query  148  TDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187
              KIDYS+C G CML  YWLG +       WQ Y   + +
Sbjct  136  NMKIDYSSCNGNCMLTIYWLGFQ----NAQWQAYVVSVGM  171

>PHYKE_6079
Length=302

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/208 (28%), Positives = 88/208 (42%), Gaps = 26/208 (13%)

Query  7    VLGATAIAALTAPSVLVEA---HQRVYFPEVVYTLADRKTNWGPQAKLENQ--GYK----  57
            V   T+ +A+ A + LV     H  +  P V + L+    N    A +E+   G+     
Sbjct  2    VASTTSFSAMLAMATLVAGVYGHGYMTEPAVTF-LSSSTDNTQFIATIESSASGFSGTFS  60

Query  58   -----TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN---  109
                  T  F     ++ Y +L++ ++          AT+ CG  DP+   QP+P     
Sbjct  61   GSPADNTAAFTTAFDSSKYTSLKELINDLATITVTD-ATLTCGSCDPDETAQPLPETYVE  119

Query  110  -GEFRTSGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYW  166
                 + G+T  HEGPCE+W DDV V   K+C  D +        D+ AC G   L +YW
Sbjct  120  WSHSSSEGFTSSHEGPCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYW  179

Query  167  LGIRPMGKKYSWQIYKACIPLADKNGGG  194
            L +       +WQ+Y  C PL      G
Sbjct  180  LALH----SSTWQVYVNCAPLETTTSTG  203

>PYAP_19712
Length=276

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 78/181 (43%), Gaps = 30/181 (17%)

Query  7    VLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYL  66
            ++ + A  A   PS  V AH  +  P+V  T  D      P A +       T       
Sbjct  7    LIASAAALAFVLPS-QVSAHGSIAVPKV--TFLDPPNRHAPSASMSGPAGPYT-------  56

Query  67   SANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEI  125
               G   +++  D  G+         +CG TDPN   QPIP +G  +      H GPCE+
Sbjct  57   ---GNAVVKELADSHGS---------KCGKTDPNGAVQPIPADGYVQLQITAAHIGPCEL  104

Query  126  WIDDVMVKSGKNCHYDISEKAFTDKIDYSACK-GKCMLKWYWLGIRPMGKKYSWQIYKAC  184
            W+D  MV S K C  +  ++    K+D+S CK  KC L+W WL          W+IY  C
Sbjct  105  WLDGEMVASAKQCVKEYPDRKI--KVDFSKCKSSKCQLRWVWLATH----NSPWEIYDNC  158

Query  185  I  185
            +
Sbjct  159  V  159

>PHYRA_78177
Length=324

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 87/208 (42%), Gaps = 26/208 (13%)

Query  7    VLGATAIAALTAPSVL---VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQ--GYK----  57
            V   T+++A+ A +VL   V  H  +  P V + L+    N    A +E+   G+     
Sbjct  2    VASTTSLSAMLAMTVLAAGVNGHGYMTEPAVTF-LSSSTDNTQFIATIESSASGFSGTFS  60

Query  58   -----TTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN---  109
                  T  F    +++ Y +L+D +           AT+ CG  DP+   Q +P     
Sbjct  61   GSPADNTAAFTTAFASSSYTSLKDLITGLATVTVTD-ATLTCGSCDPDETAQALPAEYVE  119

Query  110  -GEFRTSGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYW  166
                 T G+T  HEGPCE+W DDV V    +C  D +        D  AC G   L +YW
Sbjct  120  WSHSSTEGFTSSHEGPCEVWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYW  179

Query  167  LGIRPMGKKYSWQIYKACIPLADKNGGG  194
            L +       +WQ+Y  C PL      G
Sbjct  180  LALH----SSTWQVYVNCAPLETTTSTG  203

>PYVX_22508
Length=298

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 61/142 (43%), Gaps = 10/142 (7%)

Query  59   TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTN----GEFRT  114
            T  F     A+ Y +L++ +   G   +  G T+ CG TDP+   Q +P          T
Sbjct  51   TASFTTAFEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSST  110

Query  115  SGYT--HEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPM  172
             G+T  HEGPCEIW DD  V    +C    +        D  AC G   L +YWL +   
Sbjct  111  EGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALHSS  170

Query  173  GKKYSWQIYKACIPLADKNGGG  194
                +WQ+Y  C  L +    G
Sbjct  171  ----TWQVYINCAALEETTSTG  188

>PHYRA_78174
Length=279

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 86/213 (40%), Gaps = 31/213 (15%)

Query  1    MTRLFAVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKT--  58
            M  L A   A  +  L A   LV  H  +  P+  YT     T +   A +E        
Sbjct  1    MVALKASFTAVVVTTLAA---LVHGHGYMSVPKCEYTFEGDTTQF--MATIEASASGFSG  55

Query  59   ---------TKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT-  108
                     T  F     A+ Y +L++ +   G    +   T+ECGYT+P+   QP+P  
Sbjct  56   SFSGSPADNTAAFAKGFEASKYTSLKEMVSDLGKVT-SADFTMECGYTNPDETAQPLPKT  114

Query  109  -------NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCM  161
                   +GE  TS  +HEGPCE+W DDV V    +C    S        D+ AC G   
Sbjct  115  YVEWAHGSGEGFTS--SHEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASR  172

Query  162  LKWYWLGIRPMGKKYSWQIYKACIPLADKNGGG  194
            L +YWL +       +WQ+Y  C  L      G
Sbjct  173  LTFYWLALHSS----TWQVYTNCAALEKTTSTG  201

>PHYSO_324715
Length=274

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 58/107 (54%), Gaps = 11/107 (10%)

Query  92   VECGYTDPNAPPQPIPTNGEFRTS-GYTHEGPCEIWIDDVMVKSGKNCH--YDISE----  144
             +CGY+DPNA P+   T+G    S G  H GPCEIW+DD M+    +C   +  S+    
Sbjct  85   ADCGYSDPNASPKDPSTDGTATFSRGIAHHGPCEIWLDDKMILHDDDCEETFGTSDYEKI  144

Query  145  KAFTDKIDYSACKGK-CMLKWYWLGI--RPMGK-KYSWQIYKACIPL  187
            K     IDYS+C    CML +YWL    R  G  KY WQIYK  + L
Sbjct  145  KTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNSKYVWQIYKCYVAL  191

>SDRG_08129
Length=218

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 85/184 (46%), Gaps = 24/184 (13%)

Query  15   ALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDF-NAYLSANGYKT  73
            AL A   +V      + P V+ T            K +    +    F +A+   + +KT
Sbjct  14   ALVAGHGIVSNPAAEFSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTSAFKVQSQFKT  73

Query  74   LRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFR------TSGY--THEGPCEI  125
            LRD ++  G           CG + PNA  + IP++G           G+  +H GPCE+
Sbjct  74   LRDMLEPQGP---------ACGNSLPNASKKTIPSDGAMTWRNPDTGEGFISSHTGPCEV  124

Query  126  WIDDVMVKSGKNCHYDISEK-AFTDKIDYSACKGK-CMLKWYWLGIRPMGKKYSWQIYKA  183
            W+DD  V    +C  +  +K A    +DYS+C G  CML++YWL +     +  WQ+YK 
Sbjct  125  WLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALH----QPQWQVYKN  180

Query  184  CIPL  187
            C+PL
Sbjct  181  CVPL  184

>PYAR_24113
Length=192

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 83/181 (46%), Gaps = 19/181 (10%)

Query  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKT--------TKDFNAYLSANGYKTLR  75
            +AH ++  P   YT     +  G    L+    KT           FNA    + YK+L+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  76   DFMDKPGAYKANKGATVECGY-TDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKS  134
            + + +    K + GAT ECG+ T   A PQP+P   E+     +H GPCE+W D+ +   
Sbjct  80   ELVLQ--NQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCEVWCDNNLAFQ  137

Query  135  GKNCHYDISEKAFTDKIDY--SACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNG  192
              NC  +I  K    K++Y   AC G  +L  YW+ +        WQ+Y  C PL+   G
Sbjct  138  DDNCSKNI--KGNPAKLNYKKDACVGAKVLTSYWIALHTA----EWQVYTGCAPLSGGGG  191

Query  193  G  193
            G
Sbjct  192  G  192

>PYU1_G001528
Length=274

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 85/200 (43%), Gaps = 27/200 (14%)

Query  6    AVL-GATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNW----GPQAKLENQGYKTTK  60
            AVL GA AI  L       +AH  +  P+  +T+    T +       A     G   T 
Sbjct  10   AVLAGALAIFTLNG----ADAHGSMSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTT  65

Query  61   D-------FNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIP------  107
            D       F A L  + YK++RD  +  G      GAT +CGYT      QP+P      
Sbjct  66   DPLSNTNAFTAALKTSSYKSVRDLWNAKGVLGVT-GATKQCGYTSATGAAQPLPAKYVEW  124

Query  108  TNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWL  167
            ++G       +H+GPCE+W D+V+  +  NC  +          D++ C GK ML  YWL
Sbjct  125  SHGSGEGFTPSHQGPCEVWCDNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWL  184

Query  168  GIRPMGKKYSWQIYKACIPL  187
             +        WQ Y  C PL
Sbjct  185  ALH----SPQWQAYINCAPL  200

>PHYRA_77291
Length=252

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 94/219 (43%), Gaps = 52/219 (24%)

Query  3    RLFAVLGATAIAALTAPSVLVEAHQRV------YFPEVVYTLADRKTNWGPQAKLENQGY  56
            + FA   A  +AA  +    V AH  +      Y P  +YT  +  T  GP     N+G+
Sbjct  2    KTFASSSAITLAAFVS---CVHAHGYISQPKASYAPNTIYTTYNALT--GPSV---NKGF  53

Query  57   ----------KTTKDFNAYLSANGYKTLRDFMD--KPGAYKANKGATVECGYTDPNAPPQ  104
                         K F  +  A GYK+LRD +D   PG            G++   A P 
Sbjct  54   DGGIYNHEPENNAKQFTKHWPATGYKSLRDMVDPISPGY-----------GHSLETADPI  102

Query  105  PIPT-------NGEFRTSGY--THEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSA  155
             + +       N E++  G+  +H GPCE WIDD MV    +C             DYSA
Sbjct  103  DVSSMSDMWWQNDEYK-EGFLGSHHGPCEGWIDDTMVFHYDDCVAKFPSYPAKIPTDYSA  161

Query  156  CKG-KCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGG  193
            CKG KC+  +YWL +        WQIYK C+P+++   G
Sbjct  162  CKGDKCLFVFYWLAVH----SPEWQIYKQCVPISNGGSG  196

>PYIR_14463
Length=369

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 99/207 (48%), Gaps = 46/207 (22%)

Query  2    TRLF---AVLGATAIAA--LTAPSVLVEAHQRVYFPEVVYTLADRKTNWGP---------  47
            TRLF    VL A A ++  L   S  V+AH  V  P     LA+ K    P         
Sbjct  8    TRLFNGPLVLAAAASSSMFLLFGSATVDAHGYVSSP-----LAEFKDGVMPTKYTATMTP  62

Query  48   --QAKLENQGYKTTKDFN-AYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQ  104
              Q K ++        F  A+ + + +KTLRD +   GA         +CG + P+A  +
Sbjct  63   AFQGKFDDNPQANVDTFTKAFNAQSEFKTLRDLLKDHGA---------DCGDSKPDASRK  113

Query  105  PIPTNGEF------RTSGY--THEGPCEIWIDDVMVKSGKNC--HYDISEKAFTDKIDYS  154
             IP +G+          G+  +H GPCE+W+DD  V S +NC  H+    KA    +D+S
Sbjct  114  AIPGDGKVVWQNPDSGEGFVPSHTGPCEVWLDDKRVFSDENCAGHFTSKPKA-ELPVDFS  172

Query  155  ACKGKCMLKWYWLGIRPMGKKYSWQIY  181
            +CKG CML++YWL +     + +WQ+Y
Sbjct  173  SCKGDCMLRFYWLALH----EPTWQVY  195

Lambda      K        H        a         alpha
   0.314    0.132    0.419    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 15268060038

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40