Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_177631475879479436350.0
PYAR_135711475866666720240.0
PYU1_G0017331475873259117640.0
PYIR_134181475874759017410.0
PYIW_199691475873359916540.0
PHYCA_5114151475874461214770.0
PPTG_171291475874556314720.0
PHYKE_839514758142053414480.0
PHYSO_3489031475876656414440.0
PITG_184581475874754414350.0
PHYRA_810981475874154514340.0
HYAP_071041475872153513623e-177
PHALS_064761475872651513163e-170
PYVX_235901475868959611602e-147
CCI44111147585765329262e-114
CCA22843147585865339046e-111
SPRG_06355147587135696234e-69
SDRG_01763147587364135252e-55
H310_082921382110074012017e-15
H257_117731382110264041982e-14
SPRG_126211382110033661921e-13
SDRG_045751382110033891793e-12
PYAP_222301382111164621784e-12
PYVX_215131382114461671784e-12
SDRG_079831335559914041785e-12
PHYSO_4705331382110844531768e-12
H257_0193413355510221941722e-11
SPRG_1903013355510004041623e-10
PYIW_157171382111211661562e-09
PITG_172501382110464471552e-09
PYIR_141071382111764461552e-09
PPTG_113651382111064551491e-08
PYU1_G002110138219994211302e-06
PYAR_14788138217953721222e-05
PYIR_233601252822729791.2
SDRG_083341252820731762.8
PHYRA_828581252822429753.5
PYIR_1812212831303105755.2
PYVX_217761252820352736.5
PHYKE_5458840743881747.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_17763

Length=794
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAP_17763                                                            1404       0.0   
PYAR_13571                                                            784        0.0   
PYU1_G001733                                                          684        0.0   
PYIR_13418                                                            675        0.0   
PYIW_19969                                                            641        0.0   
PHYCA_511415                                                          573        0.0   
PPTG_17129                                                            571        0.0   
PHYKE_8395                                                            562        0.0   
PHYSO_348903                                                          560        0.0   
PITG_18458                                                            557        0.0   
PHYRA_81098                                                           556        0.0   
HYAP_07104                                                            529        3e-177
PHALS_06476                                                           511        3e-170
PYVX_23590                                                            451        2e-147
CCI44111                                                              361        2e-114
CCA22843                                                              352        6e-111
SPRG_06355                                                            244        4e-69 
SDRG_01763                                                            206        2e-55 
H310_08292                                                            82.0       7e-15 
H257_11773                                                            80.9       2e-14 
SPRG_12621                                                            78.6       1e-13 
SDRG_04575                                                            73.6       3e-12 
PYAP_22230                                                            73.2       4e-12 
PYVX_21513                                                            73.2       4e-12 
SDRG_07983                                                            73.2       5e-12 
PHYSO_470533                                                          72.4       8e-12 
H257_01934                                                            70.9       2e-11 
SPRG_19030                                                            67.0       3e-10 
PYIW_15717                                                            64.7       2e-09 
PITG_17250                                                            64.3       2e-09 
PYIR_14107                                                            64.3       2e-09 
PPTG_11365                                                            62.0       1e-08 
PYU1_G002110                                                          54.7       2e-06 
PYAR_14788                                                            51.6       2e-05 
PYIR_23360                                                            35.0       1.2   
SDRG_08334                                                            33.9       2.8   
PHYRA_82858                                                           33.5       3.5   
PYIR_18122                                                            33.5       5.2   
PYVX_21776                                                            32.7       6.5   
PHYKE_5458                                                            33.1       7.8   

>PYAP_17763
Length=794

 Score = 1404 bits (3635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/794 (100%), Positives = 794/794 (100%), Gaps = 0/794 (0%)

Query  1    MFKFKRKDKEARASHKLLRASAKGkepapepkpaRYRTLEEAQQQRLARFDSTSTTMLAE  60
            MFKFKRKDKEARASHKLLRASAKGKEPAPEPKPARYRTLEEAQQQRLARFDSTSTTMLAE
Sbjct  1    MFKFKRKDKEARASHKLLRASAKGKEPAPEPKPARYRTLEEAQQQRLARFDSTSTTMLAE  60

Query  61   DVEDAYAVARGGTEVYVGGGLMSSRSNmdstrsydssmsyddnssncsgysgysstssrs  120
            DVEDAYAVARGGTEVYVGGGLMSSRSNMDSTRSYDSSMSYDDNSSNCSGYSGYSSTSSRS
Sbjct  61   DVEDAYAVARGGTEVYVGGGLMSSRSNMDSTRSYDSSMSYDDNSSNCSGYSGYSSTSSRS  120

Query  121  MVDGLRSATNSGLRGTDLRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDA  180
            MVDGLRSATNSGLRGTDLRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDA
Sbjct  121  MVDGLRSATNSGLRGTDLRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDA  180

Query  181  DLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDT  240
            DLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDT
Sbjct  181  DLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDT  240

Query  241  ATAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTREDQIPPVLRSTSSRL  300
            ATAAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSSRL
Sbjct  241  ATAAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSSRL  300

Query  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360
            TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF
Sbjct  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360

Query  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420
            NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL
Sbjct  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420

Query  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480
            TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG
Sbjct  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480

Query  481  VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLI  540
            VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLI
Sbjct  481  VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLI  540

Query  541  NDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQS  600
            NDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQS
Sbjct  541  NDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQS  600

Query  601  LYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRM  660
            LYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRM
Sbjct  601  LYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRM  660

Query  661  LRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMP  720
            LRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMP
Sbjct  661  LRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMP  720

Query  721  gtsssgtserstmsrsgasistsstsssdrssggsNNHstpstrtssssYPAKLHEPNLN  780
            GTSSSGTSERSTMSRSGASISTSSTSSSDRSSGGSNNHSTPSTRTSSSSYPAKLHEPNLN
Sbjct  721  GTSSSGTSERSTMSRSGASISTSSTSSSDRSSGGSNNHSTPSTRTSSSSYPAKLHEPNLN  780

Query  781  PSKPVGILKNTPRA  794
            PSKPVGILKNTPRA
Sbjct  781  PSKPVGILKNTPRA  794

>PYAR_13571
Length=666

 Score = 784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/667 (64%), Positives = 496/667 (74%), Gaps = 69/667 (10%)

Query  127  SATNSGLRGT-DLRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDADLLRA  185
            + T S  R T +LRATGLETLNE+EEE VDRSTARY+G              GD   +  
Sbjct  62   ATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIG------------EQGDFTPMPT  109

Query  186  ELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAA  245
                    M AI+REMMNEMH +RYDVLKEVTMLKGTI QL+                  
Sbjct  110  TAAPAYTPMPAIRREMMNEMHTSRYDVLKEVTMLKGTITQLI------------------  151

Query  246  MGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTREDQIPPVLRSTSSRLTQLAP  305
                             E ++R+TTTV SK TKERITTTR+D +PP+LR+TS RLTQLAP
Sbjct  152  -----------------ETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAP  194

Query  306  VDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGAD  365
            VDDSALSTPL QEQID++FPL+DFSAEVQ+Q+RIR+ G+REW FDRVQEWLDSRFNVG+D
Sbjct  195  VDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSD  254

Query  366  VVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLP  425
            V+LAMVGDAG+GKT                 HFCKF+RK KSSPRNVLLS+VNQLT++LP
Sbjct  255  VLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLP  297

Query  426  MFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYND  485
             FKSQLARLNLKYVLEETDV AL+RKVL+DPL +LEEPLT KFV+ D +DQC    GYND
Sbjct  298  TFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYND  357

Query  486  LQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAA  545
            L DFLS ++PECP WLGFL+++KPSPEFA  VPV+S+LDFSA+NA Y+NDT  L+ DI A
Sbjct  358  LLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVA  417

Query  546  VFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIY  605
            +F   DQA+A QILKTKS GNYSYLEFT+QA+SNPGME   G VPVDVLHDLPQSLYEIY
Sbjct  418  IFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIY  477

Query  606  EEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAF  665
            EEIFEDKFGKGRTR+WRKALPVLQLIFTAASGPYAQITEQ++MDSLSY KD+VRMLRRAF
Sbjct  478  EEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAF  537

Query  666  IDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMPgtsss  725
            IDIISIRHGTY IVSSA++DWLTD QRKGE Y +DV L+VKVLR+VLRGEKL +PGT+  
Sbjct  538  IDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHG  597

Query  726  gtserstmsrsgasistsstsssdrssggsNNHstpstrtssssYPAKLHEPNLNP-SKP  784
              +     + S +  S  S+SS+  S   S    T  T  ++   P K HEPN+ P  KP
Sbjct  598  TPASERATTTSRSPASPESSSSTASSDRSSGGGKTRVTSMTT---PPKRHEPNMAPREKP  654

Query  785  VGILKNT  791
            VGILK T
Sbjct  655  VGILKRT  661

>PYU1_G001733
Length=732

 Score = 684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/591 (57%), Positives = 433/591 (73%), Gaps = 27/591 (5%)

Query  130  NSGLRGTD-------LRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDADL  182
            ++ LR TD       LR T L  LNE E           V P    TT  A     +AD 
Sbjct  107  STSLRVTDVYRTTEQLRNTNLMPLNEDE-----------VLPAAMRTTTGAA-GGSEADA  154

Query  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242
            LRAEL EMKQEMQ I+REMMNEMH+TRYDVLKE+TMLKGTI+QLV+ ++  G    D   
Sbjct  155  LRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGG  214

Query  243  AAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTREDQIPPVLRSTSSRLTQ  302
             A       PQ  ELSP + + ++R T    SK TK+R+       IP ++R T+SRLTQ
Sbjct  215  VAE------PQP-ELSPAQLDTITRTTAVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQ  267

Query  303  LAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNV  362
            LAPV D ALSTPL Q QIDDMFPL+DFSA++Q+ ++  +  SREW F+R Q+W+DSRFNV
Sbjct  268  LAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNV  327

Query  363  GADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTS  422
            G D +LA+VGD GSGK+    ++CD++ D +VA H CKFDRK+KSSPRNVLLSLVNQL +
Sbjct  328  GGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIA  387

Query  423  SLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVG  482
            +LP+FK+QLARLNLKYVLEETD   L+RKVL+DPL ALEEPLT K ++ D IDQC++   
Sbjct  388  NLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSK-D  446

Query  483  YNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLIND  542
             NDL DFL+AIIPE P WLG  ++SKPSPE    + ++S+LDFS +NANYMNDT+ LIND
Sbjct  447  RNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILIND  506

Query  543  IAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLY  602
            I   F D D +EA+ ILK KSGGN+++L+FTKQALS+PGMEE +G+VP+DVLHDLP+S+Y
Sbjct  507  IIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIY  566

Query  603  EIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLR  662
            EIY+EIFEDKFGKG  R+W+K  P+L LI TAASGPYA ITE+   +  S ++D++RM+R
Sbjct  567  EIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIR  626

Query  663  RAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  713
            RAF DII +RHGTY + +SA+Y+WL D QR GEQ++++++  + +LR++ R
Sbjct  627  RAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677

>PYIR_13418
Length=747

 Score = 675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/590 (58%), Positives = 437/590 (74%), Gaps = 20/590 (3%)

Query  128  ATNSGLRGTDLRAT-----GLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDA-D  181
            AT   LR TD+  T     G   +   E+EV+  ++          TT A     G+  D
Sbjct  118  ATGGSLRVTDMYRTTEQMRGTNLMPLQEDEVLPAASR-------ATTTMATASNGGNPID  170

Query  182  LLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTA  241
             LRAEL EMK E+QAI+REMMNEMH+TRYDVLKE+TMLKGTI+QLV+ ++  G    D A
Sbjct  171  ALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLD-A  229

Query  242  TAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTREDQIPPVLRSTSSRLT  301
            + AA+G +  P   ELS +E + +SR T    SK TKER   TRED  P ++R+ SSRLT
Sbjct  230  SGAAVGAEAQP---ELSSDELDTISRTTALYTSKATKER-RATREDSAPVLVRA-SSRLT  284

Query  302  QLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFN  361
            QLAPV D ALSTPL Q QID+MFPL++ S E+Q  ++  +  SREW  +R QEW+DSRFN
Sbjct  285  QLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFN  344

Query  362  VGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLT  421
            VG D +LA+VGD GSGK+    ++CDK+ D VVA H C FDRK+KSSPRNVLLSLVNQL 
Sbjct  345  VGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLI  404

Query  422  SSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV  481
            S+LP+FK+QLARLNLKYVLEETD   L+RKVL+DPL ALEEPLT K  VFD IDQC++  
Sbjct  405  SNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSK-  463

Query  482  GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLIN  541
            G NDL DFL+ IIPE P W+G  ++SKPSPE    + ++S+LDFSA+N NYMNDT+ LIN
Sbjct  464  GRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILIN  523

Query  542  DIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSL  601
            DI   F D D  +A++ILK KSGGN+++L+FTKQALS+PGMEE +G++P+DVLHDLP+S+
Sbjct  524  DIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESI  583

Query  602  YEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRML  661
            YEIYEEIFEDKFGKGR+R+W+K  P+L+LI TAASGPYA ITE    +  S +K+++R +
Sbjct  584  YEIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTI  643

Query  662  RRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711
            RRAF+DII++ HGTY I +SA+++WL D QR GEQ+++DV+  + +LR++
Sbjct  644  RRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693

>PYIW_19969
Length=733

 Score = 641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/599 (54%), Positives = 420/599 (70%), Gaps = 33/599 (6%)

Query  122  VDGLRSATNSGLRGTDLRAT-----GLETLNEMEEEVVDRSTARYVGPGVTPT----TPA  172
             D    AT   LR TD+  T     G   L  ++E+ V  + +R       PT    +  
Sbjct  105  TDTYSRATGGSLRVTDVYRTTEQLRGTANLIPLQEDEVLPAASRTTTTSQMPTNGNYSNG  164

Query  173  AVIRAGDADLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQ  232
                    D LR EL EMK E+QAI+REMMNEMH+TRYDVLKEVTMLKGTI+QLV+ ++ 
Sbjct  165  NSGGGSQLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALET  224

Query  233  SGGVHFDTATAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTREDQIPPV  292
             G                      LS +E   +SR T    SK TK+R   TR++   P+
Sbjct  225  KG----------------------LSTDEINTISRTTALFTSKATKDR-RATRDESSSPM  261

Query  293  LRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRV  352
            L   SSRLTQLAPV D ALSTPL Q QID+MFPLI+ S E+   SR  ++ SREW  +R 
Sbjct  262  LVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERF  321

Query  353  QEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNV  412
            QEW+DSRFNVG D +LA+VG+ GSGK+  A ++ DK+ D +VA H C FDRK+KSSPRNV
Sbjct  322  QEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNV  381

Query  413  LLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFD  472
            LLSLVNQ+ S+LP+FK+QLARLNLKYVLEE+D   L+RK+L+DPL ALEEP+T K  + D
Sbjct  382  LLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMID  441

Query  473  AIDQCRTGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANY  532
             +DQC++  G NDL DFL+ IIPE P W+G  ++SKPSPE    + +SS+LDFSA+N NY
Sbjct  442  GLDQCKSR-GRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNY  500

Query  533  MNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVD  592
            MNDTV +INDI   F D D  +A++ILK KSGGN+++L+FTKQALS+PGMEE +G++P+D
Sbjct  501  MNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLD  560

Query  593  VLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLS  652
            VLHDLP+S+YEIYEEIFEDKFGKGR R+W+K  P+L+LI TAASGPYA ITE    +  +
Sbjct  561  VLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFA  620

Query  653  YTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711
             +K+++R +RR+F+DII +RHGTY I +SA+++WL D QR GEQ+++DV+  +  LR++
Sbjct  621  LSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679

>PHYCA_511415
Length=744

 Score = 573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/612 (49%), Positives = 418/612 (68%), Gaps = 33/612 (5%)

Query  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242
            LR+E+ E+K+E++AI+RE+MNE+H+TRYDVLKE+T+LKG I QL      +   H   + 
Sbjct  157  LRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQL------TAAQHSSPSV  210

Query  243  AAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTRED--QIPPVLRSTSSRL  300
            ++       P    LS EE+ AL+R+T+T  S  T++R+  +R +  + PP     S RL
Sbjct  211  SSTESSSSDP----LSAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRL  266

Query  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360
            TQLAPV D+ALSTPL  +QI++MFPLIDF++++   +R    GSR W   RV+EWLD+RF
Sbjct  267  TQLAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARF  326

Query  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420
            NVG D +LA+VG+ G+GK+    +V  ++   ++A H C+FDRK+KSSPRNVLLS+V+QL
Sbjct  327  NVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQL  386

Query  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480
              +LP+FK+QLARLNLKYVLEE D   L+ KVL+DPLNA+EEP+   F++ D IDQC  G
Sbjct  387  VDNLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAG  446

Query  481  V-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  539
              G N+L  F + +IP+ P W+GFL+SSKPS + A  +PVSSVLDFSA+N  ++ D   L
Sbjct  447  PNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSL  506

Query  540  INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDL  597
            ++DIA  F D+D AEAK++LK KSGGN++YLEFTKQALS+PGM   S  G VP+ VLH+L
Sbjct  507  VDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHEL  566

Query  598  PQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDE  657
            P++LY+IY EIFEDKFG+GR RVW KA P+LQL+  AASGPY+ +TE+   +    T ++
Sbjct  567  PETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAED  626

Query  658  VRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKL  717
            +RMLRR+F+D+++++HG+Y I SSA+  WL+D  R  EQ++  ++  +  LRK+ R    
Sbjct  627  LRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKMRR----  682

Query  718  NMPgtsssgtserstmsrsgasistsstsssdrssggsNNHstpstrtssssYPAKLHEP  777
            N+  +  S +   S  S +  + S +S+  +  S     +H+               HEP
Sbjct  683  NVSSSGHSHSGSSSDSSATHHTSSRASSRVTASSKSQQRSHTR--------------HEP  728

Query  778  NLNPSKPVGILK  789
              NP KPVGILK
Sbjct  729  RTNPGKPVGILK  740

>PPTG_17129
Length=745

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/563 (51%), Positives = 401/563 (71%), Gaps = 32/563 (6%)

Query  166  VTPTTPAAVIRAGDADL--LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTI  223
            V  TT  +   +GD +L  LR+E+ E+K+E++AI+RE+MNE+H+TRYDVLKE+ +LKG I
Sbjct  140  VHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAI  199

Query  224  MQLVSVIQQSGGVHFDTATAAAMGIDVPPQA--------NELSPEEKEALSRktttvvsk  275
             QL +  Q S                 PP          + LS EE+ AL+R+T+T  S+
Sbjct  200  AQLTAT-QHSA----------------PPSVSSTESSSSDPLSAEERAALTRQTSTKTSQ  242

Query  276  vtkERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEV  333
             T++R+  +R +  + PP     S RLTQLAPV D+ALSTPL  +QI++MFPLIDF++E+
Sbjct  243  ATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSEL  302

Query  334  QIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQV  393
               +R    G+R W   RV+EWLD+RFNVG D +LA+VG+ G+GK+    +V  ++   +
Sbjct  303  AAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNL  362

Query  394  VAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVL  453
            +A H C+FDRK+KSSPRNVLLS+V+QL  +LP FK+QLARLNLKYVLEE D   L+ KVL
Sbjct  363  LAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVL  422

Query  454  IDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPE  512
            +DPLNA+EEP+   F++ D IDQC  G+ G N+L +F + +IP+ P W+GFL+SSKPS +
Sbjct  423  VDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSK  482

Query  513  FAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEF  572
             A  +PVSSVLDFSA+N  ++ D   +++DIA  F D+D AEAK++LK KSGGN++YLEF
Sbjct  483  LAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEF  542

Query  573  TKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQL  630
            TKQALS+PGM  AS  G VP++VLH+LP++LY+IY EIFEDKFG+GR RVW KA P+LQL
Sbjct  543  TKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  602

Query  631  IFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQ  690
            I  AA+GPY+ +TE+   +   +T +++RMLRR+F+D+++++HG Y I SSA+  WL+D 
Sbjct  603  IVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDP  662

Query  691  QRKGEQYFIDVNLYVKVLRKVLR  713
             R  EQ++  ++  ++ LRK+ R
Sbjct  663  ARSEEQFYFSIDDALQALRKMRR  685

>PHYKE_8395
Length=1420

 Score = 562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/534 (53%), Positives = 390/534 (73%), Gaps = 16/534 (3%)

Query  183   LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242
             LRAEL+E+K E+Q I+RE+MNE+H+TRYDVLKE+T+LKG + QL S  Q +G V   T++
Sbjct  826   LRAELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL-SAAQTTGSVSPSTSS  884

Query  243   AAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTRED--QIPPVLRSTSSRL  300
             ++            LS E++ AL+R  + + SK TK+R+  +R +   +PP     S RL
Sbjct  885   SSDP----------LSAEDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRL  934

Query  301   TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360
             TQLAPV D+ALSTPL+ +QI++MFPLIDF++E+   +R    G+R W   RV+EWLD+RF
Sbjct  935   TQLAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARF  994

Query  361   NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420
             NVG D VLA+VGD G+GK+    +V  ++   ++A H C+FDRK+KS+PRNVLLS V+QL
Sbjct  995   NVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQL  1054

Query  421   TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480
               +LP FK+QLARLNLKYVLEE+D   L+ KV +DPLNA+EEP+   F++ + +DQC  G
Sbjct  1055  VDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAG  1114

Query  481   V-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  539
               G N+L +FLS IIP+ P W+GF++SSKP  +FA  +PVSSVLDFSA+N  +++D   L
Sbjct  1115  PNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSL  1174

Query  540   INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDL  597
             ++DIA  F D D AEAK++LK KSGGN++YLEFTKQALS+PGM  AS  G VP++VL DL
Sbjct  1175  VDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDL  1234

Query  598   PQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDE  657
             PQSL++IY EIFEDKFG+GR R+W KA P+LQLI  AA+GPY+ +TE    +   +T ++
Sbjct  1235  PQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTED  1294

Query  658   VRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711
             +RMLRR+F+D++ ++HG Y + SSA+  WL+D  R  EQ+++ V+  +  LRK+
Sbjct  1295  LRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348

>PHYSO_348903
Length=766

 Score = 560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/564 (50%), Positives = 400/564 (71%), Gaps = 15/564 (3%)

Query  156  RSTARYVGPGVTPTT-PAAVIRAGDADLLRAELREMKQEMQAIKREMMNEMHLTRYDVLK  214
            +ST    G    PTT  +AV   G+ + LRAE+ E+K+E++AI+RE+MNE+H+TRYDVLK
Sbjct  149  QSTTFARGFSAIPTTVGSAVAEEGELERLRAEVLEVKEEVKAIRREVMNELHVTRYDVLK  208

Query  215  EVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQANELSPEEKEALSRktttvvs  274
            E+ +LKG + QL +  Q S      +  ++++        + LS +++  L R+T+T  S
Sbjct  209  ELALLKGAVAQLTAA-QHSSPPSVSSTDSSSL--------DPLSADDRAKLVRQTSTKTS  259

Query  275  kvtkERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAE  332
              T+ER+  +R +  + PP     S RLTQLAPV D ALSTPL  +QI++MFPLIDF++E
Sbjct  260  PATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSE  319

Query  333  VQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQ  392
            +   +R    GSR W   RV+EWLDSRFN G+D++LA+VG+ G+GK+    +V  ++   
Sbjct  320  LAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGN  379

Query  393  VVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKV  452
            ++A H C+FDRK+KS+PRNVLLS+V+Q+  + P FK+QLARLNLKYVLEE D   L+ KV
Sbjct  380  MLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKV  439

Query  453  LIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAIIPECPKWLGFLVSSKPSP  511
            L+DPLNALEEP+   F++ D IDQC  G  G N+L +F + IIP+ P W+GFL+SSKPS 
Sbjct  440  LVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSS  499

Query  512  EFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLE  571
            + A  +PVSSVLDFSA+N  ++ D   L+ DIA  F D+D  +AK +LK KSGGN++YLE
Sbjct  500  KLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLE  559

Query  572  FTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQ  629
            FTKQALS+PGM  AS  G VP+ VL+DLP++LY+IY EIFEDKFG+GR RVW KA P+LQ
Sbjct  560  FTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  619

Query  630  LIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTD  689
            L+  AASGPY+ +TE+   +  + T +++RMLRR+F+D++++RHG+Y I SSA+  WL+D
Sbjct  620  LVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSD  679

Query  690  QQRKGEQYFIDVNLYVKVLRKVLR  713
              R  EQ++  ++  ++ LR++ R
Sbjct  680  PARSEEQFYFSIDDALQALRQMRR  703

>PITG_18458
Length=747

 Score = 557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/544 (51%), Positives = 396/544 (73%), Gaps = 16/544 (3%)

Query  177  AGDADL--LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSG  234
            +GD +L  LR+E+ E+K+E++AI+RE+MNE+H+TRYDVLKE+ +LKG I QL +      
Sbjct  147  SGDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH---  203

Query  235  GVHFDTATAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTRED--QIPPV  292
                     A++       ++ LSP+E+ AL+R+T+T  S+ T++R+  +R +  + PP 
Sbjct  204  ------IAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPP  257

Query  293  LRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRV  352
                S RLTQLAPV D+ALSTPL+ +QI++MFPLID ++E+   +R    G+R W   RV
Sbjct  258  AARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRV  317

Query  353  QEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNV  412
            +EWLD+R+N+G D +LA+VG+ G+GK+    +V  ++   ++A H C+FDRK+KSSPRNV
Sbjct  318  EEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNV  377

Query  413  LLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFD  472
            LLS+V+QL  SLP FK+QLARLNLKYVLEE D   L+ KVL+DPLNA+EEP+   F++ D
Sbjct  378  LLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVD  437

Query  473  AIDQCRTGV-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNAN  531
             IDQC  G  G N+L +  + +IP+ P W+GFLVSSKPS + A  +PVSSVLDFSA+N  
Sbjct  438  GIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGA  497

Query  532  YMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFV  589
            ++ D   L++DIA  F D+D AEAK++LK KSGGN++YLEFTKQALS+PG+  AS  G V
Sbjct  498  FVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAV  557

Query  590  PVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMD  649
            P++VLH+LP++LY+IY EIFEDKFG+GR RVW KA P+LQL+  AA+GPY+ +TE+   +
Sbjct  558  PLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKE  617

Query  650  SLSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLR  709
              + T +++RMLRR+F+D++S++HG+Y I SSA+  WL+D  R  EQ++  V+  +  LR
Sbjct  618  HFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALR  677

Query  710  KVLR  713
            K+ R
Sbjct  678  KIRR  681

>PHYRA_81098
Length=741

 Score = 556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/545 (52%), Positives = 391/545 (72%), Gaps = 13/545 (2%)

Query  169  TTPAAVIRAGDADLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVS  228
            +T  A+  A + + LR+E+ E+K+E++AI+RE+MNE+H+TRYDVLKE+ +LKG I QL +
Sbjct  135  STTRAISDAFELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLAA  194

Query  229  VIQQSGGVHFDTATAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTRED-  287
                S         AA++       ++ LS +E+ AL+R+T+T  S  T+ER+  +R + 
Sbjct  195  TQHLS--------PAASVSSTESSSSDPLSADERAALTRQTSTKTSSATRERLAASRANI  246

Query  288  -QIPPVLRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSRE  346
             + PP     S RLTQLAPV D+ALSTPL  +QI+DMFPLIDF++E+   +R    GSR 
Sbjct  247  HKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRT  306

Query  347  WVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAK  406
            W   RV+EWLD+RFNVG D +LA+VG+ G+GK+    +V  ++   ++A H C+FDRK+K
Sbjct  307  WALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSK  366

Query  407  SSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTP  466
            SSPRNVLLS+V+QL  SLP FK+QLARLNLKYVLEE D   L+ KVL+DPLNA+EEP+  
Sbjct  367  SSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHA  426

Query  467  KFVVFDAIDQCRTGV-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDF  525
             F++ D IDQC  G  G N+L +F + +IP  P W+GF+VSSKPS + A  +PVSSVLDF
Sbjct  427  TFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDF  486

Query  526  SAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEA  585
            SA+N  +++D   L+ D+A  F DND AEAK++LK KSGGN++YLEFTKQALS+PGM  A
Sbjct  487  SAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAA  546

Query  586  S--GFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQIT  643
            S  G VP+ VLH+LP++LY+IY EIFEDKFG+GR RVW KA P+LQLI  AA+GPY+ +T
Sbjct  547  SKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVT  606

Query  644  EQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNL  703
            E+      + T +++RMLR +F+D++++RHG Y I SSA+  WL+D  R  EQ++  ++ 
Sbjct  607  EEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDD  666

Query  704  YVKVL  708
             ++ L
Sbjct  667  AIQAL  671

>HYAP_07104
Length=721

 Score = 529 bits (1362),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 267/535 (50%), Positives = 368/535 (69%), Gaps = 11/535 (2%)

Query  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242
            LR EL E+KQE+ AI++ ++NE+H+TRYDVLKE+ +LKG I QL        G      T
Sbjct  149  LRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLT-------GTFPPPTT  201

Query  243  AAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTRED--QIPPVLRSTSSRL  300
            +  + I     +N LS  ++ AL+R+T+T+ S  T++R+  +R +  + PP     S RL
Sbjct  202  SVPLSIQRS-VSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRL  260

Query  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360
            TQLAPV DSALSTPL   Q++D+FPLIDF+ E+   +R    GSR W   R +EWL+SRF
Sbjct  261  TQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRF  320

Query  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420
              G D +LA+VG+ GSGK+    +V  +Y  Q+VA H C+FDRK KSSPRNVLLS+V+QL
Sbjct  321  KAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQL  380

Query  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480
              +LP+FK+QLARLNLKYVLEE D   L+ KVL+DPLNALE+P+   F++ D IDQC  G
Sbjct  381  VVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVG  440

Query  481  -VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  539
              G N+L +FL+ +IP+ P WLG +VSSKPS + A  +PVSSVLDFSA+N  ++ D   L
Sbjct  441  PAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSL  500

Query  540  INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQ  599
            +++IA  F   D  EAK++LK KSGGN++YLEFTKQALS        G V +DVL +LP+
Sbjct  501  VDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPE  560

Query  600  SLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVR  659
            +LY+IY EIFEDKFG GR RVW KA  VLQL   A +GPY+ +TE+   +    T +++R
Sbjct  561  TLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLR  620

Query  660  MLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRG  714
            +LRR+F+D+++++HG Y I +SA+  WL D  R  EQ++ +++  ++ LRK+ R 
Sbjct  621  LLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMRRA  675

>PHALS_06476
Length=726

 Score = 511 bits (1316),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 264/515 (51%), Positives = 363/515 (70%), Gaps = 18/515 (3%)

Query  166  VTPTTPAAVIRAGDADL--LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTI  223
             T T PA    +GD DL  L +E+ ++K E++ I+RE+MNE+H+TRYDVLKE+T+LKG I
Sbjct  141  TTSTLPAI---SGDFDLERLHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAI  197

Query  224  MQLVSVIQQSGGVHFDTATAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITT  283
             QL S    +      +  +++        ++ LS +E+ AL+R+T T  S+ T++R+  
Sbjct  198  AQLASTKSLNSSSSVSSTDSSS--------SDPLSSDERAALTRQTPTKTSQATRDRLAA  249

Query  284  TR--EDQIPPVLRSTSSRLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRE  341
             R   ++ PP     S+RLTQLAPV D ALSTPL+ +QI++ FPLIDF++E+   +R   
Sbjct  250  PRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLT  309

Query  342  TGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKF  401
             GSR W   R+QEWLD+RF++G D +LA+VG+ GSGK+    +V  ++   ++A H C+F
Sbjct  310  PGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQF  369

Query  402  DRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALE  461
            DRK+KS PRNVLLS+V+QL  +LP+FK+QLARLNL+YVLEETD   L+ KVLIDPLNALE
Sbjct  370  DRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALE  429

Query  462  EPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVS  520
            EP    F++ D IDQC TG  G N+L +F+S II   P W+GFLVSSKPS + A  +PVS
Sbjct  430  EPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVS  489

Query  521  SVLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNP  580
            SVLDFSA+N  ++ D   L+ DI+  F D+D  EAK++L  KSGGN++YLEFTKQALS+P
Sbjct  490  SVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHP  549

Query  581  GMEEAS--GFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGP  638
            GM   S  G VP+ VL +LP++LY+IY EIFEDKFG+G  R W KA P+LQLI  AA+GP
Sbjct  550  GMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGP  609

Query  639  YAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRH  673
            Y+ +TE+     L    D++RMLRR+F+DI++++H
Sbjct  610  YSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH  644

>PYVX_23590
Length=689

 Score = 451 bits (1160),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 263/596 (44%), Positives = 361/596 (61%), Gaps = 92/596 (15%)

Query  128  ATNSGLRGTD-------LRATGLETLNEMEEEVVDRSTARYVGPGVTPTT--PAAVIRAG  178
            +T   +R TD       LR+TGLE L E      DR     V  G  P T  P A    G
Sbjct  94   STAGSVRTTDVYRTTEQLRSTGLEPLAE------DRVLPPAVPYGSVPHTSGPHADGPGG  147

Query  179  DADLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHF  238
             A  LRAEL +++ E QAI+RE+MNE+H+ RYDVLKEVT+LKG + QL++ +   GG   
Sbjct  148  LA-ALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKGAVAQLLAALAPGGG---  203

Query  239  DTATAAAMGIDVPPQANELSPEEKEALSRktttvvskvtkERITTTREDQIPPVLRSTSS  298
                                    +A SR  +   +       +++   ++ P  R+   
Sbjct  204  ------------------------DAGSRPGSAGSATSAATTASSSSA-ELSPADRAAIG  238

Query  299  RLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDS  358
                LAPVDD+ALS PL  EQ+D++FPL+D S ++   +R R  G+R+W   RVQEWLDS
Sbjct  239  VAPTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDS  298

Query  359  RFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVN  418
            RFNVG D +L +VG  G+GK+    SVCD  +  V+A HFCKFDRKAKS+PR VLLSLV 
Sbjct  299  RFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVR  358

Query  419  QLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCR  478
            Q+ ++LP FK QLARLNLKYVLEE DV  L+ KVLIDPL A EEP+T K +V D +DQC+
Sbjct  359  QVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCK  418

Query  479  T---GVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMND  535
            T   G   N+L +FL+ ++P+ P WLG LVSSKP+PE A  +  +S+LDFS +N  ++ D
Sbjct  419  TSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQD  478

Query  536  TVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLH  595
              FL++DIAA F D   AEA+++L+TK+GGN++YL+FT+QALS+PG+++  G + +D+LH
Sbjct  479  ARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGLDD--GELELDMLH  536

Query  596  DLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTK  655
            DLP+SLYEIY EIFED                                            
Sbjct  537  DLPESLYEIYLEIFED-------------------------------------------N  553

Query  656  DEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711
            D++R+++R+F+DII++R G Y I SSA+++WL+D  R GE +F D +  V  LR++
Sbjct  554  DDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRL  609

>CCI44111
Length=576

 Score = 361 bits (926),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 201/532 (38%), Positives = 303/532 (57%), Gaps = 16/532 (3%)

Query  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242
             R E++ M++E+Q +++E++  +  TRYD+LKE+  LKG +  +         +  D+  
Sbjct  56   FRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATM--------SIKIDSPI  107

Query  243  AAAMGIDVPPQANELSPEE----KEALSRktttvvskvtkERITTTREDQIPPVLRSTSS  298
             A +       AN  +  E     E LS   T   S V  +    TR      +LR   S
Sbjct  108  NAKINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRE--S  165

Query  299  RLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDS  358
             L  L  +D++ LS PL +++ID+MFPLID S +V+  +    +G+R W  D + +W+ S
Sbjct  166  GLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQS  225

Query  359  RFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVN  418
             F  G + VL +VG+ G+GK+  A  VC K+   + A HF +FDRK  SS R+V+LSLV+
Sbjct  226  NFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVS  285

Query  419  QLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNAL-EEPLTPKFVVFDAIDQC  477
            Q  S L ++K QL RLNL+Y+L E++   ++ K+LIDPL A+ E   T  FV+FD IDQC
Sbjct  286  QFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQC  345

Query  478  RTGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTV  537
                  NDL + LS I    P W+GF+V+SK  P FA  +  +SV+     N +++ D+ 
Sbjct  346  LVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSR  405

Query  538  FLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDL  597
             L+ ++   F      EA  IL  KSGGN  YL+F  +ALS+P +     F+ +DVL +L
Sbjct  406  ILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDEL  465

Query  598  PQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDE  657
            P+S+ EI   IF+DKFG+G  RVW+ A P+L++I  AA+GPY  + E  I       ++E
Sbjct  466  PESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENE  525

Query  658  VRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLR  709
             RM+ RAF DII      Y I++S++YDWL  ++R  + + ++     K LR
Sbjct  526  WRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKR-SQHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 352 bits (904),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 189/533 (35%), Positives = 311/533 (58%), Gaps = 17/533 (3%)

Query  183  LRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTAT  242
            +R E+++M+ E+Q++++E++  +  TRYD++KE+  L+G +  +      +G    D  +
Sbjct  63   VRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGI-----GNGLTKIDVKS  117

Query  243  AAAMGIDVPPQANEL----SPEEKEALSRktttvvskvtkERITTTREDQIPPVLRSTSS  298
            +     +    AN+     S E+ E +SR  T   S +  +   + +   +   L +  S
Sbjct  118  SPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVAD--CSYKSGFVTERLNTKDS  175

Query  299  RLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDS  358
              +   P+D+S LS PL +++ D+MFP ID  ++++  +     G+R W  DRV+EW++S
Sbjct  176  SFSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIES  235

Query  359  RFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVN  418
             F    D +L ++G+ GSGK+  A  +C K++ ++ A HFC+FDRK++SS R+V+LSLV+
Sbjct  236  NFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVS  295

Query  419  QLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPL---TPKFVVFDAID  475
            Q  S  P++K QL  LNL+Y+L+E++   ++ K+LI+PL A+  P+   T  FV+FD ID
Sbjct  296  QFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGID  353

Query  476  QCRTGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMND  535
            QC      NDL D +S I    P  +GF+V+SK SP F       S++    +N  +MND
Sbjct  354  QCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMND  413

Query  536  TVFLINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLH  595
            +  L+ +    F      EA  IL  KSGGN  YL+FT++ALS+P +     F+ +DVL 
Sbjct  414  SRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLD  473

Query  596  DLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTK  655
            +LP S+ +I+  IFEDKFG+G  RVW+   P+L+ I  AA+G +  + E+ I       K
Sbjct  474  ELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGK  533

Query  656  DEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVL  708
            +E RM++R+F DII      Y I++S+++ WL  + R  + ++ID    +K L
Sbjct  534  EEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENR-SQHFYIDPKAGIKFL  585

>SPRG_06355
Length=713

 Score = 244 bits (623),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 166/569 (29%), Positives = 289/569 (51%), Gaps = 59/569 (10%)

Query  185  AELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSG----------  234
            A + EMK+ +  I+R++M E+H T+YD+LKE+TML+G +MQLV  + Q            
Sbjct  144  AAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRT  203

Query  235  -----GVHFDTATAAAMGID------------------VPPQANELSPEEKEA-LSRktt  270
                  V  D   ++    +                  +P  +   SP ++E+ + R++ 
Sbjct  204  EDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVRESI  263

Query  271  tvvskvtkERITTTREDQIPPVLRSTSS--RLTQLAPVDDSALSTPLHQEQIDDMFPLID  328
               SK+++E    +RE     + R +S   R +   P+ D AL+ P  +  ++   P ++
Sbjct  264  RASSKLSRESSKLSRESS--KISRESSKLFRESTRQPIKDQALTQPW-ENVLNQHLPFLN  320

Query  329  FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDK  388
                 Q  +      +R W  ++  +W           VL +VG AG+GK+   + +   
Sbjct  321  ----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSN  376

Query  389  YEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLEETDVPAL  448
            Y +Q++A HF ++D +  +S   +L+SL +Q++  LP F+ QL RLNL Y+++E D   L
Sbjct  377  YPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVL  434

Query  449  SRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYNDLQDFLSAIIPECPKWLGFLVSSK  508
            + K+LI+PL ++  PL  + +V DA+D+  +  G N L   L+ +  E P W+ FL+SS+
Sbjct  435  ATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTN-LISLLADVALEFPSWVLFLLSSR  493

Query  509  PSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSGGNYS  568
            P      ++P   VL F  ++  +  D    +  +    H  D      +LK KS G++ 
Sbjct  494  PVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDK-HGLDDKNILFLLKAKSQGSFL  552

Query  569  YLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVL  628
            YL+F  QA +    E  +G +      +LP++LYEIY+++FE+K+GKGR RVW+K  PVL
Sbjct  553  YLQFVDQAFAMIHSEIDAGMI-----LELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVL  607

Query  629  QLIFTAASGPYAQ-----ITEQNIMDSLSYTKDEVRMLRRAFIDIISI--RHGTYAIVSS  681
            + I  AA+  + +     +TE ++       + ++ ++ R+F DI+++    G Y + S 
Sbjct  608  EAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSK  667

Query  682  AVYDWLTDQQRKGEQYFIDVNLYVKVLRK  710
             ++D+L D  R  E   I+V   V  L K
Sbjct  668  GLFDYLVDTSRSQEVAHINVERGVHYLTK  696

>SDRG_01763
Length=736

 Score = 206 bits (525),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/413 (30%), Positives = 217/413 (53%), Gaps = 21/413 (5%)

Query  305  PVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGA  364
            P+ D AL+ P  +  ++   P ++     Q  +      +R W  ++  +W         
Sbjct  321  PIKDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNE  375

Query  365  DVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSL  424
              VL +VG AG+GK+   + +   Y +Q++A HF ++D +   +P  +L+SL +Q++  L
Sbjct  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKL  433

Query  425  PMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYN  484
            P ++ QL RLNL Y+++E D   L+ K+LI+PL ++  PL  + +V DA+D+  +  G N
Sbjct  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN  493

Query  485  DLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIA  544
             L   L+ +  E P W+ FL+SS+       ++P   VL F  ++  +  D    +  + 
Sbjct  494  -LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM  552

Query  545  AVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEI  604
               H  D      +LK KS G++ YL+F  QA S    E  +G +      +LP++L+EI
Sbjct  553  DK-HGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEI  606

Query  605  YEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQ-----ITEQNIMDSLSYTKDEVR  659
            Y+++FE+K+GKGR RVW+K   VL+ I  AA+  + +     +TE ++       + ++ 
Sbjct  607  YDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLA  666

Query  660  MLRRAFIDIISIRH--GTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRK  710
            ++ R+F DI+++    G Y + S  ++D+L D  R  E   I+V   +  L K
Sbjct  667  LIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)

Query  185  AELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQ  232
            A + EMK+ +  I+R++M E+H T+YD+LKE+TML+G +MQLV  + Q
Sbjct  157  AAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQ  204

>H310_08292
Length=1007

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 94/401 (23%), Positives = 163/401 (41%), Gaps = 39/401 (10%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H  Q   +F +   FS + +I    +    REWV D++ +W        A     + G  
Sbjct  425  HDGQQARLFSIFSPFSFQAEIAKFTQGFAGREWVMDQLTQW-----KASASQTFWVTGQI  479

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  434
            G+GKT  AA +    + +V A H    D +   +PR  +LSL  QLT+ LP + + L + 
Sbjct  480  GTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCILSLAYQLTTQLPAYAAFLQQG  538

Query  435  N-LKYVLEETDVPALSRKVLIDPLNALEEPLT-PKFVVFDAIDQCRTGVGY-NDLQDFLS  491
              L+ ++  + V  L   +L+ PLNA+ +P T P  ++ D +D  +      N     L 
Sbjct  539  EPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLDGLDAFQDAAALDNCFVSSLV  598

Query  492  AIIPECPKWLGFLVSSKPSPE-------FAVSVPVSSVLD-FSAQNANYMNDTV--FLIN  541
            A++ + P W+  + +S+  P            V +   +D  SA    Y+   +  F+  
Sbjct  599  ALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCVDQSSADMLKYLQAALVPFVRP  658

Query  542  DIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSL  601
            D  AV       E    +  +S G + Y      AL    +        +D L   P  +
Sbjct  659  DEGAVV----PLETLHAIVARSEGLFLYASHIVHALHQKRLT-------LDKLESFPVGM  707

Query  602  YEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRML  661
                 + FED+F            P+L+ +  AA  P       ++M   +Y+    R  
Sbjct  708  GGYLRQFFEDQFSAHHYET--SIRPLLE-VLCAALEPMPMAMLHDVMKWDTYSH---RDC  761

Query  662  RRAFIDIISIRHG-TYAIVSSAVYDWLTDQQRKGEQYFIDV  701
              AF  ++ +          ++V++WL D    G ++F+ V
Sbjct  762  LGAFKSLLYVSESDDIKPFHTSVFEWLQDANAAG-RFFVRV  801

>H257_11773
Length=1026

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 96/404 (24%), Positives = 169/404 (42%), Gaps = 32/404 (8%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H  Q   +F +   FS + +I    +    REWV D++ EW        +     + G  
Sbjct  440  HDGQQARLFSIFSPFSFQAEISKFTQGFAGREWVMDQLTEW-----KASSSQTFWITGQI  494

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  434
            G+GKT  AASV    + +V A H    + +   + R  +LSL  QLT+ LP + + L + 
Sbjct  495  GTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCVLSLAYQLTTQLPDYAAFLQQG  553

Query  435  N--LKYVLEETDVPALSRKVLIDPLNALEEPLT-PKFVVFDAIDQCR-TGVGYNDLQDFL  490
            +  L+ ++  + V  L   +L+ PLNA+ +P T P  ++ D +D  + +    N     L
Sbjct  554  DQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVILIDGLDAFQDSNAVENCFVSSL  613

Query  491  SAIIPECPKWLGFLVSSKPSPEFAVS----VPVSSVLDFSAQNANYMND--TVFLINDIA  544
            +A +   P W+ ++++S+  P         VP  ++     Q  + M     + L+  +A
Sbjct  614  AAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKCGHQTRDDMLKYLQLALVQFVA  673

Query  545  AVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEI  604
                D   A  + I++ +S G + Y      ALS   +        +D L   P  +   
Sbjct  674  NADKDVPAATLRFIVE-RSEGLFLYASHIVNALSQKRLT-------LDKLESFPVGMGGY  725

Query  605  YEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRA  664
              + FED+F            P+L+ +  AA  P    T  NIM   SY     R    +
Sbjct  726  LRQYFEDQFTALHYET--SVRPLLE-VLCAAFEPLHMSTLHNIMKWDSYAH---RDFLGS  779

Query  665  FIDIISIR-HGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKV  707
            F  ++ +          ++V++WL D    G  +    N + ++
Sbjct  780  FKSLLYVSDENELKPFHTSVFEWLEDAHAAGRFFVCAANGHERI  823

>SPRG_12621
Length=1003

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 91/366 (25%), Positives = 156/366 (43%), Gaps = 37/366 (10%)

Query  343  GSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHF-CKF  401
              REWV D++ +W  +      D V  + G  G+GK+  AA +      +V A H  CK 
Sbjct  459  AGREWVLDQLDQWKQTH-----DQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKE  512

Query  402  DRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLN-LKYVLEETDVPALSRKVLIDPLNAL  460
            D + +S  R  +LSL  QLT+ LP + S L + + L+ V+  + V  L   +L+ PL A+
Sbjct  513  DEQTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAI  571

Query  461  EEP-LTPKFVVFDAIDQCR-TGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSP-------  511
             EP  TP  ++ D +D    T    N L   L A++ + P W+  +++S+  P       
Sbjct  572  AEPATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQ  631

Query  512  EFAVSVPVSSVLDFSAQN-ANYMNDTV--FLINDIAAVFHDNDQAEAKQILKTKSGGNYS  568
             FA  + +    D S Q+  +Y+   +  +L +  A V  +       Q +  ++ G + 
Sbjct  632  GFAPQIALDKCADHSRQDIMSYLQKALLPYLPSTTAGVVPE----ATLQFIAGRAEGLFL  687

Query  569  YLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVL  628
            Y      ALS   +        +D L   P  +     + FE +F     +      P+L
Sbjct  688  YASHIVHALSQHRLT-------LDNLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLL  738

Query  629  QLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWLT  688
            + +  AA  P      + IM   SY + E+    ++ + +            ++V +WL 
Sbjct  739  E-VLCAAYEPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTD--SNVLKPFHTSVLEWLQ  795

Query  689  DQQRKG  694
            D    G
Sbjct  796  DSNAAG  801

>SDRG_04575
Length=1003

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 92/389 (24%), Positives = 160/389 (41%), Gaps = 44/389 (11%)

Query  329  FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVCDK  388
            FS + QI    +    REWV  ++ +W  +      D V  + G  G+GK+  AA +   
Sbjct  432  FSFQNQISKYTQGFAGREWVLHQLDQWKQTH-----DQVFWITGQIGTGKSALAAYIIQS  486

Query  389  YEDQVVAKHF-CKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLN-LKYVLEETDVP  446
               ++ A H  CK D + +S  R  +LSL  QLT+ LP + S L + + L+ V+  + V 
Sbjct  487  -RPEIRAFHLVCKEDEQTQSH-RRCILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVV  544

Query  447  ALSRKVLIDPLNALEEP-LTPKFVVFDAIDQCR-TGVGYNDLQDFLSAIIPECPKWLGFL  504
             L   +L+ PL+A+ EP  TP  ++ D +D    T    N L   L  ++ + P W+  +
Sbjct  545  ELLDILLVAPLSAIAEPATTPLVILLDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVI  604

Query  505  VSSKPSP-------EFAVSVPVSSVLDFSAQN-ANYMNDTVFLINDIAAVFHDNDQAEAK  556
            ++S+  P        F   + +   +D S Q+  NY+     L+  + +V H    +  +
Sbjct  605  LTSREDPVVMRKLQGFTPQIALDKCVDNSRQDIMNYLQRA--LVPYLPSVRHRRRCSSLR  662

Query  557  QILKTKSG-----------GNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIY  605
               K +             G + Y      ALS   +        +D L   P  +    
Sbjct  663  GAPKVERDATTHRDLLLRIGLFLYASHIVHALSQHRLT-------LDHLEGFPTGMGGYL  715

Query  606  EEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAF  665
             + FE +F     +      P+L+ +  AA  P      + IM   SY + E+    ++ 
Sbjct  716  RQFFESQFTPEHYK--EHIRPLLE-VLCAAYEPLTLDMLRAIMQWDSYVQHEMLASFKSL  772

Query  666  IDIISIRHGTYAIVSSAVYDWLTDQQRKG  694
            + +            ++V +WL D    G
Sbjct  773  LYVTD--SNVLKPFHTSVLEWLQDSNAAG  799

>PYAP_22230
Length=1116

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 106/462 (23%), Positives = 183/462 (40%), Gaps = 90/462 (19%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H  Q   +F L+  FS ++QI    +    R W+ + +++W+++    G+  V  + G  
Sbjct  466  HDGQQARLFSLLSPFSFQLQISQLTQRFTGRAWLLESIRQWINTPVTSGSK-VFWVTGQI  524

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  434
            GSGKT  AA +  +   ++ A HF   D       R  +LSL  QLT+ LP +   L   
Sbjct  525  GSGKTSVAARMV-QLMPEIAAFHFALQDDDQTQLARRCVLSLAYQLTTQLPEYAVFLQTG  583

Query  435  N-LKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVF--DAIDQ---------------  476
            + L+ ++  + V AL   +L++PLNA+  P + K VV   D ++                
Sbjct  584  DPLEEIVPVSSVQALLTHLLVNPLNAIARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPAL  643

Query  477  ------------------CRTGVGYND--LQDFLSAIIPECPKWLGFLVSSKPSPEFAVS  516
                              C    G +D  L   L ++I   P W+  ++ S+  P   + 
Sbjct  644  RPSLGRGTGSTNSTTASLCDESSGSSDECLVSLLPSLISRLPLWVRVILLSREDPSILLK  703

Query  517  VPV---SSVLDFSAQ-------------------NANYMNDTVFLINDI--------AAV  546
            + V   S  LD   +                    +++++ TV +   I        A  
Sbjct  704  LQVYTPSIALDRHERENEADIREFVEMALCSPDPQSSHISRTVQVAPPIRHRSPSITALS  763

Query  547  FHDND----QAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLY  602
              DN      AE  +++  +S G + Y     QA+     EE  G + VD L  LP  L 
Sbjct  764  VSDNTPRKISAEQVEVITKRSEGLFLYAANIVQAI-----EE--GRLAVDQLETLPVGLG  816

Query  603  EIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLR  662
                + FE  F     +   K  PVL+++  A    Y  +T   +     ++  E + + 
Sbjct  817  GYLRQFFESHFDDATYKT--KIRPVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMA  870

Query  663  RAFIDIISIRHGTYA-IVSSAVYDWLTDQQRKGEQYFIDVNL  703
             +F  ++ +    Y     S+V +W+ D +  G  +  DV L
Sbjct  871  SSFSALLFVSDDDYVRPFHSSVLEWVQDFKTAG-AFLTDVAL  911

>PYVX_21513
Length=1446

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 82/167 (49%), Gaps = 3/167 (2%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H+ Q   +F L+  FS + QI         R+W+F RVQ+W++   +     V  + G  
Sbjct  408  HEGQQARLFSLLSPFSFQQQISKLTYRFTGRDWLFKRVQQWINDSSSGTDHRVFWITGQI  467

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQL-AR  433
            GSGKT  AA +   +  ++ A HF   +       R  +LSL  QLT+ LP +   L +R
Sbjct  468  GSGKTSVAARMVQTFP-EIAAFHFALQEDDQTHIARRCVLSLAYQLTTQLPEYGVFLQSR  526

Query  434  LNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480
              L+ ++  +    L   +L++PLN ++ P  P  ++ D ++   +G
Sbjct  527  EPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLILLIDGLECIVSG  573

>SDRG_07983
Length=991

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 96/404 (24%), Positives = 167/404 (41%), Gaps = 51/404 (13%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H  Q   +F L+  FS + QI    +   +REWV  +   W+ +        +  M G  
Sbjct  412  HDGQQARLFSLLSPFSFQSQISKLTQLFVAREWVLAKYDAWVQTP---NGSRIFVMSGVI  468

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  434
            GSGK+   A +      ++ A H    +     S R  +LSLV QL++ LP + +    +
Sbjct  469  GSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANV---I  524

Query  435  NLKYVLEETDVPA-----LSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYNDLQDF  489
            N +  LEE  VP      L   +LI PL+A+  P +   ++ D ID    G         
Sbjct  525  NSQEPLEEI-VPVKSLVDLIHALLIAPLSAIAHPASILVLLIDGIDCFEPGFVAT-----  578

Query  490  LSAIIPECPKWLGFLVSSKPSPE----FAVSVPVSSVLDFSAQNANYMNDTVFLINDIAA  545
            L+A +   P W+ F+  ++  P         +P +  LD S  ++  ++   +L   +  
Sbjct  579  LTAHMDLWPSWVRFVFGTREDPSVLQTLQAYMPPAVSLDPSLPDSK-LDIKAYLHLALTP  637

Query  546  VFHDNDQAEAKQI---LKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLY  602
                  Q++  +I   +  +S G + Y      A+       A G + ++ L   P S+ 
Sbjct  638  QLTSESQSKRNEIVDFIAARSEGLFLYARHLVNAI-------AVGQLQLNQLDAFPTSMG  690

Query  603  EIYEEIFEDKFGKGRTRVWRKAL-PVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRML  661
               +  F+ +F       ++K + PVL+ +  AA+ P      ++I+    Y + ++   
Sbjct  691  GCLQHCFDAQFPS--IEYYKKTIRPVLE-VLCAANEPLPLSMFRSILALAVYEQQDILAW  747

Query  662  RRAFI-----DIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFID  700
              +       DII   H       S+V DWL D +  G  YF+D
Sbjct  748  FGSLFYITDSDIIKPFH-------SSVLDWLQDAKSAGP-YFVD  783

>PHYSO_470533
Length=1084

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 106/453 (23%), Positives = 182/453 (40%), Gaps = 76/453 (17%)

Query  309  SALSTPL-HQEQIDDMFPLI-DFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADV  366
            SAL   L H+ Q   +F L+  F+ + QI         REW+F+R Q+W+     +    
Sbjct  434  SALEGTLDHEGQQARLFSLLAPFNFQRQISQLTERFIGREWLFERFQQWVQGSTTLSTST  493

Query  367  ---------VLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLV  417
                     V  +VG  GSGKT  AA +      ++ A HF + + +   + R  +LSL 
Sbjct  494  QTGELINRRVFWLVGQIGSGKTSVAAQMVQTCP-EIAAFHFARQEDEQTHNARRCVLSLA  552

Query  418  NQLTSSLPMFKSQL-ARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVF--DAI  474
             QLT+ LP +   L +   L+ ++       L  ++LI PLNA+  P T K +V   D I
Sbjct  553  YQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLIGPLNAIARPTTYKSLVLLIDGI  612

Query  475  DQC------------RTGVGYND---LQDFLSAIIPECPKWLGFLVSSKPSPEFAVSV--  517
            +                  G  D   L   L A+    P W+  +V S+  P     +  
Sbjct  613  EWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRLPDWVRVVVLSREDPPVLSKLHA  672

Query  518  --PVSSVLD-FSAQNAN----YMNDTVFLIN--------------DIAAVFHDNDQAEAK  556
              P   ++D F  +N +    Y+N ++  +               D+ A  H+    +  
Sbjct  673  FEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFAKASEQAVDVPANNHEFGLEQVV  732

Query  557  QILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIYEEIFEDKFG--  614
            +++  +S G + Y     QA++        G + +  L +LP  +    ++ F   F   
Sbjct  733  ELIARRSEGLFLYAVNVVQAITE-------GRLRLHELAELPVGMGAYLQQFFASHFSDH  785

Query  615  ---KGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISI  671
               K R R      PVL+ +  AA  P    T   +++   Y + +   +  +   I + 
Sbjct  786  DMYKQRVR------PVLE-VLCAAYEPLPLATLARVLEWDVYEQRDASSVLGSLFCIEAG  838

Query  672  RHGTYAIV---SSAVYDWLTDQQRKGEQYFIDV  701
                  ++    S+V DW+ D    G+ +F+DV
Sbjct  839  YDANSQLLRPFHSSVLDWIQDSNSSGD-FFVDV  870

>H257_01934
Length=1022

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 95/194 (49%), Gaps = 11/194 (6%)

Query  323  MFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVA  381
            +F L+  FS + QI +  +    R WV     EW+ S  +  A  V  + G  GSGKT  
Sbjct  440  LFSLLSPFSFQSQISTATQGYCGRAWVLHEFDEWVTSPPS-NARRVFLLTGVIGSGKTAL  498

Query  382  AASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARLNLKYVLE  441
            AA +      +VVA H    + +   + R  +L+LV QLT+ LP + + L   + K  LE
Sbjct  499  AAHIIQN-RPEVVAFHLASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLE  555

Query  442  ET----DVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYNDLQDFLSAIIPEC  497
            ET    ++  L +++LI PL  +  P +   ++ D I +C      ++L   L+A +   
Sbjct  556  ETVFVGNLADLVQELLIAPLERIATPPSTMVILIDGI-ECFPCAD-DNLVAILTASLNRW  613

Query  498  PKWLGFLVSSKPSP  511
            P W+ F+ +S+  P
Sbjct  614  PAWMRFVFTSREDP  627

>SPRG_19030
Length=1000

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 94/404 (23%), Positives = 165/404 (41%), Gaps = 51/404 (13%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H  Q   +F L+  FS + QI    +   +REWV  +   W+ +        +  + G  
Sbjct  420  HDGQQARLFSLLSPFSFQSQISKLTQLFVAREWVLAKYDAWVQTP---NGSRIFVVSGVI  476

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  434
            GSGK+   A +      ++ A H    +     S R  +LSLV QL++ LP + +    L
Sbjct  477  GSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANV---L  532

Query  435  NLKYVLEETDVPA-----LSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYNDLQDF  489
            N +  LEE  VP      L   +LI PL+A+  P +   ++ D I+    G         
Sbjct  533  NSQEPLEEI-VPVKSLVDLIHALLIAPLSAIAHPASILVLLIDGIECFEPGFVAT-----  586

Query  490  LSAIIPECPKWLGFLVSSKPSPE----FAVSVPVSSVLDFSAQNANYMNDTVFLINDIAA  545
            L+A +   P W+ F+  ++  P         +P +  LD S   +  ++   +L   +  
Sbjct  587  LTAHMDLWPSWVRFVFGTREDPSVLQTLQAYMPPAVSLDPSLYESK-LDIKAYLHLALTP  645

Query  546  VFHDNDQAEAKQI---LKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLY  602
                  Q +  +I   +  ++ G + Y      A+       A G + ++ L   P S+ 
Sbjct  646  QLTTESQGKRNEIVDFIAARAEGLFLYARHLVNAI-------AVGQLQLNELDAFPTSMG  698

Query  603  EIYEEIFEDKFGKGRTRVWRKAL-PVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRML  661
               +  F+ +F       ++K + PVL+ +  AA+ P      ++I+    Y + ++   
Sbjct  699  GCLQHCFDAQFPS--IGYYKKTIRPVLE-VLCAANEPLPLSMFRSILSLDVYEQHDILAW  755

Query  662  RRAFI-----DIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFID  700
              +       DII   H       S+V DWL D +  G  YF+D
Sbjct  756  FGSLFYITDSDIIKPFH-------SSVLDWLQDAKSAGP-YFVD  791

>PYIW_15717
Length=1121

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 9/166 (5%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H+ Q   +F ++   S + QI         REW+F +++ W+ S     A  V  + G  
Sbjct  495  HEGQQTRLFSILSPLSFQQQISKLTSRFAGREWLFAQLESWIASP---SAAQVFWVTGQI  551

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQL-AR  433
            GSGKT  AA +  +   ++ A HF   + +   + R  +LSL  QLT+ LP + S L +R
Sbjct  552  GSGKTALAARMV-QLIPEIAAFHFALQEDEQTQNARRCVLSLAYQLTTQLPQYASFLQSR  610

Query  434  LNLKYVLEETDVPALSRKVLIDPLNALEEPLT---PKFVVFDAIDQ  476
              L+ ++  ++   L  ++L++PLN +  P T   P  ++ D ++ 
Sbjct  611  EPLEEIVPVSNFNTLVTRLLVEPLNDIARPQTATKPLVLLIDGLEH  656

>PITG_17250
Length=1046

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 108/447 (24%), Positives = 174/447 (39%), Gaps = 72/447 (16%)

Query  309  SALSTPL-HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLD----SRFNV  362
            SAL   L H+ Q   +F L+  FS + QI         REW+F   Q W+     S   +
Sbjct  412  SALEGTLDHEGQQTRLFSLLSPFSFQRQISHLTETFVGREWLFQLFQRWVQGSAASTREL  471

Query  363  GADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTS  422
                V  ++G  GSGK+  AA +      ++ A HF   + +   + R  +LSL  QLT+
Sbjct  472  SNQRVFWVIGQIGSGKSSVAACMVQACP-EIAAFHFATQEDEQTHNARRCVLSLAYQLTT  530

Query  423  SLPMFKSQL-ARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVF--DAID----  475
             LP +   L +   L+ ++       L   +LI PLNA+  P   K +V   D ++    
Sbjct  531  QLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNAIARPSKYKSLVLLIDGVEWLLP  590

Query  476  -QCR--TGVGYNDLQD------FLSAIIPECPKWLGFLVSSKPSPE-----FAVSVPVSS  521
              C    G  + + +D       L  ++   P+W+  ++ S+  P       A   P   
Sbjct  591  ASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIVLLSREEPPVLSKLHAFDPPDVI  650

Query  522  VLDFSAQNANYMNDTVFLINDIAAVFH-DNDQAEAK----------------QILKTKSG  564
            +  F  QN   +   +        +   D +QA A+                +++  +S 
Sbjct  651  IEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIGSGSDTGEFGMEQVVELIARRSE  710

Query  565  GNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIYEEIFEDKFG-----KGRTR  619
            G + Y     QA+S        G + +  L +LP  +     + F   F      K R R
Sbjct  711  GLFLYAVNVVQAISE-------GRLRLHELAELPVGMGAYLHQFFASHFADHDVYKHRIR  763

Query  620  VWRKALPVLQLIFTAASGPYAQITEQNIMDSLSY-TKDEVRMLRRAFIDIISIRHGTYAI  678
                  PVL+ +  AA  P    T   +++   Y  +D   ML   F   I   H   A 
Sbjct  764  ------PVLE-VCCAAYEPLPLATLARVLEWDVYEQRDAAAMLGSLF--SIEAGHDPEAQ  814

Query  679  V----SSAVYDWLTDQQRKGEQYFIDV  701
            +     S+V DW+ D    G  +F+DV
Sbjct  815  LLRPFHSSVLDWVRDSNSSG-VFFVDV  840

>PYIR_14107
Length=1176

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 96/446 (22%), Positives = 186/446 (42%), Gaps = 78/446 (17%)

Query  316  HQEQIDDMFPLID-FSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374
            H+ Q   +F ++   S + QI         REW+F +++ W+ S     A  V  + G  
Sbjct  520  HEGQQARLFSILSPLSFQQQISKLTSRFAGREWLFMQLENWIASP---TATQVFWVTGQI  576

Query  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQL-AR  433
            GSGKT  AA +  +   ++ A HF   + +   + R  +LSL  QLT+ LP +   L +R
Sbjct  577  GSGKTALAARMV-QVIPEIAAFHFALQEDEQTQNARRCVLSLAYQLTTQLPQYALFLQSR  635

Query  434  LNLKYVLEETDVPALSRKVLIDPLNALEEPLT--PKFVVFDAIDQCRTG-----------  480
              L+ ++  ++   L  ++L++PLN +  P +  P  ++ D ++   +G           
Sbjct  636  EPLEEIVPVSNFATLVTRLLVEPLNEIARPQSTKPLVLLIDGLEHLSSGKNSQLMTPGTS  695

Query  481  ----------------------VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPE------  512
                                   G   L   L +++   P W+  ++ S+  P       
Sbjct  696  MGRPSFARSSGSNFGDCCNSSPSGDECLVSALPSLVARLPNWVRVVLLSRLDPAIVAKLQ  755

Query  513  -FAVSVPVSSVLDFSAQNA-----NYMNDT--VFLINDI--------AAVFHDNDQAEAK  556
             +  S+ + S+   S Q+      N + ++    L   I        A+VF +    E  
Sbjct  756  GYTPSIVLDSLKSESQQDIKRYVENMLGESPATTLRRGIYGSASSTGASVFSNKLSPEQV  815

Query  557  QILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIYEEIFEDKFGKG  616
             ++  +S G + Y     Q++     EE    + VD L  LP  +   + + F+  F + 
Sbjct  816  DLIVKRSEGLFLYAVNIVQSI-----EEKR--LAVDQLESLPIGMGGYFRQFFDGHFDEQ  868

Query  617  RTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISI-RHGT  675
            + +      PVL+ +  A+  P++     NI+  L++   + + +  +F  ++SI   G 
Sbjct  869  QYQ--DSIRPVLE-VLCASFEPFSL---WNIVSILNWDVYDQQKIALSFGSLLSIGADGN  922

Query  676  YAIVSSAVYDWLTDQQRKGEQYFIDV  701
                 S++ DW+ D    G +YF+++
Sbjct  923  IRPFHSSMCDWVQDPATAG-KYFVNI  947

>PPTG_11365
Length=1106

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 102/455 (22%), Positives = 173/455 (38%), Gaps = 81/455 (18%)

Query  309  SALSTPL-HQEQIDDMFPLI-DFSAEVQIQSRIRETGSREWVFDRVQEWL------DSRF  360
            SAL   L H+ Q   +F L+  F+ + QI         REW+F++ Q W+       S  
Sbjct  465  SALEGTLDHEGQQARLFSLLAPFNFQRQISHLTENFIGREWLFEQFQRWVQGSAASSSTR  524

Query  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420
             +    V  +VG  GSGKT  AA +      ++ A H    + +   + R  +LSL  QL
Sbjct  525  ELSNQRVFWVVGQIGSGKTSVAACMVQSCP-EIAAFHLATQEDEQTHNARRCILSLAYQL  583

Query  421  TSSLPMFKSQL-ARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVF--DAIDQC  477
            T+ LP +   L +   L+ ++       L   +LI PL A+  P   K +V   D ++  
Sbjct  584  TTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLTAIARPSKYKSLVLLIDGVEWL  643

Query  478  -----------RTGVGYNDLQD------FLSAIIPECPKWLGFLVSSKPSPEF-----AV  515
                        +G  + + +D       L  ++   P+W+  ++ S+  P       A 
Sbjct  644  IPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLPEWVRIVLLSREEPPVLSKLRAF  703

Query  516  SVPVSSVLDFSAQNAN----YMNDTVFLINDIAAVF--------------HDNDQAEAKQ  557
              P  ++  F  +N      Y+N ++  +      F              H+    +  +
Sbjct  704  DPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEKAAAQIGTDSGNNHEFGMEQVVE  763

Query  558  ILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIYEEIFEDKFG---  614
            ++  +S G + Y     QA+S        G + +  L +LP  +    ++ F   F    
Sbjct  764  LIARRSEGLFLYAVNVVQAISE-------GRLHLHELAELPVGMGAYLQQFFASHFADHD  816

Query  615  --KGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIR  672
              K R R      PVL++   A    Y  +    I   L +   E R        + SI 
Sbjct  817  MYKHRVR------PVLEVCCAA----YEPLPVATIARVLEWDVYEQRDAATVLGSLFSIE  866

Query  673  HG------TYAIVSSAVYDWLTDQQRKGEQYFIDV  701
             G      T     ++V DW+ D    G  +F+DV
Sbjct  867  AGNDPETQTLRPFHTSVLDWVRDSSSSG-VFFVDV  900

>PYU1_G002110
Length=999

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 98/421 (23%), Positives = 162/421 (38%), Gaps = 89/421 (21%)

Query  331  AEVQIQSRIRETGSR----EWVFDRVQEWLDSRFNVGADVVLAMVGDAGSGKTVAAASVC  386
            A V  Q +I +  SR    +W+  ++ +W+DS     A  +  + G  GSGKT  AA + 
Sbjct  414  APVPFQQQISKLASRFVGRKWLIAQLTKWIDSP---TASQMFWVTGQIGSGKTALAARLV  470

Query  387  DKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQL-ARLNLKYVLEETDV  445
                + + A HF   + +   + R  +LSL  QLT+ L  + + L AR  L+ ++  +  
Sbjct  471  QTIPE-IKAFHFAFEEDEQTQNARRCVLSLAYQLTTQLKDYAAFLQAREPLEELVPVSTF  529

Query  446  PALSRKVLIDPLN---ALEEPLTPKFVVFDAIDQCRTGVG-------YNDLQDF------  489
              L   +LI PLN    L+   TP  ++ D ++    G             Q F      
Sbjct  530  NELVTHLLIKPLNEIAQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVS  589

Query  490  -LSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFH  548
             L +++ + PKW+  +V S+  P               A NA   N   F  N +   + 
Sbjct  590  ALPSLVSQLPKWVRVIVLSRNDP---------------AINAKLQN---FTPNIVLEAYV  631

Query  549  DNDQAEAKQILKT--------------------------KSGGNYSYLEFTKQALSNPGM  582
              ++ + KQ ++                           +S G + Y     Q+L     
Sbjct  632  KENKEDIKQFIEKSLCSSASTGLSSGKTLPPDQIDLIVERSEGLFLYAANVVQSL-----  686

Query  583  EEASGFVPVDVLHDLPQSLYEIYEEIFEDKFG-KGRTRVWRKALPVLQLIFTAASGPYAQ  641
             E   F    V   LP  +     + F   FG K   R+ R  L VL   F   S P   
Sbjct  687  -EEKWFA---VGQSLPIGMNGYLYDFFVSHFGAKQYKRLIRPVLEVLCAAFEPLSLP---  739

Query  642  ITEQNIMDSLSYTKDEVRMLRRAFIDIISI-RHGTYAIVSSAVYDWLTDQQRKGEQYFID  700
                 I   L    +E + +  AF  ++SI   G+     S+V +W+ + Q   + +++D
Sbjct  740  ----TIASILKLQTNEQQEIATAFGSLLSIGADGSVRPFHSSVLNWVQELQSV-DPFYVD  794

Query  701  V  701
            V
Sbjct  795  V  795

>PYAR_14788
Length=795

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 85/372 (23%), Positives = 141/372 (38%), Gaps = 44/372 (12%)

Query  367  VLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPM  426
            V  + G  G+GKT  AA +      ++ A HF   +       R  +LSL  QLT+ LP 
Sbjct  418  VFWVTGQIGAGKTSVAAKMVQTIP-EIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPA  476

Query  427  FKSQLARLN-LKYVLEETDVPALSRKVLIDPLNALEEPLT--PKFVVFDAIDQCRTGV-G  482
            +   L     L+ ++  + V +L   +LI PLNA+  P +  P  ++ D ++   +   G
Sbjct  477  YAVFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  483  YNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSV---PVSSVLDFSAQNANYMNDTVFL  539
                   L ++I   P W+  ++ S+      + +     S  LD   Q  N  +   F+
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQE-NEEDIRGFV  595

Query  540  INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS-------------  586
               + +  H    A A    + +S    S    +  A S+P + + S             
Sbjct  596  EAALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITKRSEG  655

Query  587  --------------GFVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIF  632
                          G + VD L  LP  L     + FE  F     +   K  PVL+ + 
Sbjct  656  LFLYAVNIVQSIEEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYKT--KIRPVLE-VL  712

Query  633  TAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTYA-IVSSAVYDWLTDQQ  691
             AA  P       +I    +Y + E   +  +F  +  I    Y     S+V +W+ D +
Sbjct  713  CAAYEPMTTAMLASIFHWSTYDQHE---MTTSFSALFCISDDGYMRPFHSSVLEWVQDIK  769

Query  692  RKGEQYFIDVNL  703
              G  +  DV L
Sbjct  770  TAG-LFLADVAL  780

>PYIR_23360
Length=227

 Score = 35.0 bits (79),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 1/29 (3%)

Query  346  EWVFDRVQEWL-DSRFNVGADVVLAMVGD  373
            E  F++V+EWL D R +VG D+VLA+VG+
Sbjct  104  EATFEKVKEWLQDLRHHVGDDIVLAIVGN  132

>SDRG_08334
Length=207

 Score = 33.9 bits (76),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 24/31 (77%), Gaps = 1/31 (3%)

Query  344  SREWVFDRVQEWLDS-RFNVGADVVLAMVGD  373
            ++E  FD+V+EWL   R +V +D+VLA+VG+
Sbjct  90   TKEDTFDKVKEWLSELRKHVDSDIVLALVGN  120

>PHYRA_82858
Length=224

 Score = 33.5 bits (75),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 1/29 (3%)

Query  346  EWVFDRVQEWL-DSRFNVGADVVLAMVGD  373
            E  FD+++EWL D + +VG D+VLA+VG+
Sbjct  97   EASFDKIKEWLQDLQHHVGDDIVLAVVGN  125

>PYIR_18122
Length=303

 Score = 33.5 bits (75),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 45/105 (43%), Gaps = 5/105 (5%)

Query  460  LEEPLTPKFVVFDAIDQCRTGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPV  519
            L + LT KF  F A+ +   G  +  L  F  + IP   K  G  ++S  S  FAVS  V
Sbjct  137  LGDYLTAKFPTFRALAEVLNGASWKPLLLFQLSSIPNVVKCYGLAITSVSSWRFAVSSAV  196

Query  520  SSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQAEAKQILKTKSG  564
               L  +   AN  +      +DIA++     +  + +++    G
Sbjct  197  GG-LPHAVLWANIGDQA----SDIASIVSGQSELSSGRLMMLVGG  236

>PYVX_21776
Length=203

 Score = 32.7 bits (73),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 31/52 (60%), Gaps = 1/52 (2%)

Query  348  VFDRVQEWL-DSRFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHF  398
             F++++EWL D + +VG D+VLA+VG+     +    +   ++ DQ+ A  F
Sbjct  103  TFEKIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQFADQIGALVF  154

>PHYKE_5458
Length=438

 Score = 33.1 bits (74),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/81 (21%), Positives = 42/81 (52%), Gaps = 8/81 (10%)

Query  628  LQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISIRHGTYAIVSSAVYDWL  687
            + L+ T   GPY+++ +Q         +D+++  ++A  D+I I+     +   +++D +
Sbjct  34   IALLKTYGLGPYSRVIKQ--------VEDDIKKAQKAVNDLIGIKESDTGLSLPSLWDLV  85

Query  688  TDQQRKGEQYFIDVNLYVKVL  708
            +D+Q   E+  + V    K++
Sbjct  86   SDKQMMQEEQPLQVARCTKII  106

Lambda      K        H        a         alpha
   0.317    0.132    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 64282772790

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40