Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_177621475634834817220.0
PYAR_135701475632231610127e-137
PYU1_G001735147563423479592e-128
PYIR_13451147563593639445e-126
PHYSO_471523147563483569105e-121
PHYCA_556162147563513568976e-119
PPTG_17127147563513598907e-118
PITG_18456147563513578732e-115
PHYRA_81100147563493568691e-114
PYIW_19971147563483528638e-114
PHALS_06478147563453638481e-111
PYVX_18171147562943207492e-97
PHYKE_8393147563263567132e-91
CCA18899147563433196786e-86
CCI45123147563012965425e-66
SPRG_06336147563353264751e-55
SDRG_01781147563353384611e-53
H257_06294147563583444151e-46
H310_09223147563333254019e-45
CCI451271609872021952618e-26
PYU1_G0063471612810951011341e-07
PYIW_17381161289521151323e-07
PHYRA_849161612815411091297e-07
HYAP_086451612815141131297e-07
PYIR_183821526711541251271e-06
PHYSO_3617471612815231101271e-06
CCA180231526711381901262e-06
PYU1_G008848152677651181252e-06
PPTG_18898161281559881252e-06
PITG_20562161281559881243e-06
PYIW_16987152678211251233e-06
PYAR_23286161286071151233e-06
PYIR_215891612815681151234e-06
CCI462351526711551391234e-06
PHYKE_247914459171541148e-06
PYVX_204381612813461121208e-06
PYAR_154631526710911121191e-05
PYVX_1357414459950541191e-05
PHYRA_825431526711991171191e-05
PYIR_13168288513531751191e-05
SDRG_1276312510913171321181e-05
PYVX_133121526710161081182e-05
SDRG_127621612813921131182e-05
PHALS_0653314459930541172e-05
PHYKE_19901612814991091172e-05
PHYSO_5445981526711631081172e-05
SPRG_0605912510913121271172e-05
H310_0023012510912481271172e-05
H310_002311612814951291172e-05
CCI10489158709777911162e-05
PPTG_193711526711951081172e-05
PYAP_186361526710091121162e-05
SPRG_060581612812581271163e-05
PPTG_1340114459927541163e-05
PHYRA_7783414459936541163e-05
PITG_1806714459924541163e-05
PITG_113039318293441133e-05
H310_04843152679681081153e-05
H310_0637814459837761154e-05
PYAP_16734819513141101154e-05
PHYCA_503112152926214541104e-05
H257_03093152679751081145e-05
PYU1_G00106314459783541145e-05
PHYKE_56782417809691135e-05
PITG_192131526712011081136e-05
PYIW_1317214459939541127e-05
PYIR_1530914459937541128e-05
H257_033611234286991151118e-05
H257_067221612814821291129e-05
H257_0672112510912381481119e-05
PYAP_1729014459835541111e-04
CCA18875161281514971111e-04
H257_1356714459836761111e-04
PHYRA_792812417809691101e-04
SPRG_008891225189941331101e-04
CCI44752161281526411111e-04
PHYCA_5061372417810691101e-04
SPRG_060218195983991101e-04
PYIR_17453951126191121102e-04
SDRG_01407152678151081082e-04
SPRG_027521234288311101082e-04
PYAR_13491819510801091082e-04
SPRG_00890152678831081082e-04
SPRG_1702213189210769992e-04
PYAR_1991414459788391073e-04
SDRG_055678195980991073e-04
CCI4122514459981341064e-04
SDRG_144871234289641101064e-04
PHALS_036452417830691064e-04
PPTG_146301853398531054e-04
PHYKE_6662152677651381064e-04
CCA217152417782661055e-04
CCA21860155078782661055e-04
PHALS_04098152671183401055e-04
PHYSO_489872819512401101055e-04
HYAP_080262417798691055e-04
PYIW_17571819513301571056e-04
PYIW_184802417755371056e-04
PITG_021091853522531046e-04
PHYSO_3441122417813691046e-04
PPTG_055192417810691047e-04
PYVX_16095819511371351047e-04
SDRG_014081225189161111047e-04
PITG_027622417810691047e-04
CCA1648714459975591048e-04
PHYSO_4786111853522531020.001
HYAP_04457152671203581030.001
SDRG_08800144598811271020.001
PYAP_226462417815661020.001
SPRG_083462417797691020.001
PYIR_131202417814571010.001
CCI42457152926906341020.001
SPRG_05449144597231271010.001
PYAP_15732105383332051000.001
CCA17102152926884341010.002
SDRG_051502417787691010.002
PHYCA_5048011853398531000.002
H257_09028125545561431010.002
PYVX_183382417746371010.002
H310_1401992046831481000.002
PYAP_169971612810181151000.002
PYIR_16539819513461541000.002
PYU1_G00438624178371591000.002
SPRG_16312131322261170980.002
PITG_09930819512211101000.002
PYAR_198832417833651000.002
PHYRA_76931819512121101000.003
H310_07701241781169990.003
PPTG_1915381951219110990.003
PPTG_1462618501055121990.003
PYU1_G0095089576532888970.003
PYU1_G0092499511258053990.004
CCI458959511172155970.005
PHYRA_73430185339553960.005
PYIR_1511813479122280960.007
PHALS_0793013479120043960.008
H257_07514241781069950.008
PYVX_145276030126953960.008
H310_1244812554555142940.009
PHALS_06568185338853930.010
PYIW_2190185060913106940.013
PYIW_1891113479119634940.013
PYVX_2334914313924106930.015
PHYRA_73534696861210108930.016
HYAP_0930413479114434930.017
CCI4379313479111734920.018
PITG_1789314313747106920.019
CCA223673199885123920.022
SDRG_14486185330854900.022
HYAP_0223081951195110920.023
SPRG_02753185330954900.024
PHYKE_491118534637800.025
PYU1_G0007249278718942880.025
PYU1_G00263281951334107910.026
PYIW_20891185329153890.027
SDRG_0213521944306145900.027
CCA2551013479113934910.027
PHYRA_7353514313875106910.028
PHYSO_3436291445997723910.029
PYU1_G01227415835873139900.032
PYIR_2458885060909106900.033
PYIR_13555185335553890.034
PYAP_13695185334853890.036
PPTG_1898913479121334900.039
PYAR_186909511245578900.044
PHALS_0809781951069130890.047
CCA2689061471530110890.047
HYAP_1368818501036107890.048
CCA19097185668849890.048
HYAP_06101288598442890.049
H257_100638195104144890.052
H310_029338195105344890.052
PYAP_2347885060897107890.052
PHYCA_1207051531368170890.052
PHYRA_8194413479114934890.053
PPTG_0455314313904118880.054
H257_013088632897172880.057
CCI47145185339053870.058
CCI3936728852046108880.059
CCA24531185337453870.064
H310_048421395771081174880.066
H257_1180213252783140870.071
HYAP_137571151726230860.074
PHYRA_830719511230055880.077
H310_0091295112182113880.078
PYAP_162979511246677870.085
PHYSO_55616414313765106870.090
SPRG_0491212454426152850.095
H310_01921185334163850.095
SDRG_0215412656882254850.12
PYVX_1308413479126734860.13
PHYSO_5299319511221155860.13
PHYKE_1148144433975840.14
PHYRA_944092885127042850.15
PITG_033182885134342850.16
CCA1551328851341160850.16
PHYSO_2484812885128342850.16
SDRG_00080124544298116830.16
PPTG_160442885137842850.16
H310_066668632887153840.17
SDRG_05128126310512114840.18
PYU1_G0033669204648112840.18
HYAP_1171212554558124840.18
PYU1_G0032291681047840.20
PHYRA_789209196453220830.20
CCI409912417801169840.21
PHALS_092733199663132830.22
SPRG_08326126310501114830.22
PHYRA_73985144433975820.23
PYIW_219442885131742830.26
SPRG_0883412656882554830.27
SDRG_1477112554549128820.27
PYU1_G012870185335253820.27
PITG_115789511213155830.28
PPTG_117149511244455830.30
H257_101513199624111820.30
PHALS_125031151734030810.32
PYU1_G01285918501183140820.35
SPRG_01283122724291108800.36
PYIR_144941681934820.37
H257_140254927243106800.38
SPRG_091281431362049810.40
SPRG_01654640392352810.42
PHALS_055872885136140810.42
PYIW_211089511259354810.43
H257_03363185331663800.43
PYIW_22403640673121810.44
H310_1362714313678114810.44
SPRG_0921112554549128800.46
PYAR_192918506071142810.47
CCA27255157810112567810.49
PYAP_22195863290144810.50
SDRG_03175640393452800.52
PYAP_166589576529434790.53
PYAP_1956011517337114790.55
PYIR_226673199749114800.55
PHALS_0669914313884106800.56
H310_070709639680105800.59
SDRG_142861431367038800.60
PITG_0210618501015125800.61
PHYRA_7881516919120800.61
H310_13911770036952790.63
SDRG_08236863286444790.67
SPRG_087832194429186780.68
CCA190339511188355800.68
H257_039319639695105790.69
SPRG_01860863267444790.71
SDRG_11258122724279108780.72
H257_098231431365425790.73
PYVX_14287319965231790.73
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_17762

Length=348
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAP_17762                                                            667        0.0   
PYAR_13570                                                            394        7e-137
PYU1_G001735                                                          374        2e-128
PYIR_13451                                                            368        5e-126
PHYSO_471523                                                          355        5e-121
PHYCA_556162                                                          350        6e-119
PPTG_17127                                                            347        7e-118
PITG_18456                                                            340        2e-115
PHYRA_81100                                                           339        1e-114
PYIW_19971                                                            337        8e-114
PHALS_06478                                                           331        1e-111
PYVX_18171                                                            293        2e-97 
PHYKE_8393                                                            279        2e-91 
CCA18899                                                              265        6e-86 
CCI45123                                                              213        5e-66 
SPRG_06336                                                            187        1e-55 
SDRG_01781                                                            182        1e-53 
H257_06294                                                            164        1e-46 
H310_09223                                                            159        9e-45 
CCI45127                                                              105        8e-26 
PYU1_G006347                                                          56.2       1e-07 
PYIW_17381                                                            55.5       3e-07 
PHYRA_84916                                                           54.3       7e-07 
HYAP_08645                                                            54.3       7e-07 
PYIR_18382                                                            53.5       1e-06 
PHYSO_361747                                                          53.5       1e-06 
CCA18023                                                              53.1       2e-06 
PYU1_G008848                                                          52.8       2e-06 
PPTG_18898                                                            52.8       2e-06 
PITG_20562                                                            52.4       3e-06 
PYIW_16987                                                            52.0       3e-06 
PYAR_23286                                                            52.0       3e-06 
PYIR_21589                                                            52.0       4e-06 
CCI46235                                                              52.0       4e-06 
PHYKE_2479                                                            48.5       8e-06 
PYVX_20438                                                            50.8       8e-06 
PYAR_15463                                                            50.4       1e-05 
PYVX_13574                                                            50.4       1e-05 
PHYRA_82543                                                           50.4       1e-05 
PYIR_13168                                                            50.4       1e-05 
SDRG_12763                                                            50.1       1e-05 
PYVX_13312                                                            50.1       2e-05 
SDRG_12762                                                            50.1       2e-05 
PHALS_06533                                                           49.7       2e-05 
PHYKE_1990                                                            49.7       2e-05 
PHYSO_544598                                                          49.7       2e-05 
SPRG_06059                                                            49.7       2e-05 
H310_00230                                                            49.7       2e-05 
H310_00231                                                            49.7       2e-05 
CCI10489                                                              49.3       2e-05 
PPTG_19371                                                            49.7       2e-05 
PYAP_18636                                                            49.3       2e-05 
SPRG_06058                                                            49.3       3e-05 
PPTG_13401                                                            49.3       3e-05 
PHYRA_77834                                                           49.3       3e-05 
PITG_18067                                                            49.3       3e-05 
PITG_11303                                                            48.1       3e-05 
H310_04843                                                            48.9       3e-05 
H310_06378                                                            48.9       4e-05 
PYAP_16734                                                            48.9       4e-05 
PHYCA_503112                                                          47.0       4e-05 
H257_03093                                                            48.5       5e-05 
PYU1_G001063                                                          48.5       5e-05 
PHYKE_5678                                                            48.1       5e-05 
PITG_19213                                                            48.1       6e-05 
PYIW_13172                                                            47.8       7e-05 
PYIR_15309                                                            47.8       8e-05 
H257_03361                                                            47.4       8e-05 
H257_06722                                                            47.8       9e-05 
H257_06721                                                            47.4       9e-05 
PYAP_17290                                                            47.4       1e-04 
CCA18875                                                              47.4       1e-04 
H257_13567                                                            47.4       1e-04 
PHYRA_79281                                                           47.0       1e-04 
SPRG_00889                                                            47.0       1e-04 
CCI44752                                                              47.4       1e-04 
PHYCA_506137                                                          47.0       1e-04 
SPRG_06021                                                            47.0       1e-04 
PYIR_17453                                                            47.0       2e-04 
SDRG_01407                                                            46.2       2e-04 
SPRG_02752                                                            46.2       2e-04 
PYAR_13491                                                            46.2       2e-04 
SPRG_00890                                                            46.2       2e-04 
SPRG_17022                                                            42.7       2e-04 
PYAR_19914                                                            45.8       3e-04 
SDRG_05567                                                            45.8       3e-04 
CCI41225                                                              45.4       4e-04 
SDRG_14487                                                            45.4       4e-04 
PHALS_03645                                                           45.4       4e-04 
PPTG_14630                                                            45.1       4e-04 
PHYKE_6662                                                            45.4       4e-04 
CCA21715                                                              45.1       5e-04 
CCA21860                                                              45.1       5e-04 
PHALS_04098                                                           45.1       5e-04 
PHYSO_489872                                                          45.1       5e-04 
HYAP_08026                                                            45.1       5e-04 
PYIW_17571                                                            45.1       6e-04 
PYIW_18480                                                            45.1       6e-04 
PITG_02109                                                            44.7       6e-04 
PHYSO_344112                                                          44.7       6e-04 
PPTG_05519                                                            44.7       7e-04 
PYVX_16095                                                            44.7       7e-04 
SDRG_01408                                                            44.7       7e-04 
PITG_02762                                                            44.7       7e-04 
CCA16487                                                              44.7       8e-04 
PHYSO_478611                                                          43.9       0.001 
HYAP_04457                                                            44.3       0.001 
SDRG_08800                                                            43.9       0.001 
PYAP_22646                                                            43.9       0.001 
SPRG_08346                                                            43.9       0.001 
PYIR_13120                                                            43.5       0.001 
CCI42457                                                              43.9       0.001 
SPRG_05449                                                            43.5       0.001 
PYAP_15732                                                            43.1       0.001 
CCA17102                                                              43.5       0.002 
SDRG_05150                                                            43.5       0.002 
PHYCA_504801                                                          43.1       0.002 
H257_09028                                                            43.5       0.002 
PYVX_18338                                                            43.5       0.002 
H310_14019                                                            43.1       0.002 
PYAP_16997                                                            43.1       0.002 
PYIR_16539                                                            43.1       0.002 
PYU1_G004386                                                          43.1       0.002 
SPRG_16312                                                            42.4       0.002 
PITG_09930                                                            43.1       0.002 
PYAR_19883                                                            43.1       0.002 
PHYRA_76931                                                           43.1       0.003 
H310_07701                                                            42.7       0.003 
PPTG_19153                                                            42.7       0.003 
PPTG_14626                                                            42.7       0.003 
PYU1_G009508                                                          42.0       0.003 
PYU1_G009249                                                          42.7       0.004 
CCI45895                                                              42.0       0.005 
PHYRA_73430                                                           41.6       0.005 
PYIR_15118                                                            41.6       0.007 
PHALS_07930                                                           41.6       0.008 
H257_07514                                                            41.2       0.008 
PYVX_14527                                                            41.6       0.008 
H310_12448                                                            40.8       0.009 
PHALS_06568                                                           40.4       0.010 
PYIW_21901                                                            40.8       0.013 
PYIW_18911                                                            40.8       0.013 
PYVX_23349                                                            40.4       0.015 
PHYRA_73534                                                           40.4       0.016 
HYAP_09304                                                            40.4       0.017 
CCI43793                                                              40.0       0.018 
PITG_17893                                                            40.0       0.019 
CCA22367                                                              40.0       0.022 
SDRG_14486                                                            39.3       0.022 
HYAP_02230                                                            40.0       0.023 
SPRG_02753                                                            39.3       0.024 
PHYKE_4911                                                            35.4       0.025 
PYU1_G000724                                                          38.5       0.025 
PYU1_G002632                                                          39.7       0.026 
PYIW_20891                                                            38.9       0.027 
SDRG_02135                                                            39.3       0.027 
CCA25510                                                              39.7       0.027 
PHYRA_73535                                                           39.7       0.028 
PHYSO_343629                                                          39.7       0.029 
PYU1_G012274                                                          39.3       0.032 
PYIR_24588                                                            39.3       0.033 
PYIR_13555                                                            38.9       0.034 
PYAP_13695                                                            38.9       0.036 
PPTG_18989                                                            39.3       0.039 
PYAR_18690                                                            39.3       0.044 
PHALS_08097                                                           38.9       0.047 
CCA26890                                                              38.9       0.047 
HYAP_13688                                                            38.9       0.048 
CCA19097                                                              38.9       0.048 
HYAP_06101                                                            38.9       0.049 
H257_10063                                                            38.9       0.052 
H310_02933                                                            38.9       0.052 
PYAP_23478                                                            38.9       0.052 
PHYCA_12070                                                           38.9       0.052 
PHYRA_81944                                                           38.9       0.053 
PPTG_04553                                                            38.5       0.054 
H257_01308                                                            38.5       0.057 
CCI47145                                                              38.1       0.058 
CCI39367                                                              38.5       0.059 
CCA24531                                                              38.1       0.064 
H310_04842                                                            38.5       0.066 
H257_11802                                                            38.1       0.071 
HYAP_13757                                                            37.7       0.074 
PHYRA_83071                                                           38.5       0.077 
H310_00912                                                            38.5       0.078 
PYAP_16297                                                            38.1       0.085 
PHYSO_556164                                                          38.1       0.090 
SPRG_04912                                                            37.4       0.095 
H310_01921                                                            37.4       0.095 
SDRG_02154                                                            37.4       0.12  
PYVX_13084                                                            37.7       0.13  
PHYSO_529931                                                          37.7       0.13  
PHYKE_1148                                                            37.0       0.14  
PHYRA_94409                                                           37.4       0.15  
PITG_03318                                                            37.4       0.16  
CCA15513                                                              37.4       0.16  
PHYSO_248481                                                          37.4       0.16  
SDRG_00080                                                            36.6       0.16  
PPTG_16044                                                            37.4       0.16  
H310_06666                                                            37.0       0.17  
SDRG_05128                                                            37.0       0.18  
PYU1_G003366                                                          37.0       0.18  
HYAP_11712                                                            37.0       0.18  
PYU1_G003229                                                          37.0       0.20  
PHYRA_78920                                                           36.6       0.20  
CCI40991                                                              37.0       0.21  
PHALS_09273                                                           36.6       0.22  
SPRG_08326                                                            36.6       0.22  
PHYRA_73985                                                           36.2       0.23  
PYIW_21944                                                            36.6       0.26  
SPRG_08834                                                            36.6       0.27  
SDRG_14771                                                            36.2       0.27  
PYU1_G012870                                                          36.2       0.27  
PITG_11578                                                            36.6       0.28  
PPTG_11714                                                            36.6       0.30  
H257_10151                                                            36.2       0.30  
PHALS_12503                                                           35.8       0.32  
PYU1_G012859                                                          36.2       0.35  
SPRG_01283                                                            35.4       0.36  
PYIR_14494                                                            36.2       0.37  
H257_14025                                                            35.4       0.38  
SPRG_09128                                                            35.8       0.40  
SPRG_01654                                                            35.8       0.42  
PHALS_05587                                                           35.8       0.42  
PYIW_21108                                                            35.8       0.43  
H257_03363                                                            35.4       0.43  
PYIW_22403                                                            35.8       0.44  
H310_13627                                                            35.8       0.44  
SPRG_09211                                                            35.4       0.46  
PYAR_19291                                                            35.8       0.47  
CCA27255                                                              35.8       0.49  
PYAP_22195                                                            35.8       0.50  
SDRG_03175                                                            35.4       0.52  
PYAP_16658                                                            35.0       0.53  
PYAP_19560                                                            35.0       0.55  
PYIR_22667                                                            35.4       0.55  
PHALS_06699                                                           35.4       0.56  
H310_07070                                                            35.4       0.59  
SDRG_14286                                                            35.4       0.60  
PITG_02106                                                            35.4       0.61  
PHYRA_78815                                                           35.4       0.61  
H310_13911                                                            35.0       0.63  
SDRG_08236                                                            35.0       0.67  
SPRG_08783                                                            34.7       0.68  
CCA19033                                                              35.4       0.68  
H257_03931                                                            35.0       0.69  
SPRG_01860                                                            35.0       0.71  
SDRG_11258                                                            34.7       0.72  
H257_09823                                                            35.0       0.73  
PYVX_14287                                                            35.0       0.73  
SDRG_06288                                                            35.0       0.74  
H257_03095                                                            35.0       0.76  
PHALS_03540                                                           35.0       0.77  
PITG_14197                                                            34.7       0.78  
PHYRA_83696                                                           34.7       0.79  
PPTG_00804                                                            35.0       0.81  
PHYKE_7856                                                            34.7       0.82  
PHYRA_73432                                                           35.0       0.82  
PYU1_G007423                                                          35.0       0.83  
H310_01510                                                            35.0       0.85  
PYIW_14463                                                            34.3       0.86  
SPRG_00364                                                            34.3       0.89  
PYAP_22685                                                            35.0       0.89  
SPRG_14312                                                            34.7       0.90  
HYAP_13690                                                            34.7       0.90  
PHYCA_529660                                                          34.3       0.93  
PHYKE_4910                                                            34.3       0.93  
PPTG_19471                                                            34.3       0.93  
H257_05679                                                            34.3       0.97  
PHYSO_320361                                                          34.3       1.0   
PYU1_G011261                                                          34.7       1.0   
H257_06469                                                            32.0       1.0   
SDRG_05608                                                            32.7       1.0   
PPTG_06166                                                            34.7       1.1   
SDRG_03531                                                            33.9       1.1   
PYAR_24990                                                            33.5       1.1   
SPRG_11900                                                            34.3       1.2   
PYIW_23677                                                            32.3       1.2   
SDRG_07012                                                            33.9       1.2   
CCI42088                                                              34.3       1.2   
H257_00729                                                            32.7       1.2   
SPRG_13975                                                            33.9       1.2   
SPRG_02502                                                            32.7       1.3   
PPTG_18093                                                            34.3       1.3   
H310_14473                                                            34.3       1.3   
H310_01094                                                            32.3       1.4   
PHALS_06336                                                           33.9       1.5   
PYIW_20221                                                            33.9       1.5   
PHYCA_553561                                                          33.5       1.6   
CCA19118                                                              32.3       1.6   
PYAP_18434                                                            33.9       1.7   
H257_00263                                                            33.9       1.7   
PHYKE_8531                                                            33.5       1.7   
H310_05457                                                            33.5       1.7   
H257_16349                                                            33.5       1.7   
PHALS_06334                                                           33.9       1.7   
PYIR_25066                                                            33.5       1.8   
PYIR_23372                                                            33.9       1.8   
CCI43456                                                              32.3       1.8   
PYIW_24869                                                            33.5       1.8   
CCI39556                                                              33.9       1.8   
H310_06667                                                            33.9       1.9   
PITG_19979                                                            33.1       1.9   
CCA22329                                                              33.9       2.0   
PHALS_09729                                                           33.9       2.0   
H257_13346                                                            33.5       2.0   
PHYSO_484541                                                          33.9       2.0   
PITG_07572                                                            32.7       2.0   
SPRG_02939                                                            33.9       2.1   
PYU1_G014349                                                          33.5       2.1   
H310_12867                                                            33.5       2.1   
CCI10928                                                              33.5       2.1   
PYAP_16161                                                            33.5       2.2   
PITG_16799                                                            33.5       2.2   
PHYSO_355952                                                          33.1       2.3   
PHYKE_8689                                                            33.5       2.3   
PYIR_13387                                                            33.5       2.3   
H257_02642                                                            33.5       2.3   
PITG_14718                                                            33.1       2.3   
PYU1_G001268                                                          33.1       2.4   
PYU1_G005578                                                          33.1       2.4   
PHYCA_511620                                                          32.7       2.4   
PYAR_14615                                                            33.1       2.4   
CCA24252                                                              33.1       2.4   
PYU1_G007013                                                          33.5       2.5   
CCI44114                                                              33.1       2.5   
SDRG_00756                                                            33.5       2.5   
PHYKE_38                                                              32.7       2.6   
PHYRA_79406                                                           32.7       2.6   
H257_03761                                                            33.1       2.6   
PPTG_16659                                                            33.1       2.7   
PITG_00020                                                            33.1       2.7   
HYAP_07348                                                            33.1       2.7   
SPRG_14955                                                            33.1       2.8   
SDRG_17208                                                            33.1       2.8   
SDRG_14070                                                            33.1       2.8   
PYAP_19753                                                            33.1       2.8   
PPTG_03644                                                            32.7       2.9   
SPRG_05843                                                            33.1       2.9   
SDRG_01838                                                            33.1       3.0   
PYIR_20397                                                            33.1       3.0   
PYU1_G012858                                                          32.7       3.1   
PHYKE_10014                                                           33.1       3.1   
SPRG_06273                                                            33.1       3.1   
PYVX_13261                                                            33.1       3.2   
PHYSO_350197                                                          33.1       3.2   
PHYSO_349983                                                          33.1       3.2   
PYIW_18491                                                            33.1       3.3   
PHYRA_80100                                                           32.3       3.3   
PITG_06114                                                            33.1       3.4   
PYAR_22485                                                            32.7       3.4   
PYAR_24323                                                            33.1       3.4   
PYAP_14828                                                            32.7       3.4   
PITG_13545                                                            32.7       3.5   
H257_08182                                                            32.7       3.5   
PHYCA_509385                                                          32.7       3.6   
PITG_09298                                                            32.3       3.7   
SDRG_06342                                                            32.7       3.7   
SPRG_08532                                                            32.7       3.8   
PYAP_14424                                                            32.7       3.8   
PHYKE_4241                                                            32.7       3.9   
PYVX_14851                                                            32.0       3.9   
HYAP_11295                                                            32.7       4.0   
PHALS_12874                                                           32.3       4.1   
HYAP_11689                                                            32.3       4.3   
PYVX_22150                                                            32.3       4.4   
PYVX_22673                                                            32.7       4.5   
PHALS_06636                                                           32.7       4.5   
PYU1_G009578                                                          32.3       4.8   
HYAP_00921                                                            32.3       4.8   
H310_00209                                                            32.3       4.8   
PHYKE_1044                                                            32.3       4.9   
PPTG_07800                                                            31.2       4.9   
CCI42711                                                              32.3       5.1   
PHYCA_539981                                                          32.3       5.2   
H257_11786                                                            32.3       5.6   
CCI43715                                                              32.0       5.6   
PHYSO_561742                                                          32.3       5.7   
CCI41909                                                              32.0       5.8   
PHYSO_558498                                                          32.3       5.8   
H257_03521                                                            32.0       5.9   
H257_06698                                                            32.3       5.9   
PITG_10462                                                            32.3       6.0   
PYAR_15792                                                            30.4       6.0   
PPTG_08785                                                            32.3       6.1   
CCA17621                                                              32.3       6.2   
PHYCA_564296                                                          32.0       6.4   
PPTG_13492                                                            32.0       6.4   
PYAR_21583                                                            31.6       6.4   
PHYSO_538430                                                          32.0       6.7   
HYAP_11713                                                            32.0       6.7   
H310_06449                                                            32.0       6.7   
PHYKE_9146                                                            32.0       6.7   
PYU1_G000461                                                          31.6       6.9   
PYVX_14593                                                            32.0       7.1   
SPRG_15871                                                            30.0       7.1   
PYAP_17800                                                            32.0       7.2   
SDRG_07086                                                            32.0       7.3   
SPRG_20946                                                            32.0       7.4   
PHYRA_82040                                                           32.0       7.4   
PHYRA_84786                                                           32.0       7.7   
SPRG_11532                                                            31.6       7.9   
PPTG_08670                                                            31.2       8.2   
SPRG_03722                                                            32.0       8.2   
SDRG_07081                                                            31.6       8.4   
HYAP_08248                                                            31.6       8.5   
SDRG_15262                                                            31.6       8.5   
PYVX_16714                                                            31.6       8.7   
PHYSO_485120                                                          30.0       8.8   
H257_16221                                                            31.6       8.9   
PHYRA_85457                                                           31.6       9.0   
PYIR_21948                                                            31.6       9.1   
H310_02133                                                            31.6       9.1   
PYIW_13442                                                            31.6       9.2   
PYU1_G006732                                                          31.6       9.5   
PHALS_12261                                                           30.8       9.7   

>PYAP_17762
Length=348

 Score = 667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/348 (100%), Positives = 348/348 (100%), Gaps = 0/348 (0%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILRLPLGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLV
Sbjct  1    MNILRLPLGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60

Query  61   SYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDI  120
            SYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDI
Sbjct  61   SYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDI  120

Query  121  FVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKE  180
            FVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKE
Sbjct  121  FVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKE  180

Query  181  QMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL  240
            QMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL
Sbjct  181  QMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL  240

Query  241  HMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLG  300
            HMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLG
Sbjct  241  HMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLG  300

Query  301  ELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIAHA  348
            ELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIAHA
Sbjct  301  ELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIAHA  348

>PYAR_13570
Length=322

 Score = 394 bits (1012),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 206/316 (65%), Positives = 249/316 (79%), Gaps = 17/316 (5%)

Query  45   SWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGF  104
            SWRVR+LVLNGADL VSY+DSK+VART GA PKGSFYLSSVEKHEY VGVLGAQ+KPFGF
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67

Query  105  KMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSP  164
            KMVGHAPRKGYVELDIFVE+ GDL KWLEVCQ+AL AAKKLTR+G  +A + KSLFGFSP
Sbjct  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127

Query  165  ATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQG---------------E  209
            ATSPQ+Q++K++A+KE++LKQAI+EIESAKL+GR ACQEI +QG               E
Sbjct  128  ATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAE  187

Query  210  RLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVS  269
            +LDHI  EL  V+ DLDY DKLL H+K+P L++FSSDARD+   +    P  +   SA+S
Sbjct  188  KLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSP-VKSKQSALS  246

Query  270  EETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAH  329
               RA  L    +   G  +SD+ERLA LLGELE QATLLNEEA++GT QVERVG+ LAH
Sbjct  247  SAARADALGQGVERASG-EMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDALAH  305

Query  330  VNERVKAQTRKANASI  345
            +NERV+ QT+KA++++
Sbjct  306  INERVQNQTKKADSAV  321

>PYU1_G001735
Length=342

 Score = 374 bits (959),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 249/347 (72%), Gaps = 13/347 (4%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            + S     KPTSCEGYVTKRGHFRKSWRVR+LV NGADL V
Sbjct  1    MNILRVP--------DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQV  52

Query  61   SYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDI  120
            SY++S++ A   G VPKGSFY+SSVEKHEY++GV+G +EKPFGFK+VGHAP KGY+ELDI
Sbjct  53   SYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDI  112

Query  121  FVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKE  180
            FVE+L D+NKWLEV QNALDAAKKLTR G  +  + KS+FGF  + SPQ Q+KK+ ATKE
Sbjct  113  FVESLPDVNKWLEVVQNALDAAKKLTRKGMTD--STKSMFGFGASISPQLQVKKLAATKE  170

Query  181  QMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL  240
            ++L++A+ EIE AKLIGR A  EI  QGE+LD +  +L HVEGDLD+ADKLLRH+K+P L
Sbjct  171  ELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVL  230

Query  241  HMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAV--GGAPLSDIERLASL  298
            H+FS+D R + K       +S    ++ +    +      H  +  GG  L+D+E LA  
Sbjct  231  HVFSNDNRQK-KGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALA  289

Query  299  LGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345
            L ELE+QA L+N EA + T Q+ R+ E+L  VN+RV+ QT+KA A++
Sbjct  290  LSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATM  336

>PYIR_13451
Length=359

 Score = 368 bits (944),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 257/363 (71%), Gaps = 28/363 (8%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P    +    + S+       KPTSCEGYVTKRGHFRKSWRVR+LV NGA+L V
Sbjct  1    MNILRVP---DAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQV  57

Query  61   SYYDSKEVARTAGA-------VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRK  113
            +YY+S++ ++ + +       VPKGSFY+SSVEKHEY+VGV+G +EKPFGFK+VGHAP+K
Sbjct  58   AYYESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKK  117

Query  114  GYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQ-PEALAPKSLFGFSPATSPQQQM  172
            GY+ELDIFVE+LGDLNKW+EV QNALDAAKK +RTG   +    K++FGFS + SPQ Q+
Sbjct  118  GYIELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQV  177

Query  173  KKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLL  232
            KK+ ATKE +L+ A+ EIE AKLIGR A  EI +QGE+LD +  +L  VEGDLD+ADKLL
Sbjct  178  KKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLL  237

Query  233  RHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAA----------ILSDSHD  282
            RHMK P LH+FS D  +R K +  T  +S  T  A   +T             I    +D
Sbjct  238  RHMKRPMLHLFSGD--ERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRND  295

Query  283  AVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKAN  342
            A     LSD+E+LA  LGELE+QA L+N EA+K T Q+ RV ++L  VN+RV+ QT+KAN
Sbjct  296  A-----LSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKAN  350

Query  343  ASI  345
            A++
Sbjct  351  ATM  353

>PHYSO_471523
Length=348

 Score = 355 bits (910),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/356 (52%), Positives = 248/356 (70%), Gaps = 26/356 (7%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            +++     +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L V
Sbjct  1    MNILRVP---------EVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNV  51

Query  61   SYYDSKEVARTAG---AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117
            SYY+S+          + PKGSFYLSS+E HEY VGV+GA EKPFGFKMVGHAPRKGYVE
Sbjct  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVE  111

Query  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169
            LD+FVETL D NKWLEV +NAL A ++LTR    ++++P  K+LFGF+      P  SPQ
Sbjct  112  LDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQ  171

Query  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229
            +QM+ +T +++++L  A+ +IE+AK +GR AC EI  QGE+LD I Q+L+ ++ DLD+ D
Sbjct  172  KQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGD  231

Query  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPL  289
            KLLR +K+P LH+FS D+R +A        S   +P    +  R   L  + D++  A +
Sbjct  232  KLLRRLKSPTLHLFSDDSRPKASA------SKASSPQRSQQSGRPPRLPPAMDSINDAGV  285

Query  290  SDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345
            SD+ERLA  LGELE QA LLN EA +GT Q+ER+  QL++V  RV+ QT++A+A++
Sbjct  286  SDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAAL  341

>PHYCA_556162
Length=351

 Score = 350 bits (897),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 186/356 (52%), Positives = 248/356 (70%), Gaps = 23/356 (6%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            +++     +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L V
Sbjct  1    MNILRVP---------EVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV  51

Query  61   SYYDSKEVAR-TAG--AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117
            +YY+S+     T G  + PKGSFYLSS+E HEY VGV+GA  KPFGFKMVGHAP+KGYVE
Sbjct  52   TYYESRAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVE  111

Query  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169
            LD+FVET+GD NKWLEV +NAL A ++LTR    ++++P  K+LFGFS      PA SPQ
Sbjct  112  LDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQ  171

Query  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229
            +QM+ +T  K+ +L  A+ +IE+AK IGR AC EI IQGE+LD I Q+L+ ++ DLD+ D
Sbjct  172  KQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGD  231

Query  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPL  289
            KLLR +K+P LHMFS+D+R ++ ++ +     R   S  S  TR A  ++S    G    
Sbjct  232  KLLRRLKSPTLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGA---  288

Query  290  SDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345
            SD+ERLA  LGELE QA LLN+EA   T Q++ +   L+ V  RV+ QT++A+A++
Sbjct  289  SDLERLAQALGELELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATL  344

>PPTG_17127
Length=351

 Score = 347 bits (890),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 250/359 (70%), Gaps = 27/359 (8%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            +++     +PTSCEGYVTKRGHFRKSWRVRFLV++G++L V
Sbjct  1    MNILRVP---------EHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51

Query  61   SYYDSKEVARTAG---AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117
            SYY+S+          + PKGSFYLSS+E HEY VGV+GA +KPFGFKMVGHAP+KGYVE
Sbjct  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111

Query  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169
            LD+FV+TL D NKWLEV +NAL   ++LTR    ++++P  K+LFGFS      PA SPQ
Sbjct  112  LDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQ  171

Query  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229
            +QM+ +  +K+++L +A+ E+E+AKL+GR AC EI IQGE+LD I Q+L+ ++ DLD+ D
Sbjct  172  KQMQTLAKSKDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGD  231

Query  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSS--RDTPSAVSEETRAAILSDSHDAVGGA  287
            KLLR +K+P LH+FS D+  R K+TG +K SS  R   S  S  +R     D+    GG 
Sbjct  232  KLLRRLKSPTLHLFSDDS--RPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGG-  288

Query  288  PLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIA  346
              SD+ERLA  LGELE QA +LN EA   + Q+ER+   L +V  RV+ QT++A+A+++
Sbjct  289  --SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLS  345

>PITG_18456
Length=351

 Score = 340 bits (873),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 249/357 (70%), Gaps = 23/357 (6%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            +++     +PTSCEGYVTKRGHFRKSWRVRFLV++G++L V
Sbjct  1    MNILRVP---------EHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51

Query  61   SYYDSKEVARTA---GAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117
            SYY+S+          + PKG FYLSS+E HEY VGV+GA +KPFGFKMVGHAP+KGYVE
Sbjct  52   SYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111

Query  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169
            LD+FV+TL D NKWLEV +NAL A ++LTR    ++++P  K+LFGFS      PA SPQ
Sbjct  112  LDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQ  171

Query  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229
            +Q++ ++ +K+++L QA+ E+E+AKL+GR AC EI +QGE+LD I Q+L+ ++ DLD+ D
Sbjct  172  KQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGD  231

Query  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPL  289
            KLLR +K+P LH+FS D+R ++  + +     R   S  S  TR   L  + +    A +
Sbjct  232  KLLRRLKSPTLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTR---LPPALEISSDAGV  288

Query  290  SDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIA  346
            SD+ERLA  LGELE QA LLN EA + + Q+ER+   L +V  RV+ QT++A+A+++
Sbjct  289  SDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLS  345

>PHYRA_81100
Length=349

 Score = 339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 244/356 (69%), Gaps = 25/356 (7%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            +++     +PTSCEGYVTKRGHFRKSWRVRFLVL G++L +
Sbjct  1    MNILRVP---------EIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQI  51

Query  61   SYYDSKEVARTAGA---VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117
            SYY+S+       A    PKGSFYLSS+E HEY VGV+GA  KPFGFKM+GHAP+KGYVE
Sbjct  52   SYYESRAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVE  111

Query  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169
            LD+FVET GD NKWLEV +NAL A ++LTR    ++++   K+LFGF       P  +PQ
Sbjct  112  LDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQ  171

Query  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229
            +QM+ +T  K+++L  A+ +IE+AKL+GR AC EI IQGE+LD I Q+L  ++ DLD+ D
Sbjct  172  KQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGD  231

Query  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPL  289
            KLLR +K+P LH+FS D+  R K+T     S + +  +    +R   L  + + +  A +
Sbjct  232  KLLRRLKSPTLHLFSDDS--RPKSTASKGHSPQRSQQSGGSPSR---LPPAMETINDAGV  286

Query  290  SDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345
            SD+ERLA  LGELE QA +LN EA + T Q+ERV  QL++V  RV+ QT++A+A++
Sbjct  287  SDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATL  342

>PYIW_19971
Length=348

 Score = 337 bits (863),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 234/352 (66%), Gaps = 17/352 (5%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P        +  S  S     K TSCEGYVTKRGHFRKSWRVR+LV N      
Sbjct  1    MNILRVP-----DMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFN-----G  50

Query  61   SYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDI  120
            +   +      + A PKGSF++SSVEKHEY+VGV+G +EKPFGFK+VGHAP+KGY+ELDI
Sbjct  51   ADLQAAGGGGASPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110

Query  121  FVETLGDLNKWLEVCQNALDAAKKLTRT-GQPEALAPKSLFGFSPATSPQQQMKKMTATK  179
            FVETLGDLNKW+EV QNALDAAKK TRT G  ++   K++FGFS   SPQ Q+KK+ ATK
Sbjct  111  FVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATK  170

Query  180  EQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPG  239
            E++L+ A+ EIE AKLIGR A  +I  QG +L+ I  +L  VE DLD+  KLL HMK P 
Sbjct  171  EELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPM  230

Query  240  LHMFSSDARDR------AKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSDIE  293
            LH+FS+D R +        ++      S   PS+       A  +  H     + +SD+E
Sbjct  231  LHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLE  290

Query  294  RLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345
            RL   LGELE+QAT +N EA+K T Q+ RV ++L  VN+RV+AQT+KA A++
Sbjct  291  RLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATM  342

>PHALS_06478
Length=345

 Score = 331 bits (848),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 182/363 (50%), Positives = 241/363 (66%), Gaps = 41/363 (11%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILRLP            +++     +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L V
Sbjct  1    MNILRLP---------EPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV  51

Query  61   SYYDSKEVARTAGA---VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117
            +YY+S+           +PKGSFYLS++E HEY +GV+GA ++PFGFKMVGHAPRKG+VE
Sbjct  52   AYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVE  111

Query  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169
            LD+FVET  D NKWLEV  NAL A ++LTR    ++++P  K LFGFS      P  SPQ
Sbjct  112  LDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQ  171

Query  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229
            +QM+ +  +KE +L +A+ EIE+AKL+GR AC EI  QGE+LD I Q+L+ ++ DLD+ D
Sbjct  172  KQMQTLATSKEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGD  231

Query  230  KLLRHMKNPGLHMFSSDAR------DRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDA  283
            KLL  +K+P LH FS D R      D   ++G T P SR  P+   E TR          
Sbjct  232  KLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSP-SRLIPAI--EITR----------  278

Query  284  VGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANA  343
               A +SD++RLA  LGELE QA LLN E+   + Q+ER+   L+HV ERV+ QT++A A
Sbjct  279  --DAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVA  336

Query  344  SIA  346
            +++
Sbjct  337  TLS  339

>PYVX_18171
Length=294

 Score = 293 bits (749),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 202/320 (63%), Gaps = 52/320 (16%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGYVTKRGHFRKSWRVR+LVL+GADL V+Y++SK  A   GA  KG FYLSS++KH Y 
Sbjct  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK-TAFQNGAASKGEFYLSSIDKHAYV  72

Query  92   ---VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRT  148
               +G +GAQEKPFGFKMVGHAP+KGY ELDIFVETL DL KWLEV  NAL++A  ++R 
Sbjct  73   AGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMSRK  132

Query  149  GQPE---ALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIF  205
               +   +   KSLFGFS  TSPQQQ+K M+ +K+++LK A+ E+E AKLIGR AC E+ 
Sbjct  133  AAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREACTEMV  192

Query  206  IQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTP  265
            +QGE+LD I   L  +E DLDY DKLLR +K+P LH+ + D R         +P S    
Sbjct  193  VQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR---------RPPSPTKT  243

Query  266  SAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGE  325
             + + + RAA                          LEQ +          T Q+ R+ E
Sbjct  244  LSNAGDGRAA--------------------------LEQLS----------TQQIARIEE  267

Query  326  QLAHVNERVKAQTRKANASI  345
            +L  VN+RV+ QT++A + I
Sbjct  268  RLTTVNDRVQRQTKQATSGI  287

>PHYKE_8393
Length=326

 Score = 279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 215/356 (60%), Gaps = 46/356 (13%)

Query  1    MNILRLPLGatshptvtassssptspvkptsCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60
            MNILR+P            +++     +PTSCEGYVTKRGHF                  
Sbjct  1    MNILRVP---------EVGATASGDKARPTSCEGYVTKRGHF------------------  33

Query  61   SYYDSKEVARTAGAVP--KGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVEL  118
                        G  P  KGSFYLS++  HEY VGV+GA +KPFGFKMVGHAPRKGYVEL
Sbjct  34   ------PCHPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVEL  87

Query  119  DIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGF------SPATSPQQ  170
            D+FVETL D NKWLEV +NAL A +++ R    ++++P  K +FGF       P   PQ+
Sbjct  88   DVFVETLSDRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQK  147

Query  171  QMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADK  230
            Q++ +T  KE++L +A+ E+E+AK++GR AC EI +QGE+LD +  +L  ++ DLD+ DK
Sbjct  148  QIQALTHNKEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDK  207

Query  231  LLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLS  290
            LLR +KNP LH+FS D R ++          R   SA S       L  S  +   A  S
Sbjct  208  LLRRLKNPTLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIH---LPFSMGSANDADAS  264

Query  291  DIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIA  346
            D+ERLA  LGELE QA LLN EA + T Q+ R+ +QL++V  RV+ QT++A+A+++
Sbjct  265  DLERLAHALGELELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLS  320

>CCA18899
Length=343

 Score = 265 bits (678),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/319 (42%), Positives = 206/319 (65%), Gaps = 6/319 (2%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGYVTKRGHFRKSWRVR+LV++G ++ VSYY+SK+ +++  A PKGSF L S EKHEY+
Sbjct  18   CEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQSAEKHEYW  77

Query  92   VGVL---GAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRT  148
            +  +     +EKPFGFKMVGHAP++GY+ELD+FV++  D+++WL+V  N L A+K + R 
Sbjct  78   ISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCMARE  137

Query  149  G-QPEALAPKSLFGFS-PATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFI  206
                E    KS+ GFS   T+ +QQ++ + + K   + +A+++IE AK  G +AC EI  
Sbjct  138  AFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAACDEIVS  197

Query  207  QGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFS-SDARDRAKNTGRTKPSSRDTP  265
            QGE+L  + Q L+ ++ DL++++KL++ +++P  + FS S   DRA  +  +        
Sbjct  198  QGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATISKSSSIHRSHHH  257

Query  266  SAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGE  325
              +  +T+     D        P +DIE+LA  L +LE QA L+N EA+K   Q+ R+  
Sbjct  258  PGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEG  317

Query  326  QLAHVNERVKAQTRKANAS  344
            QL+ +N+R++AQT +   S
Sbjct  318  QLSGINDRIQAQTSQVITS  336

>CCI45123
Length=301

 Score = 213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 184/296 (62%), Gaps = 11/296 (4%)

Query  58   LLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG--VLGA-QEKPFGFKMVGHAPRKG  114
            + VSYY+SK+  +   A PKGSF L +VEKHEY++   V G+ +E+PFGFKMVGHAP++G
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  115  YVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG-QPEALAPKSLFGFSPA-TSPQQQM  172
            YVELD+FV++L ++++WL+V  N L A K++ R     E    K + GFS A T+ +QQ+
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120

Query  173  KKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLL  232
            K++ + K   + +A+++IE AK  G +AC EI  QGE+L  + Q L+++E DL++++KL+
Sbjct  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180

Query  233  RHMKNPGLHMFSSDARDR----AKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAP  288
            + +++P  + FS          +KN    +     T      +    I   + +     P
Sbjct  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEIC--VP  238

Query  289  LSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANAS  344
             +D+E+LA  L ELE QA L+N EA+K   Q+ R+  QL+ +N+R+++QT +  AS
Sbjct  239  TNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS  294

>SPRG_06336
Length=335

 Score = 187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/326 (36%), Positives = 180/326 (55%), Gaps = 24/326 (7%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGYVTKRGH  KSWR R++VL+G  L VSYYDSK + ++     KGSF L+ +EKH+Y 
Sbjct  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY-  71

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
                G   KP+GFK+VGHAP  GY E  ++VET  D  +WLEV  NAL   K +T     
Sbjct  72   -SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTPQASV  128

Query  152  EALAPKSLFGFSPA---TSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQG  208
            +  A   L   +P+   TS   Q++ +  TKE++L++AI  +E A+ +G +   E+    
Sbjct  129  DQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNA  188

Query  209  ERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAV  268
            E LD     + +VE +LD  D +++ M +P  + FSS     +K  G   P S+   SA 
Sbjct  189  EMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSK---SKKKGTGSPKSK---SAR  242

Query  269  SEETRAAILSDSH-------DAVGGAPL----SDIERLASLLGELEQQATLLNEEAIKGT  317
            S + +  + S +H          GGA       ++++L+ +L  LE  A  ++ E  + T
Sbjct  243  SHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVERTT  302

Query  318  AQVERVGEQLAHVNERVKAQTRKANA  343
             Q++R+ +++   +ER+  Q+ K +A
Sbjct  303  EQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 114/338 (34%), Positives = 176/338 (52%), Gaps = 48/338 (14%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGYVTKRGH  KSWR R++VL+G  L VSY+DSK + ++     KGSF L+ +EKH+Y 
Sbjct  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY-  71

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
                G   KP+GFK+VGHAP  GY E  ++VET  D  +WLEV  NAL       +   P
Sbjct  72   -SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG------KNVAP  124

Query  152  EALAPK---SLFGFSPA----TSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEI  204
            +A A +   +L G   A    TS   Q++ +  TKE++L++AI  +E A+ +G +   E+
Sbjct  125  QASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM  184

Query  205  FIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMF--------------SSDARDR  250
                E LD     + +V  +LD  D +++ M +P  + F              S  AR  
Sbjct  185  GHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARSH  244

Query  251  AKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSD-----IERLASLLGELEQQ  305
               T    P+++  PS  + +T             G P +D     +++L+ +L  LE  
Sbjct  245  LPQTPMNSPTNK-KPSGPTSKT-------------GGPTTDAGDDELDQLSKILASLEVH  290

Query  306  ATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANA  343
            A  ++ E  + T Q++R+ +++   +ERV  Q+ K +A
Sbjct  291  ANTISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H257_06294
Length=358

 Score = 164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 109/344 (32%), Positives = 175/344 (51%), Gaps = 33/344 (10%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGYVTKRGH  KSW+ R++VLNG  LLVSYYDSKE+  + G  PKGSF LS  EK +  
Sbjct  13   CEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLSECEKQD--  69

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL--DAAKKLTRTG  149
            +   GA  KPFGFK +GH P +GY E  ++VE+  D  KWL V  NAL  +++ + + + 
Sbjct  70   LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSSPQKSMSQ  129

Query  150  QPEAL-------------APK------SLFGFSPATSPQQ----QMKKMTATKEQMLKQA  186
            + E +              P+      +  G   +    Q    QMK +  T +++L+QA
Sbjct  130  RIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELLQQA  189

Query  187  IEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL----HM  242
            I + + A  IG +   E+  Q + L+     +  +   +D+A+ L R +K+P L    H+
Sbjct  190  INDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILYKLTHL  249

Query  243  FSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSD-IERLASLLGE  301
            F+     +    G          S  S  +R  +           P  D +++L+ +L +
Sbjct  250  FTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQLDQLSKILAK  309

Query  302  LEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345
            L Q A  +++   + T QV+R+ +++  V++RVK + +   A +
Sbjct  310  LGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVL  353

>H310_09223
Length=333

 Score = 159 bits (401),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 164/325 (50%), Gaps = 32/325 (10%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGYVTKRGH  K+W+ R++VL+G  LLV+YYDSKE+ ++ G  PKGSF LS  EK +  
Sbjct  13   CEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGSFVLSECEKQD--  69

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
            +   G   KPFGFK +GH P +GY E  +FVET  D  KWL V  NAL    K T    P
Sbjct  70   LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG---KTTYIPSP  126

Query  152  E-----ALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFI  206
                      K   G     S + Q+K +  T  ++L+QAI + + A  IG +   E+  
Sbjct  127  SMESHGGAGHKESAGL--MISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAY  184

Query  207  QGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL----HMFSSDARDRAK--------NT  254
            Q E L+     +  +   +D A+ L + +K+P L    H+FS     R K          
Sbjct  185  QEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGASSKKRGG  244

Query  255  GRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAI  314
            G++  SSR  P  V  +          +         ++ L+ +L +L Q A  +++   
Sbjct  245  GKSTRSSR-VPRGVQVKLHPPQPQPKQEE------DQLDELSKILAKLGQTADTISDITT  297

Query  315  KGTAQVERVGEQLAHVNERVKAQTR  339
            + T QV+R+ +++  V+ERV  + +
Sbjct  298  RTTEQVDRIDQKVTSVDERVTKEAK  322

>CCI45127
Length=202

 Score = 105 bits (261),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 111/195 (57%), Gaps = 7/195 (4%)

Query  155  APKSLFGFSPA-TSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDH  213
              K + GFS A T+ +QQ+K++ + K   + +A+++IE AK  G +AC EI  QGE+L  
Sbjct  3    TTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGK  62

Query  214  IGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDR----AKNTGRTKPSSRDTPSAVS  269
            + Q L+++E DL++++KL++ +++P  + FS          +KN    +     T     
Sbjct  63   VEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHM  122

Query  270  EETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAH  329
             +    I   + +     P +D+E+LA  L ELE QA L+N EA+K   Q+ R+  QL+ 
Sbjct  123  RKNDGKIEHVAEEIC--VPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSG  180

Query  330  VNERVKAQTRKANAS  344
            +N+R+++QT +  AS
Sbjct  181  INDRIQSQTTQVVAS  195

>PYU1_G006347
Length=1095

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 15/101 (15%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G   L+SYY   ++A +A   P     +  V+K +  
Sbjct  395  CAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDLANSAKGKPLAEVAVEDVQKWD--  450

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWL  132
                    +PFGF  +       YV    + +   + NKW+
Sbjct  451  -------GEPFGFMFMTSEQVPYYV----YADNDRERNKWM  480

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEG++TKRGH   +W+ R+ VL G D+L  Y+  +E  +  G+V
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRG-DVL-EYFSGEEKNKKYGSV  241

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+T+RGH   S R+ + VLNGA L
Sbjct  295  CEGYLTRRGHLVPSQRMAYYVLNGASL  321

>PYIW_17381
Length=952

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 55/115 (48%), Gaps = 15/115 (13%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G   L++Y+   ++A +A   P     +  V+K +  
Sbjct  406  CAGYLTKQGHKRKSWKKRYFILRGN--LIAYFTDYDIANSAKGKPLAEVTVEDVQKWD--  461

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLT  146
                    +PFGF  +       YV    + +   + NKW+   +     A++ T
Sbjct  462  -------GEPFGFMFMTSEQVPYYV----YADNDRERNKWMNALRKLTTVAEEPT  505

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (64%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEG++TKRGH   +W+ R+ VL G   ++ Y+  ++  +  G+V
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGN--VLEYFSGEDKGKRYGSV  252

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+T+RGH   S R+ + VLNG  L
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSL  332

>PHYRA_84916
Length=1541

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 52/109 (48%), Gaps = 19/109 (17%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G    +SYY   ++A      P     +  V+K +  
Sbjct  405  CAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNTKGKPLAEVLVEDVQKWD--  460

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                    +PFGF  + +     YV    + +   + NKW+    NAL+
Sbjct  461  -------GEPFGFMFMTNEQVPYYV----YADNDRERNKWM----NALN  494

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 47/101 (47%), Gaps = 20/101 (20%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGY+TKRGH   +W+ R+  L G   ++ YY S+E ++  GAV        +VEK    
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGN--VLEYYSSEEKSKKYGAV--------TVEK----  255

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWL  132
            V     +   F F      P        ++  + G+ ++WL
Sbjct  256  VAPWSGEAHGFMFYTTKQIPYY------VYASSEGERSRWL  290

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+TKRGH   S R+ + VLNG  L
Sbjct  305  CEGYLTKRGHLVPSQRMAYYVLNGTSL  331

>HYAP_08645
Length=1514

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (48%), Gaps = 16/113 (14%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G   L+SYY   ++A      P     +  V+  +  
Sbjct  308  CAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDMANNTKGRPLAEVLVEDVQSWD--  363

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKK  144
                    +PFGF  + +     YV    + +   + NKW+    N L+A ++
Sbjct  364  -------GEPFGFMFMTNEQVPYYV----YADNDRERNKWMNAL-NKLNAVEE  404

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (64%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEGY+TKRGH   +W+ R+  L G   ++ YY  +E ++  GAV
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGN--VLEYYSGEEKSKKYGAV  154

 Score = 39.7 bits (91),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+TKRGH   S R+ + VLNG  L
Sbjct  208  CEGYLTKRGHLVPSQRMAYYVLNGTSL  234

>PYIR_18382
Length=1154

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 18/125 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++KE AR+A  + +G   +S V    Y  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL-RGRMIISKVRPENY--  183

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG---  149
                   K  GF +      KG+    +   T  + + W+E+ Q A+D   K +  G   
Sbjct  184  ------GKAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNGSSV  233

Query  150  QPEAL  154
             PE L
Sbjct  234  DPETL  238

>PHYSO_361747
Length=1523

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 16/110 (15%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G    +SYY   ++A  +   P     +  V+K +  
Sbjct  414  CAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLAEVLVEDVQKWD--  469

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDA  141
                    +PFGF  +       YV    + +   + NKW+    N L+A
Sbjct  470  -------GEPFGFMFMTTEQVPYYV----YADNDRERNKWMNAL-NKLNA  507

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 49/108 (45%), Gaps = 20/108 (19%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGY+TKRGH   +W+ R+  L G   ++ YY S+E ++  GAV        +VEK    
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGN--VLEYYSSEEKSKKYGAV--------TVEK----  264

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            V     +   F F      P        ++  +  + ++WL V +  +
Sbjct  265  VATWSGEAHGFMFYTTKQIP------YYVYASSESERSRWLRVLKEYM  306

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+TKRGH   S R+ + VLNG  L
Sbjct  314  CEGYLTKRGHLVPSQRMAYYVLNGTSL  340

>CCA18023
Length=1138

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 82/190 (43%), Gaps = 32/190 (17%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++KE AR+A  + +G   +  V    Y  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL-RGKMMIVKVRPENY--  179

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQ--  150
                   K  GF +      KG+    +   T  + + W+E+ Q A++ A   +      
Sbjct  180  ------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNASHS  229

Query  151  ----PEALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAK------LIGRSA  200
                  ++AP   F  SPAT  Q      +  +  +L Q   E+ S        LI  SA
Sbjct  230  FVSLHHSIAP---FDQSPATQSQPSGSDCSDPRTHLLVQV--ELRSFYVAFRKLLISHSA  284

Query  201  CQEIFIQGER  210
              + F +  R
Sbjct  285  SPQFFSKLSR  294

>PYU1_G008848
Length=765

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 15/118 (13%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++KE AR+A  + +G   +S V    Y  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL-RGRMIISKVRPENY--  188

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQ  150
                   K  GF +      KG+    +   T  + + W+E+ Q A+D   K +  G 
Sbjct  189  ------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNGN  236

>PPTG_18898
Length=1559

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 43/88 (49%), Gaps = 11/88 (13%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G    +SYY   ++A  A   P     +  V+K +  
Sbjct  408  CAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNAKGKPLAEVLVEDVQKWD--  463

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELD  119
                    +PFGF  + +     YV  D
Sbjct  464  -------GEPFGFMFMTNEQVPYYVYAD  484

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEGY+TKRGH   +W+ R+  L G   ++ YY S+E ++  GAV
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGN--VLEYYSSEEKSKKYGAV  254

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+TKRGH   S R+ + VLNG  L
Sbjct  308  CEGYLTKRGHLVPSQRMAYYVLNGTSL  334

>PITG_20562
Length=1559

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 43/88 (49%), Gaps = 11/88 (13%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G    +SYY   ++A  A   P     +  V+K +  
Sbjct  409  CAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNAKGKPLAEVLVEDVQKWD--  464

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELD  119
                    +PFGF  + +     YV  D
Sbjct  465  -------GEPFGFMFMTNEQVPYYVYAD  485

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEGY+TKRGH   +W+ R+  L G   ++ YY S+E ++  GAV
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGN--VLEYYSSEEKSKKYGAV  255

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+TKRGH   S R+ + VLNG  L
Sbjct  309  CEGYLTKRGHLVPSQRMAYYVLNGTSL  335

>PYIW_16987
Length=821

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 18/125 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++KE AR+A  + +G   +S V    Y  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL-RGRMIISKVRPENY--  174

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG---  149
                   K  GF +      KG+    +   T  + + W+E+ Q A+D     +  G   
Sbjct  175  ------GKAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVNHSANGTVV  224

Query  150  QPEAL  154
             PE L
Sbjct  225  DPETL  229

>PYAR_23286
Length=607

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ VL G+   VSYY   + A +    P     +  V++ +  
Sbjct  389  CSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIEDVQRWD--  444

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLT  146
                    +PFGF  +       YV    + +   +  KW+    NAL   +KLT
Sbjct  445  -------GEPFGFMFMTSEQIPYYV----YADNERERTKWM----NAL---RKLT  481

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 30/44 (68%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEG++TKRGH   +W++R+ VL G   ++ Y+  ++ ++  G+V
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGN--VLEYFAGEDKSKRYGSV  235

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+T+RGH   S R  + VLNG  L
Sbjct  289  CEGYLTRRGHLVPSQRHAYYVLNGTSL  315

>PYIR_21589
Length=1568

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 54/115 (47%), Gaps = 15/115 (13%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G   L++YY   ++A +A         +  V+K +  
Sbjct  406  CAGYLTKQGHKRKSWKKRYFILRGN--LIAYYPDYDLANSAKGRALAEVTVEDVQKWD--  461

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLT  146
                    +PFGF  +       YV    + +   + NKW+   +     A++ T
Sbjct  462  -------GEPFGFMFMTSEQVPYYV----YADNDRERNKWMNALRKLTTVAEEPT  505

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
            CEG++TKRGH   +W+ R+ VL G   ++ Y+  ++  +  G+V        S E H +
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGN--VLEYFAGEDKGKRYGSVTVAKVAPWSGEAHGF  267

 Score = 38.5 bits (88),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+T+RGH   S R+ + VLNG  L
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSL  332

>CCI46235
Length=1155

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 66/139 (47%), Gaps = 23/139 (17%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++KE AR+A  + +G   +  V    Y  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL-RGKMMIVKVRPENY--  174

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP-  151
                   K  GF +      KG+    +   T  + + W+E+ Q A++ A   + T    
Sbjct  175  ------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAVPFSNTTHSF  224

Query  152  ----EALAPKSLFGFSPAT  166
                 ++AP   F  SPAT
Sbjct  225  VSLHHSIAP---FEQSPAT  240

>PHYKE_2479
Length=171

 Score = 48.5 bits (114),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G   LVSYY++K  AR    + KG   ++SV+
Sbjct  76   EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHL-KGRVNVASVK  126

>PYVX_20438
Length=1346

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (51%), Gaps = 19/112 (17%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKG-SFYLSSVEKHEY  90
            C GY+TK+GH RKSW+ R+ +L G    +SY+   E+A +A    KG +    +VE  + 
Sbjct  319  CAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSA----KGKALAEVTVEDVQR  372

Query  91   YVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQ--NALD  140
            + G      +PFGF  +       YV    + +   + NKW+   +  NA+D
Sbjct  373  WDG------EPFGFMFMTSEQVPYYV----YADNDRERNKWMNALRKLNAVD  414

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
            CEGY+TKRGH   +W+ R+  L G   ++ Y+ S + ++  GAV        S E H +
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGN--VLEYFASDDKSKKYGAVTVAKVAPWSGEAHGF  179

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 1/35 (3%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSK  66
            CEGY+TKRGH   S R+ + VL G  +L  Y D +
Sbjct  219  CEGYLTKRGHLVPSQRMAYYVLTGT-MLRHYADQQ  252

>PYAR_15463
Length=1091

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 15/112 (13%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY+SKE AR+ G   +G   +S V    Y  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARS-GRNLRGRMIISKVRPENY--  132

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKK  144
                   K  GF +      KG+    +   T  + + W+E+ Q A+D   K
Sbjct  133  ------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAIDEGVK  174

>PYVX_13574
Length=950

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G   LVSYY+SK  AR    + KG   ++SV+
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYESKVDARNRSHL-KGRVNVASVK  209

>PHYRA_82543
Length=1199

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 59/117 (50%), Gaps = 15/117 (13%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+L+L+GA L  +YY+SKE AR+A  + +G   +S V    Y  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIISKVRPENY--  115

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG  149
                   K  GF +      +G+    +   T  + + W+E+ Q A++   + T++ 
Sbjct  116  ------GKAHGFLLET----QGHKHFHLCCATELEKDMWVEMMQAAIEEGVRHTQSS  162

>PYIR_13168
Length=1353

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 86/175 (49%), Gaps = 21/175 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++TK+GH  K+W+ RF VL  AD   +YY +K   +  G +      ++        +G
Sbjct  116  GWLTKQGHMWKTWKTRFFVLY-ADGTFAYYKNKGKKKMQGCLMLNDGIVTVKHVDVRKIG  174

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG-QPE  152
                  KP+ F++      KG+ +L  +  +  +   W+    +AL +A+K   T  + +
Sbjct  175  ------KPYVFQV-----EKGFYKLICYCCSQLEAELWV----SALRSARKTPPTCFEID  219

Query  153  ALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQ  207
              AP+   G S  T   +Q+ K+  T +Q + Q++E+ ++   I R+   +IFI+
Sbjct  220  LTAPEEKAGASAVT---RQLNKIFVTDKQ-IAQSVEDFKNTPAIHRAEDIQIFIE  270

>SDRG_12763
Length=1317

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 51/132 (39%), Gaps = 26/132 (20%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TKRGH   +W+ RF VL    +L  Y D   V +       G  +L  V   EY+
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMVKKL------GQVHLVKVAPWEYF  63

Query  92   VGVL---------GAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWL-------EVC  135
                         G+ E  FGF M     R  Y    ++     +  +WL        V 
Sbjct  64   SATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLYVVT  119

Query  136  QNALDAAKKLTR  147
             NA D    LT+
Sbjct  120  SNATDCEGYLTK  131

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 56/127 (44%), Gaps = 20/127 (16%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ VL GA L  SYY   +      ++ K S     VE    +
Sbjct  224  CAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDYD------SMNKQSLAEVGVEDVALW  275

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
             G      + FGF+ +       YV    F E+  +  KW+   Q  +       +   P
Sbjct  276  DG------EQFGFQFITTEQVPYYV----FAESDRERQKWMVALQTLIRNHGAPLQ--MP  323

Query  152  EALAPKS  158
              LAP S
Sbjct  324  TVLAPPS  330

>PYVX_13312
Length=1016

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 54/108 (50%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+L+L+GA L  +YY+SK+ AR+ G   +G   LS V    Y  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARS-GRNLRGRMQLSRVRPENY--  130

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                   K  GF +      +G+    +   T  + + W+E+ Q A+D
Sbjct  131  ------GKAHGFLIE----TRGHKSFHLCCTTELEKDMWVEMMQAAID  168

>SDRG_12762
Length=1392

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 16/113 (14%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGY+TKRGH   S+R+R+ V+ G+  +V YY  +   RT      G+  L+ +E     
Sbjct  258  CEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRT------GASALAEIEVKS--  307

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKK  144
             G    +     FK   ++       + +  E + DL KW+E      + A K
Sbjct  308  GGRWDGESTGLFFKTATNS------TMFVCAENVADLQKWIEALGRIFNEAPK  354

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 27/40 (68%), Gaps = 2/40 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVART  71
            C G++TK+GH RKSW+ R+ VL G   ++SY+   E A T
Sbjct  360  CAGWLTKQGHKRKSWKKRYFVLRGT--VLSYFADFEAANT  397

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            GY+TKRGH   +W+ RF  L     L SYY+ + + +  G V
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQGRL-SYYNDEGMGKKLGEV  204

>PHALS_06533
Length=930

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G   LVSYY++K  AR    + KG   ++SV+
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVEARNRSHL-KGRVNVASVK  161

>PHYKE_1990
Length=1499

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (48%), Gaps = 19/109 (17%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ +L G+   +SYY   ++A  +         +  V++ +  
Sbjct  406  CAGYLTKQGHKRKSWKKRYFILRGS--TISYYSDYDMANNSKGKALAEVLVEDVQRWD--  461

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                    +PFGF  +       YV    + +   + NKW+    NAL+
Sbjct  462  -------GEPFGFMFMTSEQVPYYV----YADNDRERNKWM----NALN  495

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEGY+TKRGH   +W+ R+  L G   ++ YY S+E ++  GAV
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGN--VLEYYSSEEKSKKYGAV  252

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+TKRGH   S R+ + VLNGA L
Sbjct  306  CEGYLTKRGHLVPSQRMAYYVLNGASL  332

>PHYSO_544598
Length=1163

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+L+L+GA L  +YY+SKE AR+A  + +G   +S V    Y  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIISKVRPENY--  73

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                   K  GF +      +G+    +   T  + + W+E+ Q A++
Sbjct  74   ------GKAHGFLLET----QGHKHFHLCCSTELEKDMWVEMMQAAIE  111

>SPRG_06059
Length=1312

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 53/127 (42%), Gaps = 16/127 (13%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSF----YLSSVEK  87
            C GY+TKRGH   +W+ RF VL    +L  YY  + +A+  G V         Y+S+   
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILC-YYADESMAKKLGQVHLVKVAPWEYVSATTA  70

Query  88   HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWL-------EVCQNALD  140
            +       G+ E  FGF M     R  Y    ++     +  KWL        V  NA D
Sbjct  71   NSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDLYVVTSNATD  126

Query  141  AAKKLTR  147
                LT+
Sbjct  127  CEGYLTK  133

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 56/132 (42%), Gaps = 30/132 (23%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ VL G  L  +YY   +      ++ K S     VE    +
Sbjct  226  CAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYADYD------SMNKQSLAEVGVEDVALW  277

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQ-  150
             G      + FGF+ +       YV    F E+  +  KW+   Q        L RT   
Sbjct  278  DG------EQFGFQFITTEQVPYYV----FAESDRERQKWMVALQT-------LVRTHSA  320

Query  151  ----PEALAPKS  158
                P  LAP S
Sbjct  321  PLHIPNVLAPPS  332

>H310_00230
Length=1248

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 55/127 (43%), Gaps = 20/127 (16%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ VL GA  L+SYY   E A        G      +E  + +
Sbjct  226  CAGYLTKQGHKRKSWKRRYFVLRGA--LLSYYTDYESANKQCLAEVG------IEDVQVW  277

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
             G +       GF          YV    + +T  +  KWL   +  LDA     R   P
Sbjct  278  DGEM------HGFMFTTTEQVMYYV----YADTERERQKWLVALKALLDAQSN--RAPTP  325

Query  152  EALAPKS  158
             A+ P S
Sbjct  326  LAMVPPS  332

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 6/59 (10%)

Query  32  CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
           C GY+TKRGH   +W++RF VL     L SYY+ + +++  G V     +L+ V   EY
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLRPHANL-SYYEDESMSKKLGQV-----HLAKVAPWEY  64

>H310_00231
Length=1495

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 56/129 (43%), Gaps = 18/129 (14%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++TK+GH RKSW+ R+ VL G  L  +YY   + +    + P G   +  V   +  
Sbjct  352  CAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASNMRHSRPLGEVTVREVSTWD--  407

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
                    +P GF  V +     YV    F +   D  KWL   +   +++   T   +P
Sbjct  408  -------GEPGGFMFVTNDNVPYYV----FADNERDQAKWLTALRKLFESS---TSVEEP  453

Query  152  EALAPKSLF  160
            E   P+  +
Sbjct  454  EKTCPRCAY  462

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 3/43 (7%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGA  74
            CEGY+TKRGH   S+R+R+ VL+GA +    Y + E A  +GA
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASM---KYFADETAYRSGA  290

 Score = 38.1 bits (87),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            GY+TKRGH   +W+ RF VL     L SYY  + + +  G V
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGGRL-SYYADEGMKKKLGEV  197

>CCI10489
Length=777

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 45/91 (49%), Gaps = 7/91 (8%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY-Y  91
            EGY+ KRGH  +SWR RF VL+G  L  SYY SKEVA       +G   +++    E   
Sbjct  107  EGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEVAMLNTEKYRGRVTVTAARNDETRS  164

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFV  122
             GVL        F +    P    VE DI+V
Sbjct  165  CGVLITTTINKTFIIYTRTP----VERDIWV  191

>PPTG_19371
Length=1195

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+L+L+GA L  +YY+SKE AR+A  + +G   +S V    Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIISKVRPENY--  125

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                   K  GF +      +G+    +   T  + + W+E+ Q A++
Sbjct  126  ------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIE  163

>PYAP_18636
Length=1009

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 15/112 (13%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++KE AR+   + +G   +S V    Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGRNL-RGRMIISKVRPENY--  157

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKK  144
                 +   F  + +GH     +  L    E   D+  W+E+ Q A+D   K
Sbjct  158  ----GKAHGFLLETMGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVK  199

>SPRG_06058
Length=1258

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 16/127 (13%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++TK+GH RKSW+ R+ VL G   ++SYY   E A T     +    LS V   +  
Sbjct  149  CAGWLTKQGHKRKSWKKRYFVLRGT--VLSYYADFEAANT-----RAGKALSDVSLKD--  199

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRT-GQ  150
            VG    +   F F  + + P        +F +   D  KW+   + A+ A      T  +
Sbjct  200  VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGADTLAIETIDE  253

Query  151  PEALAPK  157
            PE   P+
Sbjct  254  PEKKCPR  260

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 16/102 (16%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEGY+TKRGH   S+R+R+ V+ G+  +V YY  +   RT      G+  L+ +E     
Sbjct  47   CEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRT------GASALAEIEVKS--  96

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLE  133
             G    +     FK   ++       + +  E + DL KW+E
Sbjct  97   GGRWDGESTGLFFKTATNS------TMFVCAENVADLQKWIE  132

>PPTG_13401
Length=927

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G   LVSYY++K  AR    + KG   ++SV+
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHL-KGRVNVASVK  159

>PHYRA_77834
Length=936

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G   LVSYY++K  AR    + KG   ++SV+
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHL-KGRVNVASVK  169

>PITG_18067
Length=924

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G   LVSYY++K  AR    + KG   ++SV+
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHL-KGRVNVASVK  159

>PITG_11303
Length=293

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEGY+TKRGH   +W+ R+  L G   ++ YY S+E ++  GAV
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGN--VLEYYSSEEKSKKYGAV  255

>H310_04843
Length=968

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 54/108 (50%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY+SKE ART G   +G   ++ V    Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEART-GKNLRGRMIITRVLPENY--  157

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                 +   F  + +GH     +  L    E   D+  W+E+ Q A+D
Sbjct  158  ----GKAHGFLIETMGHK----HFHLCCTTELEKDM--WVEMMQAAID  195

>H310_06378
Length=837

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 9/76 (12%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV------E  86
            EG+V K+GH  ++W+VR+  L G   L+SYY++KE AR    + KG  +L++V       
Sbjct  59   EGFVQKKGHLVRNWKVRYFTLEGN--LLSYYETKEDARKRRFL-KGRVHLTTVMLVEGRS  115

Query  87   KHEYYVGVLGAQEKPF  102
             H Y +     + KPF
Sbjct  116  AHGYDLTFTTQESKPF  131

>PYAP_16734
Length=1314

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 13/110 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + YY S+E     GA+        +V      + 
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSEEKLELLGAI--------AVSSDTLVLD  232

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
                   P+ F++     R G   L +  ET  +  +W++ CQ  +DA +
Sbjct  233  KSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMDACQELVDAVR  277

>PHYCA_503112
Length=214

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W+ RF  L G   LVSYY++K  AR    + KG   ++SV+
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEGN--LVSYYENKVDARNRSHL-KGRVNVASVK  167

>H257_03093
Length=975

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY+SK+ ART G   +G   ++ V    Y  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEART-GTNLRGRMIITKVLPENY--  158

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                 +   F  + +GH     +  L    E   D+  W+E+ Q A+D
Sbjct  159  ----GKAHGFLIETMGHK----HFHLCCTTELEKDM--WVEMMQAAID  196

>PYU1_G001063
Length=783

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W+ RF  L G +L  SYY+SK  AR    + KG   ++SV+
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKVDARNRSHL-KGRVQVASVK  197

>PHYKE_5678
Length=809

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 35/69 (51%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SKEVA+T              EK    V
Sbjct  103  EGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKEVAKT------------DTEKFRGRV  148

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  149  TVTGASRDP  157

>PITG_19213
Length=1201

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 55/108 (51%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+L+L+GA L  +YY+SKE AR+A  + +G   ++ V    Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIINKVRPENY--  125

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                   K  GF +      +G+    +   T  + + W+E+ Q A++
Sbjct  126  ------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIE  163

>PYIW_13172
Length=939

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W+ RF  L G +L  SYY+SK  AR    + KG   ++SV+
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRNHL-KGRVNVASVK  200

>PYIR_15309
Length=937

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W+ RF  L G +L  SYY+SK  AR    + KG   ++SV+
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRSHL-KGRVNVASVK  198

>H257_03361
Length=699

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 63/115 (55%), Gaps = 21/115 (18%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            +G++ K+G    SW+ R+LVL+G +  +SY+D KEV+    A  KGSF L+ V+ ++ Y 
Sbjct  11   QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPR-AKEKGSFVLAGVQPNKSYD  66

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTR  147
                      G  ++    ++G   ++I  +T+G+      +C+NAL+ A  L R
Sbjct  67   N---------GMTLLS---KEGKA-MNITTKTVGE----YVMCKNALENAVSLPR  104

>H257_06722
Length=1482

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 55/129 (43%), Gaps = 18/129 (14%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++TK+GH RKSW+ R+ VL G  L  +YY   + +      P G   +  V   +  
Sbjct  352  CAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLGEVTVREVSAWD--  407

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
                    +P GF  + +     YV    F +   D  KWL   +   ++A  +    +P
Sbjct  408  -------GEPSGFMFITNDSVPYYV----FADNDRDQAKWLAALRKLFESATSME---EP  453

Query  152  EALAPKSLF  160
            +   P+  +
Sbjct  454  DKTCPRCAY  462

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 3/43 (7%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGA  74
            CEGY+TKRGH   S+R+R+ VL G+   + YY + E A  +GA
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGS--TIKYY-ADETAYRSGA  290

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            GY+TKRGH   +W+ RF VL     L SYY  + + +  G V
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGGRL-SYYADEGMKKKLGEV  197

>H257_06721
Length=1238

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 61/148 (41%), Gaps = 28/148 (19%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP---------KGSFYL  82
            C GY+TKRGH   +W++R+ VL     L SYY+ + +A+  G V           GS   
Sbjct  14   CRGYLTKRGHVVTNWKMRYFVLRPHASL-SYYEDESMAKKLGQVHLAKVAPWEYNGSL-A  71

Query  83   SSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVC-------  135
             SV K E      GA+E  +GF M     R  Y    I+  +  +  KW           
Sbjct  72   KSVSKRESRGSSSGAEESRYGF-MFFTTKRVVYY---IYTTSAIEHQKWFHAVADYYVHT  127

Query  136  QNALDAAKKLTRTGQPEALAPKSLFGFS  163
             N  D    +T+        P +LF FS
Sbjct  128  SNVADCEGYMTKK------TPGTLFSFS  149

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 58/133 (44%), Gaps = 20/133 (15%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ VL G+  L+SYY   +          G      +E  + +
Sbjct  232  CAGYLTKQGHKRKSWKKRYFVLRGS--LLSYYTDYDSTNKQCLAEVG------IEDVQVW  283

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
             G +       GF          YV    + E+  +  KWL   +  LDA  + TR  +P
Sbjct  284  DGEM------HGFMFTTSEQVVYYV----YAESERERQKWLVSLKALLDA--QSTRAPKP  331

Query  152  EALAPKSLFGFSP  164
             A+ P  +    P
Sbjct  332  LAMGPPPVSKVCP  344

>PYAP_17290
Length=835

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 3/54 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            EGYVTKRGH  ++W++RF  L G +L  SYY++K  AR    + KG   ++SV+
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKVDARNRDHL-KGRVNVASVK  203

>CCA18875
Length=1514

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGS----------FYL  82
            EGY+TKRGH   +W+ RF VL+G   ++ YY S+E  +  G+V              F  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGN--VLEYYSSEEKTKRYGSVVVAKVAPWSGEAHGFMF  280

Query  83   SSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELD  119
             + ++  YYV      EK    +    A R+ YVE D
Sbjct  281  YTTKQIPYYVYAASETEKAKWLR----ALREFYVEPD  313

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVA  69
            C GY+TK+GH RKSW+ R+ +L G   ++SYY   ++A
Sbjct  418  CAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLA  453

 Score = 36.2 bits (82),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+T+RGH   S RV + VL+G  L
Sbjct  317  CEGYLTRRGHLVPSQRVCYYVLSGTCL  343

>H257_13567
Length=836

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 43/76 (57%), Gaps = 9/76 (12%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV------E  86
            EG+V K+GH  ++W+VR+  L G   L+SYY++KE AR    + KG  ++++V       
Sbjct  61   EGFVQKKGHLVRNWKVRYFTLEGN--LLSYYETKEDARKRRFL-KGRVHVTTVVLVEGRS  117

Query  87   KHEYYVGVLGAQEKPF  102
             H Y +     + KPF
Sbjct  118  HHGYDLTFTTQESKPF  133

>PHYRA_79281
Length=809

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 35/69 (51%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA+T              EK    V
Sbjct  103  EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKT------------DTEKFRGRV  148

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  149  TVTGASRDP  157

>SPRG_00889
Length=994

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (46%), Gaps = 18/133 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG+V K+G +   W  R+LVL+G  L  +YY  +  AR+ G   +G   L+       YV
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARS-GKNLRGRMVLT-------YV  172

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPE  152
            G     +K  GF +      KG+    +   T  + + W+E+ Q ALD A   +    P 
Sbjct  173  GPDFKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSASTKPPP-  227

Query  153  ALAPKSLFGFSPA  165
               P+  F  SP+
Sbjct  228  ---PQDDFMSSPS  237

>CCI44752
Length=1526

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 2/41 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTA  72
            C GY+TK+GH RKSW+ R+ +L G   ++SYY   ++A  A
Sbjct  418  CAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNA  456

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGS----------FYL  82
            EGY+TKRGH   +W+ RF VL+G   ++ YY S+E  +  G+V              F  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGN--VLEYYSSEEKTKRYGSVVVAKVAPWSGEAHGFMF  280

Query  83   SSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELD  119
             + ++  YYV      EK    +    A R+ YVE D
Sbjct  281  YTTKQIPYYVYAASEAEKTKWLR----ALREFYVEPD  313

 Score = 36.2 bits (82),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEGY+T+RGH   S RV + VL+G  L
Sbjct  317  CEGYLTRRGHLVPSQRVCYYVLSGTYL  343

>PHYCA_506137
Length=810

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 35/69 (51%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA+T              EK    V
Sbjct  104  EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKT------------DTEKFRGRV  149

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  150  TVTGASRDP  158

>SPRG_06021
Length=983

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 12/99 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            GY++KRG +RK+W+ R+ +L      + Y DS++     G VP                 
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPI-------TPNTRVIDN  191

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWL  132
             +G Q+ PF F++  H PR+    L +   T+ +  KW+
Sbjct  192  SIGCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWI  225

>PYIR_17453
Length=2619

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 51/112 (46%), Gaps = 10/112 (9%)

Query  32    CEGYVTKRGHFR-KSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKG--SFYLSSVEK-  87
             CEGYV  R HF   +WR RF VL    L +  Y     A + G   K      L +V+K 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQKALEKHDLIAVKKW  2217

Query  88    HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
             H  Y   LG     FGF++   A   GY+E  + +E   +  KWL    NA+
Sbjct  2218  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIE--DEQTKWLAAITNAV  2265

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 27/53 (51%), Gaps = 2/53 (4%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL    L   Y+ + E +R     P GSF +  V
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVLVKNTL--EYFATHEDSRNPAIRPHGSFQVEIV  1272

>SDRG_01407
Length=815

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++K+ AR +G   +G   ++ V    Y  
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR-SGRNLRGRMIITRVLPENY--  139

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                   K  GF +      KG+    +   T  + + W+E+ Q A+D
Sbjct  140  ------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAID  177

>SPRG_02752
Length=831

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 58/110 (53%), Gaps = 21/110 (19%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG++ K+G    +W+ R++VL G    ++YYD KEV     A  KG+F L++VE+     
Sbjct  7    EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVTN-PRAKEKGTFTLAAVER-----  57

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAA  142
                A E   G  + G+    G + + I+ +T+G+      +C NA+ AA
Sbjct  58   --TPAME--LGLTLAGY---DGKI-MHIYTKTVGE----FVLCNNAMTAA  95

 Score = 38.1 bits (87),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYD  64
            G++ K G   KSW+ RF VL+G DL  +YYD
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>PYAR_13491
Length=1080

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 52/109 (48%), Gaps = 18/109 (17%)

Query  36   VTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVL  95
            +TK+G +R++W+ RF +L      +SYY S+E     G+VP     L  ++K        
Sbjct  2    LTKQGSWRRNWKTRFFILRSDYPSLSYYKSEEKLELLGSVPITGDSL-VLDKSA------  54

Query  96   GAQEKPFGFKM----VGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
            G    PF F++    VG A       L +  ET  +  +W++ CQ  +D
Sbjct  55   GGGHAPFRFQLRTDAVGAA-------LLLETETRDNQQRWMDACQELVD  96

>SPRG_00890
Length=883

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 15/108 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+G +   W  R+LVL+GA L  +YY++K+ AR +G   +G   ++ V    Y  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR-SGRNLRGRMIITRVLPENY--  85

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
                   K  GF +      KG+    +   T  + + W+E+ Q A+D
Sbjct  86   ------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAID  123

>SPRG_17022
Length=107

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  ++WR R+ VL+G     +YY SKE A             + +EK++  V
Sbjct  35   EGYIWKQGHVVRNWRNRYAVLSGT--CFTYYASKEAAS------------ADLEKYKGRV  80

Query  93   GVLGAQEKP  101
             V GA++ P
Sbjct  81   TVTGAKKDP  89

>PYAR_19914
Length=788

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVART  71
            EGYVTKRGH  ++W+ RF  L G +L  SYY++K  AR 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKVDARN  182

>SDRG_05567
Length=980

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 12/99 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            GY++KRG +RK+W+ R+ +L      + Y DS++     G VP                 
Sbjct  137  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPI-------TPNTRVIDN  189

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWL  132
             +G Q+ PF F++  H PR+    L +   T+ +  KW+
Sbjct  190  SIGCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRKWI  223

>CCI41225
Length=981

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSK  66
            EGYVTKRGH  ++W++RF  L G  L  SYY+SK
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESK  171

>SDRG_14487
Length=964

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 59/110 (54%), Gaps = 21/110 (19%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG++ K+G    +W+ R++VL G    ++YYD KEV+    A  KG+F L++VE+     
Sbjct  7    EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVSN-PRAKEKGTFTLAAVER-----  57

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAA  142
               G +    G  + G+    G + + I+ +T+G+      +C NA+ AA
Sbjct  58   -TPGME---LGLTLAGY---DGKI-MHIYTKTVGE----FVLCNNAMTAA  95

 Score = 38.1 bits (87),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYD  64
            G++ K G   KSW+ RF VL+G DL  +YYD
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>PHALS_03645
Length=830

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 35/69 (51%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G   + SYY SK+VA+               EK    V
Sbjct  104  EGYIWKQGHVVRSWRYRYAVLSGT--IFSYYVSKDVAKM------------DTEKFRGRV  149

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  150  TVTGASRDP  158

>PPTG_14630
Length=398

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   K+W+ RF+VL+G  L  +YYD+ ++  T    PKGSF + +VE
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLVPTVK--PKGSFQVITVE  60

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 64/144 (44%), Gaps = 26/144 (18%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   KSW+ R+ VL G  L  SY++S++     GA  KG  ++ +VE +     
Sbjct  155  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVKAVEVNGT---  205

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
            V    +  F    +          L +  +  GD+  WL    +A++AA       + ++
Sbjct  206  VTNGLDISFDNGRI----------LRVSAKNSGDMELWLCKLSDAIEAANTEMNNVR-QS  254

Query  154  LAPKSLF------GFSPATSPQQQ  171
            LA ++ F      G SP    QQQ
Sbjct  255  LAARNSFRSSSIGGPSPTRMKQQQ  278

>PHYKE_6662
Length=765

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 66/138 (48%), Gaps = 19/138 (14%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG+V K+G +   W  R+L+L+GA L  +YY+SKE AR+A  + +G   +  V    Y  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIIVKVRPENY--  126

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPE  152
                   K  GF +      +G+    +   T  + + W+E+ Q A++      R G P 
Sbjct  127  ------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEG---VRHG-PN  172

Query  153  ALAPKSLFGFSPATSPQQ  170
            +++ + +   +   SP Q
Sbjct  173  SMSLEGMDALALQASPTQ  190

>CCA21715
Length=782

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 36/66 (55%), Gaps = 14/66 (21%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SKE+A            ++  E++   V
Sbjct  109  EGYIWKQGHVVRSWRYRYAVLSGT--CFSYYSSKEIA------------MADTERYRGRV  154

Query  93   GVLGAQ  98
             V GA+
Sbjct  155  TVTGAE  160

>CCA21860
Length=782

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 36/66 (55%), Gaps = 14/66 (21%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SKE+A            ++  E++   V
Sbjct  109  EGYIWKQGHVVRSWRYRYAVLSGT--CFSYYSSKEIA------------MADTERYRGRV  154

Query  93   GVLGAQ  98
             V GA+
Sbjct  155  TVTGAE  160

>PHALS_04098
Length=1183

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 2/40 (5%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTA  72
            EGYV K+G +   W  R+L+L+GA L  +YY+SKE AR+A
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSA  112

>PHYSO_489872
Length=1240

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 49/110 (45%), Gaps = 13/110 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + Y+ S++     G +P        + +    + 
Sbjct  154  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIVLD  205

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
              G    PF F++     R     L +  E+  +  +W+E CQ   DA +
Sbjct  206  RSGGGHAPFRFQI-----RTDAQTLLLEAESRENQKRWIEACQELADAIR  250

>HYAP_08026
Length=798

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA+               EK    V
Sbjct  91   EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKV------------DTEKFRGRV  136

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  137  TVTGATRDP  145

>PYIW_17571
Length=1330

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/157 (22%), Positives = 61/157 (39%), Gaps = 13/157 (8%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK G +R++W+ RF +L      + YY S++     G +P        ++     + 
Sbjct  175  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSEDKLELLGEIP--------IQPDTMVLD  226

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
               A   P+ F++     R     L +  E+  +  +W++ CQ  +DA +     G    
Sbjct  227  RSAAGHAPYRFQV-----RSDAKTLLLEAESRDNQRRWIDSCQELVDAVRADKFRGSTAT  281

Query  154  LAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEI  190
            L   S+       S Q  +    A +  M K     I
Sbjct  282  LTRTSIMDRESRDSRQSNVAAAVARRSSMSKAGNNNI  318

>PYIW_18480
Length=755

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 2/37 (5%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVA  69
           EGYV K+GH  +SWR R+ +L+G     SYY SKEVA
Sbjct  53  EGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVA  87

>PITG_02109
Length=522

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 4/53 (8%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            G+V K+G   K+W+ RF+VL+G  L  +YYD+ ++  T    PKGSF + +VE
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLNPTVK--PKGSFQVITVE  186

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 72/166 (43%), Gaps = 28/166 (17%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   KSW+ R+ VL G  L  SY++S++     GA  KG  ++ +VE +     
Sbjct  281  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVEVNGTVTN  334

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK-KLTRTGQPE  152
             L        F         G + L +      D+  WL    +A++AA  ++T   Q  
Sbjct  335  GLD-----ISFD-------NGRI-LRVSTRNSKDMELWLCKLSDAIEAANAEMTNVRQ--  379

Query  153  ALAPKSLF------GFSPATSPQQQMKKMTATKEQMLKQAIEEIES  192
            +LA +S F      G SP    QQQ  +    +   ++ ++  + S
Sbjct  380  SLAARSSFRASSIGGPSPTRMKQQQNIQHYNNRNAGMRHSLASVPS  425

>PHYSO_344112
Length=813

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA+               EK    V
Sbjct  104  EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKM------------DTEKFRGRV  149

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  150  TVTGASRDP  158

>PPTG_05519
Length=810

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA+               EK    V
Sbjct  104  EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKM------------DTEKFRGRV  149

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  150  TVTGASRDP  158

>PYVX_16095
Length=1137

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (43%), Gaps = 16/135 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + Y+ S+E     G +        +V +    + 
Sbjct  96   GVLTKQGSWRRNWKTRFFILRRDFPSLCYFTSEEKLELLGEI--------AVTEDTLVLD  147

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
               A   P+ F++     R     L +  E+  D  +W+E CQ   DA + L  +    +
Sbjct  148  RSSAGHAPYRFQV-----RSEDKALLLEAESRDDQRRWMESCQELADALRALKFS---HS  199

Query  154  LAPKSLFGFSPATSP  168
             A  SLF   P   P
Sbjct  200  SAGNSLFALHPRDRP  214

>SDRG_01408
Length=916

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 53/111 (48%), Gaps = 14/111 (13%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG+V K+G +   W  R+LVL+G  L  +YY  +  AR+ G   +G   L+       YV
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARS-GKNLRGRMVLT-------YV  174

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
            G     +K  GF +      KG+    +   T  + + W+E+ Q ALD A 
Sbjct  175  GPDFKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEAN  221

>PITG_02762
Length=810

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA+               EK    V
Sbjct  104  EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKL------------DTEKFRGRV  149

Query  93   GVLGAQEKP  101
             V GA   P
Sbjct  150  TVTGASRDP  158

>CCA16487
Length=975

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 6/59 (10%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYY----DSKEVARTAGAVPKGSFYLSSVEK  87
            EGYVTKRGH  ++W++RF  L G  L  SYY    D+++ A   G V   S  +  V K
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKVDAQQRAHLKGRVKVASVRIDQVSK  194

>PHYSO_478611
Length=522

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            G+V K+G   K+W+ RF+VL G  L  +YYD+ +V  T  A  KGSF + +VE
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVDPTVKA--KGSFQVITVE  189

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 19/110 (17%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   KSW+ R+ VL G  L  SY++S++     GA  KG  ++ +VE       
Sbjct  283  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVE-------  329

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
            V G  +     K        G V L +     GD+  WL    +A++AA 
Sbjct  330  VNGTVKNGLDIKF-----DNGRV-LRVSARNSGDMEVWLCKLSDAIEAAN  373

>HYAP_04457
Length=1203

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 3/58 (5%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
            EGYV K+G +   W  R+L+L+G  L  +YY+SKE AR+A  + +G   L  V    Y
Sbjct  62   EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDARSARNL-RGRMLLLKVRPENY  116

>SDRG_08800
Length=881

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (45%), Gaps = 30/127 (24%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE-----  86
             EG+V+K+GH  ++W++R+  L     L+SYY+SKE AR    + KG  +L+ V      
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLESN--LLSYYESKEDARKRRHL-KGRVHLTRVHIIEGK  121

Query  87   -KHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNK--WLEVCQNALDAAK  143
              H Y       + KPF                   V T  +L++  W++V Q  +D   
Sbjct  122  SAHGYDFTFDTQEGKPF------------------HVSTTTELDQIAWVKVMQAGIDWF-  162

Query  144  KLTRTGQ  150
             L   GQ
Sbjct  163  NLNNAGQ  169

>PYAP_22646
Length=815

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 35/66 (53%), Gaps = 14/66 (21%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ +L+G     SYY SK+VA            +   EK+   V
Sbjct  103  EGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDVA------------MLDTEKYRGRV  148

Query  93   GVLGAQ  98
             V GA+
Sbjct  149  SVTGAK  154

>SPRG_08346
Length=797

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  ++WR R+ VL+G     +YY SKE A             + +EK++  V
Sbjct  35   EGYIWKQGHVVRNWRNRYAVLSGT--CFTYYASKEAAS------------ADLEKYKGRV  80

Query  93   GVLGAQEKP  101
             V GA++ P
Sbjct  81   TVTGAKKDP  89

>PYIR_13120
Length=814

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (4%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89
            EGY+ K+GH  +SWR R+ +L+G     SYY SKEVA       +G   ++   K E
Sbjct  107  EGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGARKDE  161

>CCI42457
Length=906

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSK  66
            EGYV KRGH  ++W++RF  L G    VSYY+SK
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGNR--VSYYESK  161

>SPRG_05449
Length=723

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 58/127 (46%), Gaps = 30/127 (24%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE-----  86
             EG+V+K+GH  ++W++R+  L     L+SYY+SKE AR    + KG  +L+ V+     
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLESN--LLSYYESKEDARKRRHL-KGRVHLTRVQIIEGK  121

Query  87   -KHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNK--WLEVCQNALDAAK  143
              H Y       + KPF                   V T  +L++  W++V Q  +D   
Sbjct  122  SAHGYDFTFDTQEGKPF------------------HVSTTTELDQIAWVKVMQAGIDWF-  162

Query  144  KLTRTGQ  150
             L   GQ
Sbjct  163  NLNNAGQ  169

>PYAP_15732
Length=333

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 84/205 (41%), Gaps = 45/205 (22%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSY---YDSKEVARTA---------GAVPKGSFY  81
            G++  RG     WR R+  LNG   L++Y   + S+E  R A         G  P+G   
Sbjct  75   GWLWMRGSRIGRWRHRYFCLNGT--LLTYFMTFPSEEFLRQASPENVCFSDGTRPRGVIR  132

Query  82   LSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDA  141
            ++ VE+         +  K  GFK+ G   R     ++I    + + N+WL   +     
Sbjct  133  VAHVEE---------SDTKTLGFKVFGTCGR----SIEIRAHRVDERNEWLRALKTPARR  179

Query  142  AKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSAC  201
              +   TG  E L   SL  F P        + MT T +   +Q+I  ++S  ++ +S  
Sbjct  180  KSRSWSTGSAEDLT-LSLASFDP--------ENMTCTLD---RQSIPIMKSGWMLKKSDV  227

Query  202  QE------IFIQGERLDHIGQELAH  220
             +        +QG+ L +   + AH
Sbjct  228  LKRWNRYFFVLQGKMLSYYASDRAH  252

>CCA17102
Length=884

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSK  66
            EGYV KRGH  ++W++RF  L G  L  SYY+SK
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESK  141

>SDRG_05150
Length=787

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  ++WR R+ VL+G     +YY SKE A             + +EK++  V
Sbjct  35   EGYIWKQGHVVRNWRNRYAVLSGT--CFTYYASKEAAS------------ADLEKYKGRV  80

Query  93   GVLGAQEKP  101
             V GA++ P
Sbjct  81   TVTGAKKDP  89

>PHYCA_504801
Length=398

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   K+W+ RF+VL G  L  +YYD+ +V  T  A  KGSF + +VE
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVNPTTKA--KGSFQVITVE  60

 Score = 38.1 bits (87),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 63/144 (44%), Gaps = 26/144 (18%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   KSW+ R+ VL G  L  SY++S++     GA  KG  ++ +VE       
Sbjct  156  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVE-------  202

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
            V G        K        G V L +     GD+  WL    +A++AA       + ++
Sbjct  203  VNGTVTNGLDIKF-----DNGRV-LRVSARNSGDMELWLCKLSDAIEAANNEANNVR-QS  255

Query  154  LAPKSLF------GFSPATSPQQQ  171
            LA +S F      G SP    QQQ
Sbjct  256  LAARSSFRASSLGGPSPTRMKQQQ  279

>H257_09028
Length=556

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 67/143 (47%), Gaps = 25/143 (17%)

Query  32   CEGYVTKRGHFRKS--WRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89
            C GYV  + H + S  W+ R+ VL    L + +YD+ E A T G + KG    SSV  H+
Sbjct  22   CTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAEAA-TQGEL-KGKIPYSSV--HD  76

Query  90   YYVGVLGAQEKPFGFKMVGHAP-RKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRT  148
            +       + KP GF+   + P  K Y    ++ +T  +  KW+   Q  LD A  +   
Sbjct  77   W-------EGKPHGFQF--YTPTNKCY---KVYTDTEEEKLKWVSTMQKQLDDAPDVPDG  124

Query  149  GQPEALAPKSLFG-FSPATSPQQ  170
             Q     P + FG  SP  SP+Q
Sbjct  125  EQ----VPYARFGASSPVGSPRQ  143

>PYVX_18338
Length=746

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 2/37 (5%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVA  69
            EGY+ K+GH  +SWR R+ VL+G     SYY SK+VA
Sbjct  82   EGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  116

>H310_14019
Length=683

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 60/148 (41%), Gaps = 24/148 (16%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG++ KRG   K+W+ R+  LNG +L        +     GA PKG         +   V
Sbjct  173  EGWLLKRGQRVKNWKRRYFTLNGQEL--------KYMEGPGAKPKG---------YGMVV  215

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPE  152
            GV    E P+    +   P +    LD+  E+  +   W+   Q  LDA   +  T  P 
Sbjct  216  GVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWM---QRILDACGHVAATTPPP  268

Query  153  ALAPKSLFGFSPATSPQQQMKKMTATKE  180
                      +PAT PQQ    + +T E
Sbjct  269  PPVLHVTLSSAPATPPQQLAASLQSTLE  296

>PYAP_16997
Length=1018

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 52/115 (45%), Gaps = 22/115 (19%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C GY+TK+GH RKSW+ R+ VL G    ++Y+   + A +          +  V++ +  
Sbjct  402  CSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKALAEVIVEDVQRWD--  457

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLT  146
                    +PFGF  +       YV    + +   +  KW+    NAL   +KLT
Sbjct  458  -------GEPFGFMFMTSEQVPYYV----YADNERERGKWM----NAL---RKLT  494

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            CEG++TKRGH   +W++R+ VL G   ++ Y+   + ++  G+V
Sbjct  207  CEGFLTKRGHVFTNWKMRYFVLRGN--VLEYFSGDDKSKRYGSV  248

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEG++T+RGH   S R  + VLNG  L
Sbjct  302  CEGFLTRRGHLVPSQRFAYYVLNGTSL  328

>PYIR_16539
Length=1346

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 65/154 (42%), Gaps = 14/154 (9%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK G +R++W+ RF +L      + YY S++     G +P        +      + 
Sbjct  171  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSEDKLELLGEIP--------ILPDTMVLD  222

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
               +   P+ F++     R     L +  E+  +  +W++ CQ  +DA +     G   A
Sbjct  223  RSASGHAPYRFQV-----RSETKTLLLEAESRDNQRRWIDSCQELVDAVRADKFRGSTTA  277

Query  154  LAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAI  187
            L+  SL     + S Q  +  + A +   + +A+
Sbjct  278  LSRTSLMDRESSDSRQSNI-ALNAARRSSVSKAV  310

>PYU1_G004386
Length=837

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 72/159 (45%), Gaps = 27/159 (17%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  +SWR R+ +L+G     SYY SK+VA            +   EK    V
Sbjct  139  EGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDVA------------MIDTEKFRGRV  184

Query  93   GVLGAQE---KPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG  149
             V GA++   +  G  +V     K +    ++  T  +   W+++ Q A+  A     +G
Sbjct  185  TVTGARKDDARTNGV-LVTTTINKVFA---LYTRTAIESEIWIKMIQQAVQNA-----SG  235

Query  150  QPEALAPKSLFGFSPATSPQQQMK-KMTATKEQMLKQAI  187
            Q  + +  +  G   +   QQQM  + T T   +L Q +
Sbjct  236  QKMSTSATTTSGGRDSDLQQQQMYGRNTLTTNAILAQTV  274

>SPRG_16312
Length=261

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 73/170 (43%), Gaps = 38/170 (22%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            GYV K+G F K+W+ RF+VL+   L   YY    V+  A A P+G F ++SV        
Sbjct  43   GYVRKQGSFVKNWKRRFMVLHDDTLF--YY----VSERAMAKPRGFFRVTSVAY------  90

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
               A + P G    G   R+    L   +    + + W +        +++L RTG    
Sbjct  91   ---APDLPHGLIADGTGTRR----LRFTLADSDECDAWYDTL------SERLGRTGL---  134

Query  154  LAPKSLFGFSPATSPQQQMKK---MTATKEQMLKQAI----EEIESAKLI  196
               +SL G SP     + M K     A +   L  A+    +++ESA  I
Sbjct  135  ---QSLRGASPPGVWHKTMSKGCGAAAFRRLALHAAVNTNLQQVESAATI  181

>PITG_09930
Length=1221

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 49/110 (45%), Gaps = 13/110 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + Y+ S++     G +P        V +    + 
Sbjct  153  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------VTEDTIVLD  204

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
              G    PF F++     R     L +  E+  +  +W++ CQ   DA +
Sbjct  205  RSGGGHAPFRFQI-----RTDAHTLLLEAESRENQKRWIDSCQELADAIR  249

>PYAR_19883
Length=833

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 34/65 (52%), Gaps = 14/65 (22%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+GH  ++WR R+ +L+G     SYY SK+VA            +   EK+   V
Sbjct  103  EGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVA------------MQDTEKYRGRV  148

Query  93   GVLGA  97
             V GA
Sbjct  149  SVTGA  153

>PHYRA_76931
Length=1212

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 49/110 (45%), Gaps = 13/110 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + Y+ S++     G +P        + +    + 
Sbjct  152  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIILD  203

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
              G    PF F++     R     L +  E+  +  +W++ CQ   DA +
Sbjct  204  RSGGGHAPFRFQI-----RTEAQTLLLEAESRENQKRWIDSCQELADAIR  248

>H310_07701
Length=811

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+GH  ++WR R+ +L G     +YY SKE A            +S  EK +  V
Sbjct  53   EGYVWKQGHVVRNWRNRYGILTGT--CFTYYSSKEHA------------MSDFEKFKGRV  98

Query  93   GVLGAQEKP  101
             V GA++ P
Sbjct  99   TVTGAKKDP  107

>PPTG_19153
Length=1219

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 49/110 (45%), Gaps = 13/110 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + Y+ S++     G +P        + +    + 
Sbjct  147  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIVLD  198

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
              G    PF F++     R     L +  E+  +  +W++ CQ   DA +
Sbjct  199  RSGGGHAPFRFQI-----RTDAHTLLLEAESRENQKRWIDSCQELADAIR  243

>PPTG_14626
Length=1055

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 51/121 (42%), Gaps = 27/121 (22%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++ K G   KSW+ R+  L G+ L  SYY S+          KGS   S        
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSE----------KGSLLRS--------  753

Query  92   VGVLGAQEKP---FGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRT  148
            V V+  +  P    G  +     RK    L +  E+ G+ NKWL   Q A+  A +   T
Sbjct  754  VSVINVEPHPSVSLGLTVSTVGGRK----LIVQAESNGEFNKWLNAIQEAVAEASERNST  809

Query  149  G  149
            G
Sbjct  810  G  810

>PYU1_G009508
Length=328

 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 39/88 (44%), Gaps = 12/88 (14%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE-----------VARTAGAVPKGSFYL  82
            GY+ K+G + K+WR R+ +L     ++SYYDS E              T    P+  F  
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDSAEELTKLGEITVDATTTVKPTPREGFPF  225

Query  83   SSVEKHEYYVGVLGAQE-KPFGFKMVGH  109
              V +HE     L A+E KP     + H
Sbjct  226  QFVVEHEKRKLTLVAEEGKPSTDAWISH  253

>PYU1_G009249
Length=2580

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL      + YY + E +R     P GSF + +V
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYYATHEDSRNPSVAPHGSFRVDTV  1231

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 54/118 (46%), Gaps = 16/118 (14%)

Query  34    GYVTKRGHFRKS-WRVRFLVLNGADLLVSYYDSK------EVARTAGAVPKGSFYLSSVE  86
             GYV  R HF  + WR RF+VL+G    + Y DS       E      A+ K +  ++  +
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKKALEKHNL-VAIAK  2158

Query  87    KHEYYVGVLGAQEKP---FGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDA  141
              H  YV   G+       +GF++   A   GY+E    V T  +  +W++   +A+ A
Sbjct  2159  WHPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTISDAVTA  2212

>CCI45895
Length=1721

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (4%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVAR--TAGAVPKGSFYLSSV  85
            EGY+ KRGH   S R R+ VL   D  + Y+++KE A     G+ P G F +++V
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKEDAEGFECGSKPLGEFQVANV  897

>PHYRA_73430
Length=395

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   ++W+ RF+VL G  L  +YYD+ +V  T  A  KGSF + +VE
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGRQL--TYYDTAKVDPTVKA--KGSFQVITVE  60

 Score = 34.3 bits (77),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (44%), Gaps = 20/135 (15%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   KSW+ R+ VL G  L  SY++S++     GA  KG  ++ +VE +     
Sbjct  152  GWIKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVEVNGT---  202

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEA  153
            V    +  F    V          L +     GD+  WL    +A++AA       + ++
Sbjct  203  VTNGLDITFDNGRV----------LRVSARNSGDMELWLLKLSDAIEAANAEMNNVR-QS  251

Query  154  LAPKSLFGFSPATSP  168
            LA +S F  S    P
Sbjct  252  LAARSSFRASSMGGP  266

>PYIR_15118
Length=1222

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (49%), Gaps = 12/80 (15%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE---------VARTAGA--VPKGSFYL  82
            GY+ K+G F K+WR R+ +L     ++SYYDS E         V  T G    P+  F  
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLGEITVDGTTGVRPTPREGFPF  252

Query  83   SSVEKHEYYVGVLGAQE-KP  101
              V +HE     L A+E KP
Sbjct  253  QFVVEHEGRKLTLVAEEGKP  272

>PHALS_07930
Length=1200

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP  76
            GY+ K+G F KSWR RF +L     ++ YY S E     G +P
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAEELAKLGEIP  226

>H257_07514
Length=810

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 14/69 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGYV K+GH  ++WR R+ +L G     +YY SKE A            ++  EK +  V
Sbjct  53   EGYVWKQGHVVRNWRNRYGILTGT--CFTYYSSKEHA------------MADFEKFKGRV  98

Query  93   GVLGAQEKP  101
             V GA++ P
Sbjct  99   TVTGAKKDP  107

>PYVX_14527
Length=1269

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            G+V K+G   ++W+ RF+VL+G  L  +YYD+  +  +  A  KGSF L +VE
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGRQL--TYYDTARLTPSVKA--KGSFTLITVE  951

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 6/56 (11%)

Query  34    GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89
             G++ K G   KSW+ RF  L G  L  SY+DS++     GA  KG  ++ +VE ++
Sbjct  1049  GWLKKEGSRVKSWKRRFFALRGDAL--SYFDSEDT----GAAAKGYGHIKTVEVND  1098

 Score = 34.7 bits (78),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            G+V K G   +SW+ RFLV  GADL  +YY + +
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKNTD  620

>H310_12448
Length=555

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 62/142 (44%), Gaps = 23/142 (16%)

Query  32   CEGYVTKRGHFRKS-WRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
            C GYV  +       W+ R+ VL    L + +YDS E A  A    KG    SSV  H++
Sbjct  22   CTGYVYNQPEKNSIIWKKRYCVLQENSLYIFHYDSAEAA--AKGELKGKIPYSSV--HDW  77

Query  91   YVGVLGAQEKPFGFKMVGHAP-RKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG  149
                   + KP GF+   + P  K Y    ++ +T  +  KW+   Q  LD A ++    
Sbjct  78   -------EGKPHGFQF--YTPTNKCY---KVYTDTEDEKVKWIATMQKQLDDAPEIPDGE  125

Query  150  QPEALAPKSLFG-FSPATSPQQ  170
            Q     P + FG  SP  SP+ 
Sbjct  126  Q----VPYARFGASSPTGSPRH  143

>PHALS_06568
Length=388

 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   KSW+ R++VL+G  L  +YYD+ +V +     PKGS  + +VE
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGRQL--TYYDTAKVDQKVK--PKGSCQVITVE  60

 Score = 39.3 bits (90),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 47/94 (50%), Gaps = 10/94 (11%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   KSWR RF VL G  L  SY++S++     GA+ KGS  + +VE +    G
Sbjct  153  GWLKKEGARVKSWRRRFFVLRGNSL--SYFNSEDT----GAIAKGSGDVRAVEVNTINNG  206

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGD  127
            +    +  F    V     K   E+++++  L D
Sbjct  207  L----DISFDTGRVLRVTAKNSKEMELWLCKLSD  236

>PYIW_21901
Length=913

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K GH RK+W+ R+ VL+ +  ++ YY  + +AR  G V     +  +   H   + 
Sbjct  426  GWLRKLGHVRKNWKSRYFVLDRS--VLRYYADESLARLKGEV---LLFHPATRVHYVDIH  480

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            + G ++  F    VG    K Y  L +  E L D   W+   ++AL
Sbjct  481  LSGGKDGTFAIH-VG----KDYALL-LQAEQLSDRENWMYCIEDAL  520

>PYIW_18911
Length=1196

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F K+WR R+ +L     ++SYYDS E
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAE  207

>PYVX_23349
Length=924

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K GH RK+W+ R+ VL  +  ++ YY  +  +R  G V     +  +   H   + 
Sbjct  447  GWLRKLGHVRKNWKARYFVLEKS--ILRYYSDESRSRLKGEV---LLFHPATRVHYVDIH  501

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            + G ++  F  + VG      Y  L +  E L D   W+   ++AL
Sbjct  502  LSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>PHYRA_73534
Length=1210

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 48/108 (44%), Gaps = 15/108 (14%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ KRGH RK+W+ R+ VL  +  ++ YY     A+  G V     +      H   V 
Sbjct  342  GWLRKRGHVRKNWKARYFVLEKS--VLRYYTDPSCAKLKGEV---LLFHPQTRVHYVDVH  396

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVET--LGDLNKWLEVCQNAL  139
            V G ++  F  + VG        E  + ++   L D   W+   ++AL
Sbjct  397  VAGGRDASFAIQ-VG-------PEYTLLLQAAQLRDRENWMYCIEDAL  436

>HYAP_09304
Length=1144

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F KSWR RF +L     ++SYY S E
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTSAE  158

>CCI43793
Length=1117

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F KSWR RF +L     +++YY SKE
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKE  208

>PITG_17893
Length=747

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ KRGH RK+W+ R+ VL  +  ++ YY     A+  G V     +      H   V 
Sbjct  221  GWLRKRGHVRKNWKARYFVLEKS--VLRYYTDSSCAKLKGEV---LLFHPQTRVHYVDVH  275

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            V G ++  F  + VG      Y  L +    L D   W+   ++AL
Sbjct  276  VAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  315

>CCA22367
Length=885

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 28/123 (23%), Positives = 59/123 (48%), Gaps = 13/123 (11%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            +G++ KRGH +K+W+ R+  +    L   + ++K++ R  GA+P     +S         
Sbjct  544  DGFLWKRGHLKKNWKKRYFRIEDGQLQY-FTENKKLMR--GAIPLNGTVVSP--------  592

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPE  152
            G+    +    + ++ +   K   EL +  ET  ++++W++V Q A    ++  R  +P 
Sbjct  593  GMTCCPDGRKNYFVISNMNHKS--ELHLNAETEAEMHEWVQVLQQAQSGFERKKRIEEPL  650

Query  153  ALA  155
              A
Sbjct  651  GFA  653

>SDRG_14486
Length=308

 Score = 39.3 bits (90),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 4/54 (7%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           +G+V K+G   +SW+ R++VL    L  SY+D++ V  TA    KGSF + ++E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENV--TASTKAKGSFAVITIE  56

 Score = 35.0 bits (79),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTA  72
            C G++ K G   K+W+ RF  L G  L  +YYD+ ++A +A
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSA  175

>HYAP_02230
Length=1195

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 24/110 (22%), Positives = 48/110 (44%), Gaps = 13/110 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK+G +R++W+ RF +L      + Y+ S++     G +        ++ +    + 
Sbjct  157  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEI--------AITEDTIVLD  208

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
              G    PF F++     R     L +  E+     +W++ CQ   DA +
Sbjct  209  RSGGGTAPFRFQI-----RSDAHTLLLEAESRDSQKRWMDSCQELADAIR  253

>SPRG_02753
Length=309

 Score = 39.3 bits (90),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 4/54 (7%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           +G+V K+G   +SW+ R++VL    L  SY+D++ V  TA    KGSF + ++E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENV--TASTKAKGSFAVITIE  56

 Score = 35.0 bits (79),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTA  72
            C G++ K G   K+W+ RF  L G  L  +YYD+ ++A +A
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSA  176

>PHYKE_4911
Length=46

 Score = 35.4 bits (80),  Expect = 0.025, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVAR  70
           G+V K+G   K+W+ RF+VL G  L  +YYD+ ++ +
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKMMK  43

>PYU1_G000724
Length=189

 Score = 38.5 bits (88),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  KSW+ RF VL  AD   +YY +K   +  G +
Sbjct  111  GWLTKQGHMWKSWKTRFFVLF-ADGTFAYYKNKGKKKMQGCM  151

>PYU1_G002632
Length=1334

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 45/107 (42%), Gaps = 13/107 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G +TK G +R++W+ RF +L      + YY S+E     G +P        +      + 
Sbjct  167  GTLTKEGSWRRNWKTRFFILRRDVPSLCYYTSEEKLELLGEIP--------ISPDTLVLD  218

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
               +   P+ F++     R     L +  E+     +W++ CQ  +D
Sbjct  219  KSASGHAPYRFQI-----RTETKTLLLEAESKDSQQRWIDSCQELVD  260

>PYIW_20891
Length=291

 Score = 38.9 bits (89),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   ++W+ RFLVL G  L  +YYD+  +  T     KGSF + +VE
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGKQL--TYYDTASL--TPKTKEKGSFQVITVE  57

 Score = 31.2 bits (69),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 6/53 (11%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            G++ K G   K+W+ R+  L+G  L  SY+DS +     G+  KG  ++  VE
Sbjct  97   GWLKKEGSRVKNWKKRYFTLHGNTL--SYFDSADT----GSAAKGYGHVKGVE  143

>SDRG_02135
Length=306

 Score = 39.3 bits (90),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 62/145 (43%), Gaps = 33/145 (23%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSK--------EVARTAGAVPKGSFYLSS  84
            EGY+ K+GH  K+WR R+  L  A L  +YYDS         ++A T   V  G      
Sbjct  2    EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDSHRHDAKRCGQIALTGATVALGDG----  55

Query  85   VEKHEYYVGVLG------AQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNK-----WLE  133
                   +G LG      A E+ F F+++  +    Y  +   V +  D ++     W+ 
Sbjct  56   -------IGSLGEGVASAADERRFVFRVIDGSSHVAYY-MCAEVPSGSDASRANAAAWVA  107

Query  134  VCQNALDAAKKLTRTGQPEALAPKS  158
              Q ++ AA   +    P AL+ ++
Sbjct  108  CVQASIRAASSTSVDSLPVALSSET  132

>CCA25510
Length=1139

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F KSWR R+ +L     +++YY SKE
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSKE  230

>PHYRA_73535
Length=875

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ KRGH RK+W+ R+ VL  +  ++ YY     A+  G V     +      H   V 
Sbjct  342  GWLRKRGHVRKNWKARYFVLEKS--VLRYYTDPSCAKLKGEV---LLFHPQTRVHYVDVH  396

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            V G ++  F  ++    P      L +    L D   W+   ++AL
Sbjct  397  VAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDAL  436

>PHYSO_343629
Length=977

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 18/23 (78%), Gaps = 0/23 (0%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNG  55
            EGYVTKRGH  ++W++RF  L G
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEG  152

>PYU1_G012274
Length=873

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (47%), Gaps = 27/139 (19%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE--VARTAGAVPKGSFYLSSVEKHEY  90
            EGY+ K+    +SW+  + VL G  +  +YY+S+E  +  T      G  ++ SVE  + 
Sbjct  312  EGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMNTKLI---GRIHIQSVE--DD  364

Query  91   YVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQ  150
            ++G      KP GF+++    R  ++       T  + ++W    + A+ AA     T  
Sbjct  365  HMG------KPNGFRILTEGHRTNHLS----SRTAFEKDQW----KRAITAAI----TKA  406

Query  151  PEALAPKSLFGFSPATSPQ  169
            PEA  P   FG  P  +P+
Sbjct  407  PEAARPHVAFGSQPLDAPK  425

>PYIR_24588
Length=909

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K GH RK+W+ R+ VL  +  ++ YY  + +AR  G V     +  +   H   + 
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKS--VLRYYADESMARLKGEV---LLFHPATRVHYVDIH  466

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            + G ++  F    VG    K Y  L +  + L D   W+   ++AL
Sbjct  467  LSGGKDCTFAIH-VG----KDYALL-LQADQLSDRENWMYCIEDAL  506

>PYIR_13555
Length=355

 Score = 38.9 bits (89),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   ++W+ R++VL G  L  +YYD+  +  TA    KGSF + +VE
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGKQL--TYYDTASL--TAKTKEKGSFQVITVE  58

 Score = 34.3 bits (77),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 29/53 (55%), Gaps = 6/53 (11%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            G++ K G   KSW+ R+  L+G  L  SYYDS +     G+  KG  ++  VE
Sbjct  160  GWLKKEGSRVKSWKKRYFTLHGNTL--SYYDSADT----GSAAKGYGHVKGVE  206

>PYAP_13695
Length=348

 Score = 38.9 bits (89),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G++ K+G   K+W+ RF+VL G  L  +YYD++ +  +     KGSF + +VE
Sbjct  12  GWIYKQGSLVKNWKRRFMVLRGKQL--TYYDTERI--SPRVKEKGSFQVITVE  60

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 19/110 (17%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++TK G   K+W+ R+  L G  L  SY+DS +     G+  KG  ++ +VE       
Sbjct  156  GWLTKEGMRVKNWKRRWFTLRGDTL--SYFDSADT----GSNAKGYGHVRAVE-------  202

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
            V G +      +        G + L +  E+  D+  WL    +A++AA+
Sbjct  203  VNGEKANSLDIRF-----DNGRI-LRVAAESSEDMQDWLCKLSDAIEAAQ  246

>PPTG_18989
Length=1213

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F KSWR RF +L     ++ YY S E
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  221

>PYAR_18690
Length=2455

 Score = 39.3 bits (90),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 6/78 (8%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAG-AVPKGSFYLSSVEKHEYY  91
             EGY+ KRGH   S R R+ VL     +++YY ++E +R +  + P GSF +  V     +
Sbjct  1138  EGYLVKRGHLVPSMRKRYCVL--VKNVLTYYLTQEDSRNSDTSQPLGSFRVEIVSD---W  1192

Query  92    VGVLGAQEKPFGFKMVGH  109
              G    Q   FG ++  H
Sbjct  1193  HGKTAMQTYEFGMELETH  1210

>PHALS_08097
Length=1069

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 55/130 (42%), Gaps = 30/130 (23%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAG--AVPKGSFYLSSVEKHEYY  91
            G++TK+G +R++W+ RF +L      + Y+ S+E     G  A+ + +  L         
Sbjct  144  GFLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEEKLDLLGDIAITQDTIILD--------  195

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELD---IFVE--TLGDLNKWLEVCQNALDA--AKK  144
                         +  GHAP +  V  D   + +E  T  +   W++ CQ   DA  A K
Sbjct  196  -------------RSGGHAPFRFQVRTDAQILLLEAATSEEQKWWIDSCQELADAIRATK  242

Query  145  LTRTGQPEAL  154
             +   +P  +
Sbjct  243  FSSQSRPNNI  252

>CCA26890
Length=1530

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 14/110 (13%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVART---AGAVPKGSFYLSSVEKHEY  90
            GY+ KRG   KS+R R++ LNG   ++SYY  K   ++       P+GS  L +V     
Sbjct  297  GYLRKRGETNKSFRRRYMELNGN--ILSYYKKKPSTKSREENKTCPRGSIQLENVTS---  351

Query  91   YVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
             +  L ++ + +G  +V  +        ++  E   + ++WL+   NA++
Sbjct  352  -LQPLESKTEKYGIVLVTTSR-----TWELVAENESEYHRWLKELCNAVE  395

>HYAP_13688
Length=1036

 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 46/107 (43%), Gaps = 21/107 (20%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++ K G   KSW+ R+  L GA L  SYY  +          KGS  L SV+     
Sbjct  698  CVGWLRKEGGNVKSWKRRYFTLYGAKL--SYYKCE----------KGSL-LRSVDT----  740

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNA  138
            VGV      P G  +     RK  ++ D  VE     ++WL   Q A
Sbjct  741  VGVTVHPSMPNGLMVATAGGRKLIIQADTNVE----FDRWLNAIQRA  783

>CCA19097
Length=688

 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 32/49 (65%), Gaps = 6/49 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYL  82
            G++ K+G   K+W+ RF +L G +L  SY+D++    + GAV KG+ Y+
Sbjct  144  GWLVKQGGRVKNWKRRFFLLRGDNL--SYFDTE----STGAVAKGTLYV  186

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 5/53 (9%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   K+W+ R++VLNG   ++ YYDS   A +     KGS  + SVE
Sbjct  9   GWVHKQGAVIKTWKRRYMVLNGN--VLKYYDS---ALSIKMEEKGSVQILSVE  56

>HYAP_06101
Length=984

 Score = 38.9 bits (89),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  KSW+ RF VL  AD   +YY +K   +  G +
Sbjct  143  GWLTKQGHLWKSWKTRFFVL-FADGTFAYYKNKGRKKIKGCM  183

>H257_10063
Length=1041

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP  76
            +GY++K+G +RK+W+ R+ +L   +  + Y DS+E     G VP
Sbjct  168  QGYLSKQGSWRKNWKHRYFILRIDEPALVYCDSEENREVLGWVP  211

>H310_02933
Length=1053

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP  76
            +GY++K+G +RK+W+ R+ +L   +  + Y DS+E     G VP
Sbjct  179  QGYLSKQGSWRKNWKRRYFILRIDEPSLVYCDSEENREVLGLVP  222

>PYAP_23478
Length=897

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (48%), Gaps = 13/107 (12%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K GH RK+W++R+ VL+ +  ++ YY  + + R      KG   L       +YV 
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKS--VLRYYSDEGMTRL-----KGEVLLFHPATQVHYVD  432

Query  94   VLGAQEKPFGFKM-VGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            +  ++ K   F + VG      Y  L +  E L D   W+   ++AL
Sbjct  433  IHESRGKDHTFAIQVG----PEYTLL-LQAERLADRENWMYCIEDAL  474

>PHYCA_12070
Length=1368

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 68/170 (40%), Gaps = 33/170 (19%)

Query  34    GYVTKR-----GHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKH  88
             GY+ K      GH R  W   + VLN +D  +SYY S+  A+    V   S  L+  E  
Sbjct  1074  GYMYKNKYPETGH-RNVWERYYFVLNRSDGSLSYYISEAHAKDRTFVRGTSRPLTVSEGL  1132

Query  89    EYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLE---VCQNALDAAKKL  145
               +V     Q   FGF++      +G+    + V+++     WL    VC          
Sbjct  1133  PMHV---NGQHSVFGFQIN----TQGHGAFMVLVDSIDTRLTWLTEILVC----------  1175

Query  146   TRTGQPEALAPKSLFGFSPATSPQQQMKKMTAT-------KEQMLKQAIE  188
                  P    PK     SP  +P+Q++   T++       KE+M +  +E
Sbjct  1176  VSNANPSPPLPKQRLSLSPDDAPKQRLSATTSSISSLKCNKEEMRELVVE  1225

>PHYRA_81944
Length=1149

 Score = 38.9 bits (89),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F KSWR RF +L     ++ YY S E
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTSAE  156

>PPTG_04553
Length=904

 Score = 38.5 bits (88),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 49/118 (42%), Gaps = 11/118 (9%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ KRGH RK+W+ R+ VL  +  ++ YY      +  G V     +      H   V 
Sbjct  364  GWLRKRGHVRKNWKARYFVLEKS--VLRYYADSSCTKLKGEV---LLFHPQTRVHYVDVH  418

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
            V G ++  F  + VG      Y  L +    L D   W+   ++AL         G+P
Sbjct  419  VAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDALLCRDSYHPQGRP  470

>H257_01308
Length=897

 Score = 38.5 bits (88),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 39/172 (23%), Positives = 71/172 (41%), Gaps = 19/172 (11%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+G   K W+ R+ V +G  L  SYY +K   +    +P  S  +      E + 
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKLEKKPNAVIPLESATVQDGGTSETW-  80

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGD-LNKWLEVCQNALDAAKKLTRTGQP  151
                    P  +   G +     +  D      GD +++WL+V   A+    +     QP
Sbjct  81   ------NSPRIYLTDGTSGTMYCLSGD-----EGDVVSQWLDVLDRAVKRIHEKRELSQP  129

Query  152  EALAPKSLFGFSPATSPQQQMKKM----TATKEQMLKQAIEEIESAKLIGRS  199
              + P+S    +P    + + K +    + T++ +L  +  +I + K  G S
Sbjct  130  IGVVPRSKSHITPFDEEEGRQKPIMSDKSPTRKALLASSFSDINATKPRGSS  181

>CCI47145
Length=390

 Score = 38.1 bits (87),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 3/53 (6%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G++ K+G   +SW+ R++VL G  L  SYYD+  +  +     KGSF + +VE
Sbjct  39  GWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVITVE  88

 Score = 31.6 bits (70),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 5/53 (9%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
            G++ K G   KSW+ R+ VL G  L  +Y+ S++   T GA  KG   + +VE
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASED---TGGASAKGFGRVCAVE  246

>CCI39367
Length=2046

 Score = 38.5 bits (88),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 46/108 (43%), Gaps = 26/108 (24%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K+GH  KSWRVRF VL   D  ++YY  +   +  G +                 G
Sbjct  86   GWLRKQGHLWKSWRVRFFVLY-TDGTLAYYRKRGDVKMKGYIKLNE-------------G  131

Query  94   VLGAQ-------EKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEV  134
            ++G Q        + + F++     RKG+  L    +T  +   W+ V
Sbjct  132  IIGIQYIDAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSV  174

>CCA24531
Length=374

 Score = 38.1 bits (87),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 3/53 (6%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G++ K+G   +SW+ R++VL G  L  SYYD+  +  +     KGSF + +VE
Sbjct  27  GWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVITVE  76

>H310_04842
Length=1081

 Score = 38.5 bits (88),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 70/174 (40%), Gaps = 32/174 (18%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EG V K+G +   W  R+LVL+G   ++ YY  ++ AR  G   +G   L+ V       
Sbjct  118  EGQVRKKGDWLPRWESRYLVLDGT--VLRYYSKQDDARL-GKHLRGKLILTHVSPE----  170

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNK--WLEVCQNALDAA-----KKL  145
             +   +E  F  +  G   RK +     F+    +L K  W+E+ Q A+  A     +  
Sbjct  171  -IHKKKEHTFAVETTG---RKMF-----FMSCDTELEKDMWVEMIQAAISEAAAPQRQHA  221

Query  146  TRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRS  199
             R GQP  +         PA+S Q     +  T      +   E++   L   S
Sbjct  222  NRHGQPPLV---------PASSAQHHHAMVPPTMHHHDPRVFHELQPPVLTKNS  266

>H257_11802
Length=783

 Score = 38.1 bits (87),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 64/140 (46%), Gaps = 16/140 (11%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE--VARTAGAVPKGSFYLSSVEKHEY  90
            EGY+ K+    K+W  R++ L   D L+SYY SK+  V RT     +GS+ +S+V+K   
Sbjct  63   EGYLYKQSKIVKTWTPRYVTLK--DGLISYYKSKKHAVERTQN---RGSWSVSAVQKTIP  117

Query  91   YVGVLGAQ--EKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRT  148
              G  G++      GF +V        + +     +  +   WL + +    AAK  T  
Sbjct  118  STGFGGSKLHASTLGFSIVT----TNQLLVHFVAISPAEREMWLHMLEKCCAAAKVQTNV  173

Query  149  --GQPEALAP-KSLFGFSPA  165
              G  EA  P +S F   P+
Sbjct  174  AEGLDEASRPSESYFHLDPS  193

>HYAP_13757
Length=262

 Score = 37.7 bits (86),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYY  63
           G++ KRGH  K+W+ RF +LNGA L  +YY
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYY  42

>PHYRA_83071
Length=2300

 Score = 38.5 bits (88),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADL--LVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL G +L   V++ DSK     A   P G F ++ V
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSKNPGGGATTAPLGKFRVAVV  1186

>H310_00912
Length=2182

 Score = 38.5 bits (88),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (48%), Gaps = 12/113 (11%)

Query  33    EGYV-TKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
             EG+V  +R HF  +W+  + VL G  L  + YD++E   TA   P     +  V   ++Y
Sbjct  1797  EGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKREVVFVG--DWY  1852

Query  92    VGV-LGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK  143
              GV  G  +  F  + +      G+VE   +V+   D  +W++  Q A+ + K
Sbjct  1853  GGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLK  1899

>PYAP_16297
Length=2466

 Score = 38.1 bits (87),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
             EGY+ KRGH   S R R+ +L     +++YY + E +R     P GSF +  V     + 
Sbjct  1168  EGYLVKRGHLVPSMRKRYCML--VKNVLTYYLTHEDSRNTEIQPLGSFRVEIVSD---WH  1222

Query  93    GVLGAQEKPFGFKMVGH  109
             G    Q   +G ++  H
Sbjct  1223  GKTTTQTYEYGMELETH  1239

>PHYSO_556164
Length=765

 Score = 38.1 bits (87),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ KRGH RK+W+ R+ VL  +  ++ YY     ++  G V     +      H   V 
Sbjct  223  GWLRKRGHVRKNWKARYFVLEKS--VLRYYTDSSCSKLKGEV---LLFHPQTRVHYVDVH  277

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            V G ++  F  + VG      Y  L +    L D   W+   ++AL
Sbjct  278  VAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  317

>SPRG_04912
Length=261

 Score = 37.4 bits (85),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 6/52 (12%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV  85
           GYV K+G F K+W+ R + L+  D  + YY    V+  A A P+G F ++SV
Sbjct  43  GYVRKQGSFVKNWKRRIMALH--DDTLFYY----VSERAMAKPRGVFRVTSV  88

>H310_01921
Length=341

 Score = 37.4 bits (85),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (62%), Gaps = 5/63 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE-KHEYYV  92
           G+V K+G   KSW+ R++VL    L  +Y++S++V   + A  KGSF + +VE  H+   
Sbjct  24  GWVYKQGSMIKSWKKRYMVLKNKQL--TYFESEKVEGNSKA--KGSFQVITVEIAHDIKN  79

Query  93  GVL  95
           G+L
Sbjct  80  GLL  82

>SDRG_02154
Length=822

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEK  87
            G++ K+G   K+W+ RF+VL    L   Y+++ ++  T    PKGSF + ++E+
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHL--HYFETDKLTPTLK--PKGSFQVLAIER  177

>PYVX_13084
Length=1267

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F K+WR R+ VL     ++SY+ SK+
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKD  275

>PHYSO_529931
Length=2211

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADL--LVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL G +L   V++ DSK     A   P G+F +  V
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNELSYFVTHDDSKNPGGGATTNPLGNFRVEVV  1043

 Score = 31.6 bits (70),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPK  77
           EGY+ K+G    S +  + VL G   ++S++ +++ A+ +GAVPK
Sbjct  2   EGYLWKKGRKVPSMKRHYAVLKGT--MLSFFVTQDEAQRSGAVPK  44

>PHYKE_1148
Length=339

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 33/75 (44%), Gaps = 4/75 (5%)

Query  34   GYVTKRGHFRKSWRVRFLVL----NGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89
            G++ K G F K WR R+ V     NG   L  Y   K+V+    + PKG   ++      
Sbjct  25   GWLKKLGRFSKRWRKRYFVFLSTSNGIKELRHYDTIKDVSTLLMSTPKGVISITDATGIC  84

Query  90   YYVGVLGAQEKPFGF  104
             +  V  A +KP  F
Sbjct  85   CFTPVPTADKKPTKF  99

>PHYRA_94409
Length=1270

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  KSW+ RF VL  +D   +YY +K   +  G +
Sbjct  113  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGRKKIKGCM  153

>PITG_03318
Length=1343

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  KSW+ RF VL  +D   +YY +K   +  G +
Sbjct  139  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGRKKIKGCM  179

>CCA15513
Length=1341

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 69/160 (43%), Gaps = 35/160 (22%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G+++K+GH  K WR RF VL  AD  ++YY      R      KG   L+         G
Sbjct  86   GWLSKQGHLWKGWRSRFFVLY-ADGTLAYY-----RRRGNVKMKGYIKLNE--------G  131

Query  94   VLGAQ-------EKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLT  146
            ++G Q        + + F++     RKG+  L    +T  +   W+    N L +A+ L 
Sbjct  132  IIGIQYIDVWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWV----NHLRSARHLA  182

Query  147  RTGQP--EALAPKSLFGFSPATSPQQQMKKMTATKEQMLK  184
               +   E  AP+   G   + +  + + K   T++ ++K
Sbjct  183  PPDKMEFELTAPEERMG---SIAVARHLNKFFVTRKPIIK  219

>PHYSO_248481
Length=1283

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  KSW+ RF VL  +D   +YY +K   +  G +
Sbjct  92   GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGRKKIKGCM  132

>SDRG_00080
Length=298

 Score = 36.6 bits (83),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 31/116 (27%), Positives = 51/116 (44%), Gaps = 25/116 (22%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            GYV K+G F K+W+ R++VL+   L   YY    V+  A   P+G F ++         G
Sbjct  75   GYVRKQGSFVKNWKRRYMVLHDDTLF--YY----VSERATTKPRGFFRVT---------G  119

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG  149
            +  A + P G    G   R+    L   +    + + W +        +++L RTG
Sbjct  120  IAYAPDLPHGLIADGTGTRR----LKFTLADNDECDAWYDTL------SERLHRTG  165

>PPTG_16044
Length=1378

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  KSW+ RF VL  +D   +YY +K   +  G +
Sbjct  139  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNKGRKKIKGCM  179

>H310_06666
Length=887

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 38/153 (25%), Positives = 60/153 (39%), Gaps = 15/153 (10%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ K+G   K W+ R+ V +G  L  SYY SK   +    +P  S  +      E + 
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKPNAVIPLESATVQDGGTSETW-  80

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGD-LNKWLEVCQNALDAAKKLTRTGQP  151
                    P  +   G +     +  D      GD +++WLEV   A+    +     QP
Sbjct  81   ------NSPRIYLTDGTSGTMYCLSGD-----EGDVVSQWLEVLDRAVKRIHEKRELSQP  129

Query  152  EALAPKSLFGFSPATSPQQQMKKMTATKEQMLK  184
                P+S    +P    + + K + A K    K
Sbjct  130  SGPVPRSKSHITPFDEEEGRQKPLHAEKSPTRK  162

>SDRG_05128
Length=512

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 19/114 (17%)

Query  33   EGYVTKRGH--FRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
            EGY+ K+    FR  W  R+  ++   L+++Y+ SKE  +  G  P+GSF LS +     
Sbjct  376  EGYLEKKSSSIFR-GWERRWFKVDTRTLVMTYFHSKE-DQMRGFAPRGSFALSRITHLVT  433

Query  91   YVGVLGAQEKPFGFKMV--------GHAPRKGYVELDIFVETLGDLNKWLEVCQ  136
            +  + G +   + F +V         HA R      ++  E+  DL  W++  +
Sbjct  434  HTHLRGNR---YAFDIVVDLGTRANPHATRT----FELRCESEADLKYWVDTIE  480

>PYU1_G003366
Length=648

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 51/112 (46%), Gaps = 23/112 (21%)

Query  44   KSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFG  103
            K+W+  F VL+G D   S        + +G  PKG   + SV++           E PFG
Sbjct  243  KTWKKHFAVLSGLDFRYS--------KGSGQPPKGFDTVHSVQEW---------HEMPFG  285

Query  104  FKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALA  155
             ++V  + R    +L ++ E   D   W+   Q +L+  K+  ++G  ++ A
Sbjct  286  IRLVLSSGR----DLPVYCEGPVDFGNWMAAFQKSLE--KQHNQSGSSKSYA  331

>HYAP_11712
Length=558

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 48/124 (39%), Gaps = 18/124 (15%)

Query  46   WRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFK  105
            W+ R+ V+   +L + Y+ S E            F   ++     +  V     KP GF+
Sbjct  42   WKKRYCVIYANELQIVYFLSLE-----------DFERRTIRGKIPFSSVHAWDGKPNGFQ  90

Query  106  MVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPA  165
                A         ++ ET  D  KWLEV Q  +D A       + E + P      SPA
Sbjct  91   FYTPADHC----FRVYTETAADQLKWLEVMQKCIDNAPDRKDGARVEYVRP---VASSPA  143

Query  166  TSPQ  169
             SP+
Sbjct  144  ASPK  147

>PYU1_G003229
Length=810

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 24/47 (51%), Gaps = 8/47 (17%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKG  78
            CEG++ KRG    +W+ RF  LNG  L   Y DS       G  PKG
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQL--QYQDS------PGENPKG  298

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 50/123 (41%), Gaps = 21/123 (17%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++ K G   K+W++R+  L G  L  +Y+ S           KG        K    
Sbjct  702  CSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKSD----------KGPLL-----KALKV  744

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
              VL  + K F  ++     RK    L I  +T  + ++WL     A+ A K+  R  + 
Sbjct  745  CYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQAVSAEKEKDRGRKS  800

Query  152  EAL  154
            E L
Sbjct  801  EPL  803

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYD  64
            G++ K+GH  KSW+ RF V+ G+   ++Y++
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGS--TITYFE  430

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (51%), Gaps = 4/63 (6%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE-KHEYYV  92
           G+ +K+G   KSW+ R+ VL G +L+   Y S+      G   KG   +  VE   E+  
Sbjct  31  GWASKQGSIIKSWKRRYFVLKGRELI---YFSERSPSGKGINEKGRLKIVGVEFTPEFTN  87

Query  93  GVL  95
           G+L
Sbjct  88  GLL  90

>PHYRA_78920
Length=453

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 57/220 (26%), Positives = 95/220 (43%), Gaps = 31/220 (14%)

Query  90   YYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTG  149
            YY  VL          M+    R+   EL+ F  ++ D+ +W++  QNALD  +      
Sbjct  246  YYSAVLA---------MLDTRARQMDAELEGFSASIDDIARWIKAVQNALDVREDRRYLY  296

Query  150  QPEALA-PKSLFGFSP-ATSPQQQMKKMTATKEQMLK-QAIEEIESAKLIGRSACQ--EI  204
            Q +  A  K++ G  P + S  +   ++ A K++  +  A    E A+  G+ A +  ++
Sbjct  297  QAQLAAHRKAVNGDGPDSPSATRLSNELVAAKDEFERVHARVMREVARFRGQKAVELKKL  356

Query  205  FIQGERLDH---------IGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDA--RDRAKN  253
            F++  +L           + Q  A +E  L    KLL   + P     S D+   D+   
Sbjct  357  FLEFAQLQLRNSKELEKIVAQSAAELETPL--PAKLLYAAQTPASMFESRDSFGLDKIDV  414

Query  254  TGRTKPS-SRDTPSAVSEETRAAILSDSHDAVGGAPLSDI  292
             G TK + S  +P+  S    A ILS +  AVG    SD+
Sbjct  415  IGTTKSTASTQSPTGSSS---AEILSKTDSAVGAQNYSDV  451

>CCI40991
Length=801

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 42/169 (25%), Positives = 66/169 (39%), Gaps = 43/169 (25%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGA------------------DLLVSYYDSKEVARTAGA  74
            EGY+ K+GH  +SWR R+ VL+G                   D  V  Y SKE+A     
Sbjct  109  EGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQSVITQLTGDCCVD-YSSKEIAMADTE  167

Query  75   VPKGSFYLSSVEKHEYYV-GVLGAQ--EKPFGFKMVGHAPRKGYVELDIFVETLGDLNKW  131
              +G   ++  E+ E    GVL +    K F  +          +E D+          W
Sbjct  168  RYRGRVTVTGAERDESRTNGVLVSTTVNKVFSIQT------SSTIESDL----------W  211

Query  132  LEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKE  180
            + +   A+  +     TGQ  +L   SL   +  +S   + + M  TK+
Sbjct  212  IRMISQAVANS-----TGQKTSLTSGSLLAQTVRSSGDLKTRNMNVTKQ  255

>PHALS_09273
Length=663

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 55/132 (42%), Gaps = 25/132 (19%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLS-----SVEK  87
            EG + KRGH  K+W+ RF  +   +L   YY   +  +  G+VP     +S       + 
Sbjct  333  EGRLLKRGHLNKNWKTRFFRIQQGEL--RYYTENQ-NKCKGSVPLKDTIVSPGMAQCPDG  389

Query  88   HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTR  147
             +YY  VL +++  F   +  H  +  ++              W+E  Q A  A  K+  
Sbjct  390  RKYYF-VLTSKDSKFEMHLNAHNEKSMHL--------------WIEALQEAQTALSKV--  432

Query  148  TGQPEALAPKSL  159
             G  E +A  SL
Sbjct  433  AGNKETVAGLSL  444

>SPRG_08326
Length=501

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 19/114 (17%)

Query  33   EGYVTKRGH--FRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEY  90
            EGY+ K+    FR  W  R+  ++   L+++Y+ SKE  +  G  P+GSF LS +     
Sbjct  368  EGYLEKKSSSIFR-GWERRWFKVDTRTLVLTYFHSKE-DQMRGFAPRGSFALSRITHLVT  425

Query  91   YVGVLGAQEKPFGFKMV--------GHAPRKGYVELDIFVETLGDLNKWLEVCQ  136
            +  + G +   + F +V         HA R      ++  E+  DL  W++  +
Sbjct  426  HAHLRGNR---YAFDIVVDLGTRANPHATRT----FELRCESEADLKYWVDTIE  472

>PHYRA_73985
Length=339

 Score = 36.2 bits (82),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 33/75 (44%), Gaps = 4/75 (5%)

Query  34   GYVTKRGHFRKSWRVRFLVL----NGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHE  89
            G++ K G F K WR R+ V     NG   L  Y   K+V+    + PKG   ++      
Sbjct  25   GWLKKLGRFSKRWRKRYFVFLSTSNGLKELRHYDTYKDVSTLLMSTPKGVISMTDATGIC  84

Query  90   YYVGVLGAQEKPFGF  104
             +  V  A +KP  F
Sbjct  85   CFTPVPTAGKKPMKF  99

>PYIW_21944
Length=1317

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++TK+GH  K+W+ RF VL  +D   +YY ++   R  G++
Sbjct  105  GWLTKQGHMWKTWKTRFFVLY-SDGTFAYYKNEGKKRMQGSL  145

>SPRG_08834
Length=825

 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEK  87
            G++ K+G   K+W+ RF+VL    L   Y+++ ++  T    PKGSF +  +E+
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHL--HYFETDKLTPTLK--PKGSFQVLVIER  177

>SDRG_14771
Length=549

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (43%), Gaps = 26/128 (20%)

Query  46   WRVRFLVLNGADLLVSYYDSKEVARTA---GAVPKGSFYLSSVEKHEYYVGVLGAQEKPF  102
            W+ R+ VL  + L + YY+S+E A      G +P              Y  V     KP 
Sbjct  34   WKRRYCVLQESALAIFYYESEEAAAEGSLKGKIP--------------YCSVHDWDGKPH  79

Query  103  GFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFG-  161
            GF+   + P        ++ ++  + NKW+   Q  LD A ++   G+   LAP +  G 
Sbjct  80   GFQF--YTPTNKCFR--VYCDSDDERNKWMTAMQAQLDNAPEVA-DGE---LAPYARNGA  131

Query  162  FSPATSPQ  169
             SP  SP+
Sbjct  132  ASPTGSPR  139

>PYU1_G012870
Length=352

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 4/53 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE  86
           G+V K+G   ++W+ RF+VL G  L  +YYD+  +  +     KGSF + + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGKQL--TYYDTASI--SPKTKEKGSFQVITAE  55

 Score = 35.4 bits (80),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (46%), Gaps = 19/107 (18%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ K G   K+W+ R+  L+G  L  SYYDS +     G+  KG  ++ SVE       
Sbjct  154  GWLKKEGSRIKNWKKRYFTLHGNTL--SYYDSADT----GSAAKGYGHVKSVE-------  200

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALD  140
            V G +E             +G + L +  +   D+ +WL +   A++
Sbjct  201  VNGERENSLDITF-----ERGRL-LRVSAKNQDDMEQWLCILSEAIE  241

>PITG_11578
Length=2131

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADL--LVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL G +L   V++ DSK     A   P G+F +  V
Sbjct  952   EGYLMKRGHKIPSMRKRYCVLIGNELTYYVTHDDSKNPGGGATTNPLGNFRVEIV  1006

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPK  77
           EGY+ KRG    S +  + VL G   ++S+Y S++ A+  GAVPK
Sbjct  2   EGYLWKRGRKVPSMKRHYAVLKGT--MLSFYLSQDEAQRPGAVPK  44

>PPTG_11714
Length=2444

 Score = 36.6 bits (83),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADL--LVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL G +L   V++ DSK     A   P G+F +  V
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNELTYYVTHDDSKNPGGGATTNPLGNFRVEIV  1197

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPK  77
           EGY+ KRG    S +  + VL G   ++S+Y +++ A+ +GAVPK
Sbjct  2   EGYLWKRGRKVPSMKRHYAVLKGT--MLSFYLTQDEAQRSGAVPK  44

>H257_10151
Length=624

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 17/111 (15%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGAD--LLVSYY---DSKEVARTAGAVPKGSFYLSSVEKH  88
            G++ KRGH R +W  R+  L   D   ++ Y+   DS       GA+   + YLS     
Sbjct  311  GFLLKRGHVRTNWVQRYFKLEKLDHHPVLRYFLHDDSSRHQTAKGAISLVNAYLSP----  366

Query  89   EYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
                G+    +    + M+      G  EL +   T GD+ +W+    NA+
Sbjct  367  ----GIPCCSDGRRNYFML----HSGSQELHLNALTEGDMRRWIHALANAI  409

>PHALS_12503
Length=340

 Score = 35.8 bits (81),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYY  63
            G++ KRGH  K+W+ RF +LNG  L  +YY
Sbjct  101  GWLWKRGHSFKTWKKRFFLLNGVAL--TYY  128

>PYU1_G012859
Length=1183

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 60/140 (43%), Gaps = 37/140 (26%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++ K+G   K+W+ R+  L+G  L       +   R  G++ + SF +S VEK    
Sbjct  811  CHGWLNKQGGTIKTWKRRYFSLHGTTL-------RYFKRETGSMLR-SFTISHVEKQ---  859

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
                   +   G +++  + RK    L +  E+  D  +WL   Q ++ A          
Sbjct  860  ------PQVALGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISA----------  899

Query  152  EALAPKSLFGFSPATSPQQQ  171
            E+  PKS       T+P QQ
Sbjct  900  ESSVPKS------PTAPVQQ  913

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 24/37 (65%), Gaps = 1/37 (3%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEV  68
            CEG++ K+GH  K W+ R+  LN  D+L   ++ ++V
Sbjct  359  CEGWLLKQGHKSKRWKRRYFTLNN-DMLEYRHEPQDV  394

 Score = 33.1 bits (74),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 6/56 (11%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKH  88
            +G++ K G   K+W+ RF+VL G   ++SYY       T  + P GS  +  VE +
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGN--VLSYY----ADETPSSPPLGSLVIRQVETN  246

 Score = 31.6 bits (70),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADL  58
            G++ K+GH  +SW+ R+ VL+G  L
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSL  521

 Score = 31.6 bits (70),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADL  58
           G+ +K+G   K+W+ RF VL G DL
Sbjct  11  GWGSKQGSKVKTWKTRFFVLRGTDL  35

>SPRG_01283
Length=291

 Score = 35.4 bits (80),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 49/108 (45%), Gaps = 12/108 (11%)

Query  34   GYVTKRGHFRKSWRVRFLVL-NGADLLVSYYDSKE-VARTAGAVPKGSFYLSSVE-KHEY  90
            G++TKRG + KSW+ R+ VL NG    V YY + E V ++   +       ++VE   +Y
Sbjct  91   GWLTKRGAWVKSWKSRWCVLYNG---FVYYYKAPEDVNQSRMCLGVIDLMGATVEVCDQY  147

Query  91   YVGVLGAQEKPFGFKM--VGHAPRKGYVELDIFVETLGDLNKWLEVCQ  136
               +       F FK+  V    R  Y        T  DL +W+  CQ
Sbjct  148  EADLTDIPYNSFVFKIDQVATENRTFY----FIAPTTRDLEEWIAACQ  191

>PYIR_14494
Length=819

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDS  65
            C G++ K G   K+W++R+  LNGA L  SY+ S
Sbjct  716  CSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 35.0 bits (79),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (63%), Gaps = 0/27 (0%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADL  58
            CEG++ KRG    +W+ RF  LNG  L
Sbjct  265  CEGWLYKRGQRSTAWKRRFFTLNGFQL  291

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 29/52 (56%), Gaps = 8/52 (15%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV  85
            G++ K+G   KSW+ RF V+   D  ++YY+    A      PKG+ +++ V
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYEQLNEA------PKGNGFINQV  465

>H257_14025
Length=243

 Score = 35.4 bits (80),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 26/106 (25%), Positives = 48/106 (45%), Gaps = 8/106 (8%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            +G++ K+      WR ++ VL G   L+S+YD+  +  T  A P       +    +  +
Sbjct  26   QGWLWKKCGVFSLWRRKYFVLCGP--LLSFYDT--LPDTCSANPSIVLSSGTCSSPQGVL  81

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNA  138
             V+  +    GFK+ G + +  +V  +          KW++VCQ A
Sbjct  82   RVVYVESTSKGFKVFGSSGKVIHVRANTSSTDF----KWVQVCQRA  123

>SPRG_09128
Length=620

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYL  82
            G++ K GH RKSW+ RF VL+G+  ++ YY + +V++      KG   L
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGS--VLQYY-TDDVSKVKTPKLKGEVLL  313

>SPRG_01654
Length=923

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 28/52 (54%), Gaps = 2/52 (4%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSS  84
           EGY+ KRG +   W   ++VL+G DL  +Y+D  ++ +    V   S  L +
Sbjct  26  EGYLRKRGDWLPRWDTYYVVLSGVDL--TYFDKSDMEKKVEYVQSNSISLPT  75

>PHALS_05587
Length=1361

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAG  73
            G++ K+GH  KSW+ RF VL  +D  V YY +K   +  G
Sbjct  139  GWLKKQGHMWKSWKARFFVL-FSDGTVVYYKNKSRKKIKG  177

>PYIW_21108
Length=2593

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  33    EGYVTKRGHFRKSWRVRFLV-LNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ V L  A L   Y+ + E +R     P GSF +  V
Sbjct  1234  EGYLVKRGHLIPSMRKRYCVLLKNASL--EYFATHEDSRNPAIRPHGSFQVEIV  1285

 Score = 32.0 bits (71),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 26/115 (23%), Positives = 48/115 (42%), Gaps = 9/115 (8%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYV  92
            EGY+ KRG    + + R+ VL G  +L  Y +  E  R   A P+    +      +   
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKGT-MLAYYTNEDECKRQ--ATPRDVLEVVQARDWDGAS  58

Query  93   GVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTR  147
             +    +  F    +G A  + +       ++L D   W++  Q+ALD   ++ +
Sbjct  59   ALRQHYKHAFEIDYLGGATYQCH------CDSLEDKQLWMQAIQHALDEPNRIVQ  107

>H257_03363
Length=316

 Score = 35.4 bits (80),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 39/63 (62%), Gaps = 5/63 (8%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVE-KHEYYV  92
           G+V K+G   KSW+ R++VL    L  +Y++++++   + A  KGSF + ++E  H+   
Sbjct  8   GWVYKQGSMVKSWKKRYMVLKNKQL--TYFENEKIEGNSKA--KGSFQVITIEIAHDIKN  63

Query  93  GVL  95
           G+L
Sbjct  64  GLL  66

>PYIW_22403
Length=673

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 29/121 (24%), Positives = 55/121 (45%), Gaps = 10/121 (8%)

Query  42   FR-KSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEK  100
            FR ++W  ++ VL+    ++ YYDS+  AR   ++ K    L+   K+       G +  
Sbjct  418  FRGRNWYRKWFVLDTRKCILRYYDSESAARKGLSMSK----LNLNHKNASLAVTSGEEAA  473

Query  101  PFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAK--KLTRTGQPEALAPKS  158
            P  +  +    ++ +    I   +L + N+W      A+  A+  K  R+G  +A+  KS
Sbjct  474  PTPYMFIARTRKRCW---KICASSLTEYNEWEHAISTAILTAQLSKRRRSGNKDAIDGKS  530

Query  159  L  159
            L
Sbjct  531  L  531

>H310_13627
Length=678

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 52/114 (46%), Gaps = 19/114 (17%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP-------KGSFYLSSVE  86
            G++ K+GH  K+W+ RF VL+G+   V  Y S++V  T   VP       KG   L   +
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGS---VLRYFSEDVDAT---VPKSTTHKLKGEVLLFHKD  323

Query  87   KHEYYVGV-LGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
               +YV + L  ++  F     G     G   L +   +L +   W+   ++A+
Sbjct  324  TTVHYVDIHLSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAI  372

>SPRG_09211
Length=549

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (43%), Gaps = 26/128 (20%)

Query  46   WRVRFLVLNGADLLVSYYDSKEVARTA---GAVPKGSFYLSSVEKHEYYVGVLGAQEKPF  102
            W+ R+ VL  + L + YY+S+E A      G +P              Y  V     KP 
Sbjct  34   WKRRYCVLQESALAIFYYESEEAAAEGSLKGKIP--------------YCSVHDWDGKPH  79

Query  103  GFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFG-  161
            GF+   + P        ++ ++  + NKW+   Q  LD A ++   G+   LAP +  G 
Sbjct  80   GFQF--YTPTNKCFR--VYCDSDDERNKWMTSMQAQLDNAPEVA-DGE---LAPYARNGA  131

Query  162  FSPATSPQ  169
             SP  SP+
Sbjct  132  ASPTGSPR  139

>PYAR_19291
Length=711

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV  75
            G++ K GH RK+W++R+ VL  +  ++ YY  + + R  G V
Sbjct  212  GWLRKLGHVRKNWKMRYFVLEKS--VLRYYADEAMTRLKGEV  251

>CCA27255
Length=1125

 Score = 35.8 bits (81),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 4/67 (6%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAV--PKGSFYL--SSVEKHE  89
            GY+ K+G +R++W+ RF +L        YY S+      G V   K +  L  +S E  +
Sbjct  167  GYLLKQGSWRRNWKSRFFMLRQDYPSFCYYKSQHKLHLLGHVRITKDTIVLQRTSSESGK  226

Query  90   YYVGVLG  96
            YY  V G
Sbjct  227  YYFQVRG  233

>PYAP_22195
Length=901

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP  76
           EGY+ K+G   K W+ R+ V NG  L  SYY S++  +    +P
Sbjct  38  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISRKDRKPNAVIP  79

>SDRG_03175
Length=934

 Score = 35.4 bits (80),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 28/52 (54%), Gaps = 2/52 (4%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSS  84
           EGY+ KRG +   W   ++VL+G DL  +Y+D  ++ +    V   S  L +
Sbjct  26  EGYLRKRGDWLPRWDTYYVVLSGVDL--AYFDKSDMEKKVEYVQSNSISLPT  75

>PYAP_16658
Length=294

 Score = 35.0 bits (79),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKE  67
            GY+ K+G F K+W+ R+ +L     +++YY S+E
Sbjct  152  GYLVKQGSFWKTWKRRYFILRRDINVLAYYTSQE  185

>PYAP_19560
Length=337

 Score = 35.0 bits (79),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 27/114 (24%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYD-----SKEVARTAGAVP-KGSFYLSSVEK  87
            G++ K+G   K+W+ RF +LNG+ L  +YY      + EV      +P KG   ++S + 
Sbjct  89   GWLWKKGASFKTWKKRFFLLNGSTL--TYYTQSCVVATEVGTRCFDMPAKGGLRVASADF  146

Query  88   HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLN---KWLEVCQNA  138
             +         E  FG ++V  + R       +FV+  GD     KWL V Q A
Sbjct  147  TD---------ETSFGIRIVSSSGRV------LFVQA-GDRTSRIKWLGVLQEA  184

>PYIR_22667
Length=749

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 23/114 (20%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLS-----SVEK  87
            EG + KRGH  K+W+ RF  +   +L   YY   +     G+VP  S  +S       + 
Sbjct  405  EGCLLKRGHVNKNWKNRFFRIEKGEL--RYYTENQ-EELKGSVPLKSTIVSPGMAQCSDG  461

Query  88   HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDA  141
             +YY  VL +              R G  E+ +       ++KW+E  Q A  A
Sbjct  462  RKYYF-VLTS--------------RDGKFEMHLNAHNESSMHKWIEAIQEAQTA  500

>PHALS_06699
Length=884

 Score = 35.4 bits (80),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 11/106 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G++ KRGH  K+W+ R+ VL+ +  ++ YY      +  G V     +      H   V 
Sbjct  338  GWLRKRGHVCKNWKDRYFVLHKS--VLRYYSDACCTKLKGEV---LLFHPQTCVHYVDVH  392

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL  139
            V G ++  F  + VG         L +  E L D   W+   ++AL
Sbjct  393  VTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIEDAL  432

>H310_07070
Length=680

 Score = 35.4 bits (80),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 48/105 (46%), Gaps = 11/105 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G + K+ +  K+W+ RF+VL G  +   YY S   +      P+G   LS V+ H   V 
Sbjct  123  GVLVKQANHLKNWKKRFMVLRGQSMF--YYVSGTTSEE--TYPRGVISLSGVDVHPLDVS  178

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNA  138
                 +K F F+ + H     Y  L +  +   DL +W+   ++A
Sbjct  179  KF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>SDRG_14286
Length=670

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVART  71
            G++ K GH RK+W+ RF VL+G+ +L  Y D    A+T
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGS-VLQYYTDDVSKAKT  313

>PITG_02106
Length=1015

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 53/125 (42%), Gaps = 29/125 (23%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++ K G   KSW+ R+  L G+ L  SYY S+          KGS   S        
Sbjct  676  CVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKSE----------KGSLLRS--------  715

Query  92   VGVLGAQEKP---FGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNAL--DAAKKLT  146
            V V+  +  P    G  +  H+ RK  ++ D   E     ++WL   Q A+  +  +KLT
Sbjct  716  VSVVSIEPHPTVSLGLVVSTHSGRKLIMQADSNEE----FDRWLSAIQGAVAGENERKLT  771

Query  147  RTGQP  151
                P
Sbjct  772  VVEAP  776

>PHYRA_78815
Length=919

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 52/120 (43%), Gaps = 22/120 (18%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            C G++ K G   K+W+ R+  L+G  L   Y+ S            G+   S    H   
Sbjct  794  CSGWLRKEGGTVKNWKRRYFTLHGPTLC--YFKSD----------NGALLRSFTVCH---  838

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQP  151
              V+  + +    ++     RK    L +  ET  DL++WL+    A+ AA+K  + G+P
Sbjct  839  --VVTLRTRKLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI-AAEKCKKHGEP  891

 Score = 33.1 bits (74),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 48/128 (38%), Gaps = 32/128 (25%)

Query  32   CEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYY  91
            CEG++ KRG     W+ R+  L G  L   Y D         +VPKG+  +         
Sbjct  275  CEGWLYKRGQRSTEWQRRYFKLKGFKL--QYQDGP-----GESVPKGAGTV---------  318

Query  92   VGVLGAQEKPFGFKMVGHAPRKGYVELD------IFVETLGDLNKWLEVCQNALDAAKKL  145
                       G K+        YV+LD      +  ++ G ++KW++   + LD   K 
Sbjct  319  ----------VGLKLGETGSNCVYVQLDSGRVLCVSADSQGQVDKWVQAICSLLDKDPKT  368

Query  146  TRTGQPEA  153
                 P A
Sbjct  369  VEKEAPTA  376

>H310_13911
Length=369

 Score = 35.0 bits (79),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 31/52 (60%), Gaps = 6/52 (12%)

Query  34  GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSV  85
           G++ K+    K+W  RF  L+G+ L  SYYDS++++      P+G   ++SV
Sbjct  30  GWMRKQKAHLKTWNRRFFALSGSTL--SYYDSEDIS----GAPRGILEVASV  75

>SDRG_08236
Length=864

 Score = 35.0 bits (79),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 2/44 (5%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP  76
           EGY+ K+G   K W+ R+ V +G  L  SYY S +  +    +P
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISSKDKKPNAVIP  64

>SPRG_08783
Length=291

 Score = 34.7 bits (78),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (47%), Gaps = 13/86 (15%)

Query  37   TKRGHFRKSWRVRFLVLNGADLLVSYYDS-KEVARTAGAVPKGSFYLSSVEKHEYYVGVL  95
            T+ GH  K+WR RF  L GA L   Y+DS +  A+  G +      + +   H   +G L
Sbjct  3    TRTGHVVKNWRRRFFRLLGASL--EYFDSHRHDAKRCGRIA----LVGATVAHGAAIGSL  56

Query  96   G------AQEKPFGFKMVGHAPRKGY  115
            G      A E+ F F++V  +    Y
Sbjct  57   GEGVASAADERRFVFRVVDGSSHVAY  82

>CCA19033
Length=1883

 Score = 35.4 bits (80),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  33    EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVART--AGAVPKGSFYLSSV  85
             EGY+ KRGH   S R R+ VL   +  + Y+++KE A +   G    G F + +V
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKEDADSFQYGLKALGEFQIGNV  1075

>H257_03931
Length=695

 Score = 35.0 bits (79),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 46/105 (44%), Gaps = 11/105 (10%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVG  93
            G + K+ +  K+W+ RF+VL G  +   YY S     +    P+G   LS V+ H     
Sbjct  113  GVLVKQANHLKNWKKRFMVLRGQSMF--YYVSG--TSSEETFPRGVISLSGVDVHPLDTA  168

Query  94   VLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNA  138
                Q   F F+ + H     Y  L +  +   DL +WL   ++A
Sbjct  169  KFKKQ---FCFE-ISHP---NYRSLYMVAKNEADLVQWLSSIKSA  206

>SPRG_01860
Length=674

 Score = 35.0 bits (79),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 2/44 (5%)

Query  33  EGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVP  76
           EGY+ K+G   K W+ R+ V +G  L  SYY S +  +    +P
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISSKDKKPNAVIP  64

>SDRG_11258
Length=279

 Score = 34.7 bits (78),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 12/108 (11%)

Query  34   GYVTKRGHFRKSWRVRFLVL-NGADLLVSYYDSKE-VARTAGAVPKGSFYLSSVEKHEYY  91
            G++TKRG + KSW+ R+ VL NG    V YY + E V ++   +       ++VE  + Y
Sbjct  79   GWLTKRGAWVKSWKSRWCVLYNG---FVYYYKAPEDVNQSRMCLGVIDLMGATVEVCDQY  135

Query  92   VGVL-GAQEKPFGFKM--VGHAPRKGYVELDIFVETLGDLNKWLEVCQ  136
               L       F FK+  V    R  Y        T  DL +W+  CQ
Sbjct  136  KAELTDIPYNSFVFKIDQVATESRTFY----FIAPTTRDLEEWIAGCQ  179

>H257_09823
Length=654

 Score = 35.0 bits (79),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 0/25 (0%)

Query  34   GYVTKRGHFRKSWRVRFLVLNGADL  58
            G++ K GH RK+W+ RF VL+G+ L
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVL  289

>PYVX_14287
Length=652

 Score = 35.0 bits (79),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  33   EGYVTKRGHFRKSWRVRFLVLNGADLLVSYY  63
            EG + KRGHF K+W+ RF  +   +LL  YY
Sbjct  312  EGCLMKRGHFNKNWKNRFFRIEKGELL--YY  340

Lambda      K        H        a         alpha
   0.315    0.131    0.370    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22852808520

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40