Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_17747147551341347052e-96
PHYRA_95903147551341354371e-55
PHYCA_11834147551341354204e-53
PHYSO_321155147551361344083e-51
PPTG_17126147551361344059e-51
PHALS_06479147551361344032e-50
PYVX_18180147551351344005e-50
PITG_18455147551321323944e-49
PYIW_19970147551301213849e-48
PHYKE_8392147551381363841e-47
PYU1_G001736147551231253812e-47
HYAP_07103147551641653626e-44
PYIR_13454147551291243483e-42
CCA17542147551201223135e-37
CCI44820147551231243083e-36
SPRG_06335147551231232737e-31
SDRG_01782147551231212729e-31
H257_06293147551231222483e-27
H310_09224147551231202381e-25
PYAP_228461114710467915e-04
CCI442321114710591850.005
CCA175211114710489840.006
PHYSO_3150171114710963780.042
PITG_137391114710563770.060
HYAP_084991114710863760.079
PPTG_092521114710563760.081
HYAP_085006526017262780.091
H310_0223565269957750.093
PYAR_232071114711263760.10
PHALS_115641114710763730.19
PYIW_142931416310445690.66
PYVX_208541114710455690.69
H310_07567111479864680.88
PYVX_18358141636245661.0
PYIW_187931475799737711.1
PHYCA_5353801114710863681.2
SDRG_0421940630951691.7
PYIR_182231416310545661.8
SPRG_0746040629863691.9
HYAP_025791561313345672.0
PHYKE_58411114712159662.1
CCA224011561310952653.2
HYAP_016067276106974673.8
CCI4190877731541115664.7
PYIW_181765793471358664.7
PHYRA_816751114710647635.0
PHYSO_288783379231378655.0
PYU1_G0131561561313156636.6
PYAR_203711099790060656.8
PHYSO_5143231416310449628.1
PYVX_156044693103944648.3
PYVX_151505606474645649.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_17747

Length=134
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAP_17747                                                            276        2e-96
PHYRA_95903                                                           172        1e-55
PHYCA_11834                                                           166        4e-53
PHYSO_321155                                                          161        3e-51
PPTG_17126                                                            160        9e-51
PHALS_06479                                                           159        2e-50
PYVX_18180                                                            158        5e-50
PITG_18455                                                            156        4e-49
PYIW_19970                                                            152        9e-48
PHYKE_8392                                                            152        1e-47
PYU1_G001736                                                          151        2e-47
HYAP_07103                                                            144        6e-44
PYIR_13454                                                            138        3e-42
CCA17542                                                              125        5e-37
CCI44820                                                              123        3e-36
SPRG_06335                                                            109        7e-31
SDRG_01782                                                            109        9e-31
H257_06293                                                            100        3e-27
H310_09224                                                            96.3       1e-25
PYAP_22846                                                            39.7       5e-04
CCI44232                                                              37.4       0.005
CCA17521                                                              37.0       0.006
PHYSO_315017                                                          34.7       0.042
PITG_13739                                                            34.3       0.060
HYAP_08499                                                            33.9       0.079
PPTG_09252                                                            33.9       0.081
HYAP_08500                                                            34.7       0.091
H310_02235                                                            33.5       0.093
PYAR_23207                                                            33.9       0.10 
PHALS_11564                                                           32.7       0.19 
PYIW_14293                                                            31.2       0.66 
PYVX_20854                                                            31.2       0.69 
H310_07567                                                            30.8       0.88 
PYVX_18358                                                            30.0       1.0  
PYIW_18793                                                            32.0       1.1  
PHYCA_535380                                                          30.8       1.2  
SDRG_04219                                                            31.2       1.7  
PYIR_18223                                                            30.0       1.8  
SPRG_07460                                                            31.2       1.9  
HYAP_02579                                                            30.4       2.0  
PHYKE_5841                                                            30.0       2.1  
CCA22401                                                              29.6       3.2  
HYAP_01606                                                            30.4       3.8  
CCI41908                                                              30.0       4.7  
PYIW_18176                                                            30.0       4.7  
PHYRA_81675                                                           28.9       5.0  
PHYSO_288783                                                          29.6       5.0  
PYU1_G013156                                                          28.9       6.6  
PYAR_20371                                                            29.6       6.8  
PHYSO_514323                                                          28.5       8.1  
PYVX_15604                                                            29.3       8.3  
PYVX_15150                                                            29.3       9.4  

>PYAP_17747
Length=134

 Score = 276 bits (705),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)

Query  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
            MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI
Sbjct  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60

Query  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ  120
            GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ
Sbjct  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ  120

Query  121  HFMDRGVAPPKPIF  134
            HFMDRGVAPPKPIF
Sbjct  121  HFMDRGVAPPKPIF  134

>PHYRA_95903
Length=134

 Score = 172 bits (437),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 2/135 (1%)

Query  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
            MA  ELRPLYK+LLRLA+SLP E KR+ ++ QIR EFRS ++  DPKEV+AL+QRAQ+ +
Sbjct  1    MAARELRPLYKKLLRLAQSLP-EPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59

Query  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRR  119
            GYLKIVTPR+ ++ G++ ++Y NG+RV++ +V+   EE ARYKT D EG ++RH+QLLRR
Sbjct  60   GYLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRR  119

Query  120  QHFMDRGVAPPKPIF  134
            QHFMDR   PP+PIF
Sbjct  120  QHFMDRKSGPPRPIF  134

>PHYCA_11834
Length=134

 Score = 166 bits (420),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 108/135 (80%), Gaps = 2/135 (1%)

Query  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
            MA  ELRPLYK+LLRLA+SLP E KR+ ++ QIR EFRS +D  DPKEV+ L+QRAQ+ +
Sbjct  1    MAARELRPLYKKLLRLAQSLP-EPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSL  59

Query  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRR  119
            GYLKIVTPR+ ++ GV+ F+Y +GKRV++ +++ + EE AR+KT D E  ++RH+QLLRR
Sbjct  60   GYLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRR  119

Query  120  QHFMDRGVAPPKPIF  134
            Q+FMDR   PP+PIF
Sbjct  120  QYFMDRKSGPPRPIF  134

>PHYSO_321155
Length=136

 Score = 161 bits (408),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 2/134 (1%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            A  ELRPLYK+LLRLA+SLP E KRE ++ QIR EFRS  D  DP+ V+AL+QRAQ+ + 
Sbjct  4    AARELRPLYKKLLRLAQSLP-EPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLS  62

Query  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQ  120
            YLKIVTPR  ++ GV+ F+Y NG+RV++++ + + EE ARYKT D E  ++RH+QLLRRQ
Sbjct  63   YLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQ  122

Query  121  HFMDRGVAPPKPIF  134
            +FMDR   PP+PIF
Sbjct  123  YFMDRKSGPPRPIF  136

>PPTG_17126
Length=136

 Score = 160 bits (405),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 107/134 (80%), Gaps = 2/134 (1%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            A  ELRPLYK+LLRLA+SLP E KR++++ QIR +FR+  D  DP+EV+AL+QRAQ+ + 
Sbjct  4    AMRELRPLYKKLLRLAQSLP-EPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS  62

Query  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQ  120
            YLKIVTPR+ ++ GV+ ++Y NG+RV++ + + + EE AR+KT D EG +RRH+QLLRRQ
Sbjct  63   YLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQ  122

Query  121  HFMDRGVAPPKPIF  134
            +F+DR   PP+PIF
Sbjct  123  YFLDRKSGPPRPIF  136

>PHALS_06479
Length=136

 Score = 159 bits (403),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 104/134 (78%), Gaps = 2/134 (1%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            AT ELRPLYK+LLRLA++LP + KR++++ QIR EFR  +D  DPKEV+  +QRAQ+ + 
Sbjct  4    ATRELRPLYKKLLRLAQNLP-QSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLS  62

Query  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQ  120
            YLKI+TPR+ ++ GV+ F+Y NG+RV+++D + +  E AR+KT D E   +RH+QLLRRQ
Sbjct  63   YLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQ  122

Query  121  HFMDRGVAPPKPIF  134
            +FMDR   PP+PIF
Sbjct  123  YFMDRKSGPPRPIF  136

>PYVX_18180
Length=135

 Score = 158 bits (400),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 106/134 (79%), Gaps = 2/134 (1%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            + +ELRPLYK+LLRLA+SLP E KR +T+ QIR+EFRS  +  D  EVA L+QRAQ+++G
Sbjct  3    SPAELRPLYKKLLRLAQSLP-EPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLG  61

Query  62   YLKIVTPRSTADAGVKSFVYVNGKRV-DSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ  120
            YLKIVTPR  + +GVK ++Y NG+RV   +     E+GARYKT D EG ++RH+QLLRRQ
Sbjct  62   YLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQ  121

Query  121  HFMDRGVAPPKPIF  134
            HFMDRGVAPP+PIF
Sbjct  122  HFMDRGVAPPRPIF  135

>PITG_18455
Length=132

 Score = 156 bits (394),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 106/132 (80%), Gaps = 2/132 (2%)

Query  4    SELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63
            SELRPLYK+LLRLA+SLP E KR++++ QIR +FRS  D  DPKEV+AL+QRAQ+ + YL
Sbjct  2    SELRPLYKKLLRLAQSLP-EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

Query  64   KIVTPRSTADAGVKSFVYVNGKRVDSSDVQTRE-EGARYKTIDFEGNMRRHNQLLRRQHF  122
            KIVTPR+ ++ GV+ ++Y NG+RV++++ + +  E AR+K  D EG ++RH+QLL+RQ+F
Sbjct  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  123  MDRGVAPPKPIF  134
            M+R   PP+PIF
Sbjct  121  MNRKSGPPRPIF  132

>PYIW_19970
Length=130

 Score = 152 bits (384),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 98/121 (81%), Gaps = 3/121 (2%)

Query  5    ELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLK  64
            +LRP+YK+LL+LAK+LP E KRE T QQIRSEFRS K+  DPKE+ AL+ RAQ+ I YLK
Sbjct  12   DLRPVYKKLLQLAKTLP-EGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLK  70

Query  65   IVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMD  124
            IVTPR ++DAGVK+++Y NG+RV+++ V   E+GA+Y+  D+ G M RH +LLRRQHFMD
Sbjct  71   IVTPRKSSDAGVKNYIYKNGQRVEAAAVM--EDGAKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  125  R  125
            R
Sbjct  129  R  129

>PHYKE_8392
Length=138

 Score = 152 bits (384),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 105/136 (77%), Gaps = 4/136 (3%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            A  ELRPLYK+LLR+A++LP E KR  ++ QIR EFR+  D  DPKEV+ L+Q AQ+ + 
Sbjct  4    AARELRPLYKKLLRMAQALP-EPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLS  62

Query  62   YLKIVTPR--STADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLR  118
            YLKIVTPR  + +++GV+ ++Y NG+RV++++++ + EE ARYKT D E  ++RH+QL+R
Sbjct  63   YLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMR  122

Query  119  RQHFMDRGVAPPKPIF  134
            RQHFMDR   PP+P+F
Sbjct  123  RQHFMDRKSGPPRPMF  138

>PYU1_G001736
Length=123

 Score = 151 bits (381),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
            MA+S+LRP+YK+LL+LA++LP + KR+ T++QIR EFR+     DPKE+AAL+ RAQ+ I
Sbjct  1    MASSDLRPMYKKLLKLAQTLPAD-KRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI  59

Query  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ  120
            GYLKIVTPR+T+DAGVK++VY+ GKRV+++     E+GARYKT D+   M+RH QLLRRQ
Sbjct  60   GYLKIVTPRATSDAGVKNYVYIKGKRVEAA--GAAEDGARYKTADYNAQMQRHVQLLRRQ  117

Query  121  HFMDR  125
            HFMDR
Sbjct  118  HFMDR  122

>HYAP_07103
Length=164

 Score = 144 bits (362),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 104/165 (63%), Gaps = 37/165 (22%)

Query  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65
            +RPLYK+LLRLA+SLP E KR+ ++ QIR EFR   D  DPKEV++L+QRAQ+ I +LKI
Sbjct  1    MRPLYKKLLRLAQSLP-EPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59

Query  66   VTPRSTA-----------------------------------DAGVKSFVYVNGKRVDSS  90
            VTPR+ +                                   D G++ FVY +GKR+D++
Sbjct  60   VTPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAA  119

Query  91   DVQTR-EEGARYKTIDFEGNMRRHNQLLRRQHFMDRGVAPPKPIF  134
            +++ + EE ARYKT D E  M+RH+QLLRRQHFMDR   PP+PIF
Sbjct  120  ELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYIR_13454
Length=129

 Score = 138 bits (348),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 100/124 (81%), Gaps = 3/124 (2%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            A  +LRP+YK+LL+LAK+LP E KR+AT+ QIRSEFR+ KD  DPKE+ AL+ RAQ+ IG
Sbjct  8    ALGDLRPVYKKLLKLAKTLP-EGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIG  66

Query  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQH  121
            YLKIVTPR ++DAGVK+++Y NG+RV+++ V   E+GA+Y   D+   M+RH +LLRRQH
Sbjct  67   YLKIVTPRKSSDAGVKNYIYKNGQRVEATSVL--EDGAKYSIPDYNAQMQRHQKLLRRQH  124

Query  122  FMDR  125
            FMDR
Sbjct  125  FMDR  128

>CCA17542
Length=120

 Score = 125 bits (313),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 90/122 (74%), Gaps = 3/122 (2%)

Query  4    SELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63
            S+ R +YKRL+RLAKSLP E K+ AT+  IR+EFR  +D  DP +++ L++RAQ+ IGYL
Sbjct  2    SDTRSIYKRLIRLAKSLPAE-KQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60

Query  64   KIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFM  123
            KIVTP   +D+GVK F++ +G+R++ +   +  E AR+K  D    ++RH+QLLRRQHFM
Sbjct  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKAS--ERARFKVQDIGEGLKRHHQLLRRQHFM  118

Query  124  DR  125
            DR
Sbjct  119  DR  120

>CCI44820
Length=123

 Score = 123 bits (308),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 93/124 (75%), Gaps = 3/124 (2%)

Query  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61
            A +E R ++K++++LAKSLP E K+  T+  IR+EFR  +D  DP ++A L++RAQ+ IG
Sbjct  3    AVNETRRIFKKMVKLAKSLPVE-KQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIG  61

Query  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQH  121
            YLKIVTP   +D+GVK FVY +G+R++ S +Q  E+ A++K  D E  ++RHNQL+RRQ+
Sbjct  62   YLKIVTPHKRSDSGVKHFVYKDGERIEKS-LQAGEK-AKFKVQDMEEGLKRHNQLIRRQY  119

Query  122  FMDR  125
            FMDR
Sbjct  120  FMDR  123

>SPRG_06335
Length=123

 Score = 109 bits (273),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 4/123 (3%)

Query  4    SELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63
            + +R  YK+LL+LAKS+P E +R  T++++R+EFR+   A  P+E+  L+++AQ+KI YL
Sbjct  3    TTIRAAYKKLLKLAKSVPQE-QRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYL  61

Query  64   KIVTPRSTADAGVKS-FVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHF  122
            KIVTP+ +   G  + FVY NG+R+D  ++    + A  KT D+   M +H QL+RRQHF
Sbjct  62   KIVTPKKSPSPGQGNHFVYKNGQRIDGRELSA--DSATIKTADYNAMMTKHVQLVRRQHF  119

Query  123  MDR  125
            MDR
Sbjct  120  MDR  122

>SDRG_01782
Length=123

 Score = 109 bits (272),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 85/121 (70%), Gaps = 4/121 (3%)

Query  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65
            +R  YK+LL+LAKS+P E +R  T++++R EFR+ + A  P+E+  L+++AQ+KI YLKI
Sbjct  5    IRAAYKKLLKLAKSVPQE-QRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKI  63

Query  66   VTPRSTADAGVKS-FVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMD  124
            VTP+ ++ +   S FVY NG+R+D  ++    + A  KT D+   M +H QL+RRQHFMD
Sbjct  64   VTPKKSSSSTQGSHFVYKNGQRIDGRELSA--DSATIKTHDYNAMMTKHVQLVRRQHFMD  121

Query  125  R  125
            R
Sbjct  122  R  122

>H257_06293
Length=123

 Score = 100 bits (248),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 80/122 (66%), Gaps = 6/122 (5%)

Query  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65
            +R  YK+L++LA+SLP + K  A + +IR +FRS       +E+  LV +AQ+KI YLKI
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTA-LDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKI  63

Query  66   VTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGAR--YKTIDFEGNMRRHNQLLRRQHFM  123
            VTP+ T  +G + F+Y +GKR+DS   Q+ ++G     KT D    M RH +L+RRQHFM
Sbjct  64   VTPKRTPQSGPQRFIYKDGKRLDS---QSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  124  DR  125
            DR
Sbjct  121  DR  122

>H310_09224
Length=123

 Score = 96.3 bits (238),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 75/120 (63%), Gaps = 2/120 (2%)

Query  6    LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65
            +R  YK+L++LA+SLP E K  A + ++R EFRS        ++  +V +AQ+KI YLKI
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVA-LDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKI  63

Query  66   VTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMDR  125
            VTP+       + ++Y +GKR+D   +  +   A  KT+DF   M RH +L+RRQHFMDR
Sbjct  64   VTPKRAPQTSPQRYIYKDGKRLDPGCID-QSTNATIKTVDFNAMMERHVKLVRRQHFMDR  122

>PYAP_22846
Length=104

 Score = 39.7 bits (91),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 4/67 (6%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI---  65
           LY+ +L+LAK  P   KR+A +Q I+ EF   K A D + +   +  AQA I  L +   
Sbjct  10  LYRHILKLAKQYPSV-KRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSMYAT  68

Query  66  VTPRSTA  72
           + P STA
Sbjct  69  LNPSSTA  75

>CCI44232
Length=105

 Score = 37.4 bits (85),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 49/91 (54%), Gaps = 18/91 (20%)

Query  1   MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
           M  +++  LY+R+LRLA+  P   KR+A ++ IR EFR  ++   P   AA+ Q+     
Sbjct  1   MERAQIFGLYRRILRLARRYPS-IKRDAIVEDIRLEFRESRNIARP---AAIEQKI----  52

Query  61  GYLKIVTPRSTADAGVKSF-VYVNGKRVDSS  90
                    ++A+AG+K   +Y N   V+++
Sbjct  53  ---------ASANAGIKELMMYANLNPVEAN  74

>CCA17521
Length=104

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 44/89 (49%), Gaps = 18/89 (20%)

Query  1   MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
           M  +++  LY+R+LRLA+  P   KR+A +  IR EFR  +D       AA++    A  
Sbjct  1   MERTQIFGLYRRILRLARRYP-SIKRDAIINDIRMEFRESRDI----TTAAIIDHKIA--  53

Query  61  GYLKIVTPRSTADAGVKSFV-YVNGKRVD  88
                     +A+AG+K  + Y N   VD
Sbjct  54  ----------SANAGIKELLMYANLNPVD  72

>PHYSO_315017
Length=109

 Score = 34.7 bits (78),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62
           T E+  +Y+R+L+LA+  P   KRE+ ++ I++EF + KD  D +++   +   +A I  
Sbjct  4   TKEVLRMYRRILKLAQRYPSV-KRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKE  62

Query  63  LKI  65
           L +
Sbjct  63  LSM  65

>PITG_13739
Length=105

 Score = 34.3 bits (77),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62
           T E+  +Y+R+L+LA+  P   KRE+ ++ I++EF + KD  D +++   +   +A I  
Sbjct  4   TREVLRMYRRILKLAQRYPSI-KRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITE  62

Query  63  LKI  65
           L +
Sbjct  63  LSM  65

>HYAP_08499
Length=108

 Score = 33.9 bits (76),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62
            +E+  +Y+R+L+LA+  P   KR++ +  I+SEFR+ ++  D ++V   +   QA I  
Sbjct  4   ANEVLRMYRRILKLAQRYP-SIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKE  62

Query  63  LKI  65
           L +
Sbjct  63  LSM  65

>PPTG_09252
Length=105

 Score = 33.9 bits (76),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62
           T E+  LY+R+L+LA+  P   KRE+ ++ I++EF + K+  D +++   +   +A I  
Sbjct  4   TKEVLRLYRRILKLAQRYPSV-KRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITE  62

Query  63  LKI  65
           L +
Sbjct  63  LSM  65

>HYAP_08500
Length=172

 Score = 34.7 bits (78),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 1/62 (2%)

Query  4    SELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63
            +E+  +Y+R+L+LA+  P   KR++ +  I+SEFR+ ++  D ++V   +   QA I  L
Sbjct  69   NEVLRMYRRILKLAQRYP-SIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKEL  127

Query  64   KI  65
             +
Sbjct  128  SM  129

>H310_02235
Length=99

 Score = 33.5 bits (75),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKI  65
           LY+++ R A  +P + + E   +++RSE+   +   DP+ +  L++ A  ++  L+I
Sbjct  26  LYRKIYRTAGRMPTKDRTEFVRRRLRSEYDKYRHETDPERIEFLIKVADTQLDTLEI  82

>PYAR_23207
Length=112

 Score = 33.9 bits (76),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 2/63 (3%)

Query  2   ATS-ELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
           ATS E+  LY+R+L+LAK  P   KR+A ++ I+ EF   K   D   +   +  AQA I
Sbjct  5   ATSREVVRLYRRVLQLAKQYPS-IKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGI  63

Query  61  GYL  63
             L
Sbjct  64  KEL  66

>PHALS_11564
Length=107

 Score = 32.7 bits (73),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 35/63 (56%), Gaps = 1/63 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62
           T ++  +Y+RLL+LA+  P   KREA ++ I+ EF +     D +++   +  A A I  
Sbjct  4   TKQVLRVYRRLLKLAQHYPSI-KREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKE  62

Query  63  LKI  65
           L +
Sbjct  63  LSM  65

>PYIW_14293
Length=104

 Score = 31.2 bits (69),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQ-IRSEFRSVKDAGDPKEVAAL  52
           LY+  +RLAK +    K+ + ++  IR EF   +D  DP+++ AL
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEAL  57

>PYVX_20854
Length=104

 Score = 31.2 bits (69),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 33/55 (60%), Gaps = 1/55 (2%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63
           LY+R+L+LA+  P   KR++ ++ I++EF   K   D ++V   +  A+A I  L
Sbjct  10  LYRRILKLAQRYPSV-KRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>H310_07567
Length=98

 Score = 30.8 bits (68),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query  1   MATSELRP-LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAK  59
           M+ S   P +Y+R+L+LAK  P   KR+  ++ I++EF   K   DP ++   V  A   
Sbjct  1   MSASPTVPQIYRRVLQLAKKFP-SIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKG  59

Query  60  IGYL  63
           I  L
Sbjct  60  IQQL  63

>PYVX_18358
Length=62

 Score = 30.0 bits (66),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query  9   LYKRLLRLAKSLPDEHKR-EATMQQIRSEFRSVKDAGDPKEVAAL  52
           LY+  LRLAK +  + K+ EA  + +R EF   +   DP+++ AL
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEAL  45

>PYIW_18793
Length=997

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  78   SFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHN  114
            +   VNG ++D    +TR  G    T+ F+G+ RR N
Sbjct  115  ALAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGN  151

>PHYCA_535380
Length=108

 Score = 30.8 bits (68),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (56%), Gaps = 1/63 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGY  62
           T E+  +Y+R+L+LA   P   KRE+ ++ I++EF + K   D + +   +   +A I  
Sbjct  4   TKEVLRMYRRILKLAHRYPSI-KRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKE  62

Query  63  LKI  65
           L +
Sbjct  63  LSM  65

>SDRG_04219
Length=309

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 7/51 (14%)

Query  25   KREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTADAG  75
            KREAT++ I +  ++ KD+GD   ++  +Q+         +  P +TADAG
Sbjct  150  KREATIKYILTRLQATKDSGDV--ISLYIQKQNG-----DVCDPTTTADAG  193

>PYIR_18223
Length=105

 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQ-IRSEFRSVKDAGDPKEVAAL  52
           LY+  +RLAK +  + K+   ++  +R EF   +D  DP+++ AL
Sbjct  14  LYRDCMRLAKHIGGKSKKGIAIKSLVRREFEKARDETDPEKIEAL  58

>SPRG_07460
Length=298

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query  18   KSLPDEH-----KREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTA  72
            K  PDE      KREA ++ I +  +++KD+GD     A+    Q + G L    P +TA
Sbjct  127  KQQPDEDMSSAAKREAMIKYILARLQAIKDSGD-----AITLYIQTQNGDL--CDPTTTA  179

Query  73   DAG  75
            DAG
Sbjct  180  DAG  182

>HYAP_02579
Length=133

 Score = 30.4 bits (67),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 22/45 (49%), Gaps = 0/45 (0%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALV  53
           LY + LR A+  P   +RE     +R + RS  D  DP  V  L+
Sbjct  15  LYAQCLRSARRCPQWEQREMMKMYVRMKLRSEIDTQDPDRVRTLL  59

>PHYKE_5841
Length=121

 Score = 30.0 bits (66),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 36/59 (61%), Gaps = 1/59 (2%)

Query  5   ELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63
           E+  +Y+R+L+LA+  P   KR++ ++ I++EF + K   D +++   +  A+A I  L
Sbjct  6   EVTRMYRRILKLAQRYPSV-KRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>CCA22401
Length=109

 Score = 29.6 bits (65),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 14/52 (27%), Positives = 26/52 (50%), Gaps = 0/52 (0%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60
           LY+  LR A+  P+   RE     I+ +FR  +   DP+ +  L++    ++
Sbjct  8   LYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDPRAIKLLLREGNEEL  59

>HYAP_01606
Length=1069

 Score = 30.4 bits (67),  Expect = 3.8, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 34/74 (46%), Gaps = 20/74 (27%)

Query  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQ--LLR  118
            G   +V PRS   AG        GKR         E GAR+K+  F G + RH+   LL+
Sbjct  761  GGFPVVVPRSQDAAG-------GGKR--------PEFGARHKSPRFSGIINRHHMAVLLQ  805

Query  119  RQHFMDRGVAPPKP  132
            R+ F    V  P+P
Sbjct  806  RKDFF---VEKPEP  816

>CCI41908
Length=1541

 Score = 30.0 bits (66),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 48/115 (42%), Gaps = 17/115 (15%)

Query  22    DEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTADAGVKSFVY  81
             D H   A+M  +         +G P  V  L+  A  K+G L  +  ++ A    +    
Sbjct  1159  DTHHNVASMATV---------SGTPGRVEDLLV-APGKVGELDAIGSQAVAGFVTEEDTL  1208

Query  82    VNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLR--RQHFMDRGVAPPKPIF  134
             +NG+   ++   T+EEG         GN+ R  QL +  R  F + G AP  P+ 
Sbjct  1209  INGELNWTAHDNTKEEGE-----GVAGNLARTEQLAQAGRDIFGEGGEAPQGPLM  1258

>PYIW_18176
Length=713

 Score = 30.0 bits (66),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 29/58 (50%), Gaps = 5/58 (9%)

Query  65   IVTPRSTADAGVKSFVYVNG---KRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRR  119
            I T R      V+ F YV G   +RV   D     EG +   + FEG+MR +N+++ +
Sbjct  50   IATQRENIREDVEEFAYVLGLLKQRV--GDQSKLSEGLQLTILRFEGDMRHYNRVMAK  105

>PHYRA_81675
Length=106

 Score = 28.9 bits (63),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 30/47 (64%), Gaps = 1/47 (2%)

Query  3   TSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEV  49
           T E+  +Y+R+L+LA+  P   KR + ++ I++EF + K   D +++
Sbjct  4   TKEVVRMYRRILKLAQRYPSI-KRASIIRDIKTEFHANKHLTDAQKI  49

>PHYSO_288783
Length=313

 Score = 29.6 bits (65),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 20/78 (26%), Positives = 38/78 (49%), Gaps = 9/78 (12%)

Query  16   LAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTADAG  75
            +  +L D H  E   + IR+     KD  + K +A  +Q+AQ    ++ + +P+      
Sbjct  228  IVSTLTDHHGDEGLAKLIRA----AKDVEETKTLAMDLQKAQVDNWFVAMESPKD-----  278

Query  76   VKSFVYVNGKRVDSSDVQ  93
            VK ++ V G   D+++ Q
Sbjct  279  VKKWLGVKGATSDTAEAQ  296

>PYU1_G013156
Length=131

 Score = 28.9 bits (63),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 28/56 (50%), Gaps = 0/56 (0%)

Query  9   LYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLK  64
           LY + LR A+  P   +RE     ++ +FR   D  DP  +  L+  A+ ++  ++
Sbjct  14  LYAQCLRSARKCPQWEQREMMKAYVKMKFRHDADVQDPARIQRLLADAREELDQME  69

>PYAR_20371
Length=900

 Score = 29.6 bits (65),  Expect = 6.8, Method: Composition-based stats.
 Identities = 19/60 (32%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query  13   LLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTA  72
            L++    L D HK +  +QQ+ +    V   GDP      V+  QA +G  K   PR  A
Sbjct  651  LIKYKNKLQDAHKDDDAVQQMTAATDVVIFTGDPARALEHVKTMQATLG--KAQCPRLIA  708

>PHYSO_514323
Length=104

 Score = 28.5 bits (62),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  9   LYKRLLRLAKSLPDEHKR-EATMQQIRSEFRSVKDAGDPKEVAALVQRA  56
           LY+  +RLAK +    K+ +A  + +R EF   +   DP+++ AL   A
Sbjct  14  LYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANA  62

>PYVX_15604
Length=1039

 Score = 29.3 bits (64),  Expect = 8.3, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 0/44 (0%)

Query  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAG  44
            M T E+  L  RL  LA+S PD+  R   + + RSE   V   G
Sbjct  663  MPTDEINKLLPRLQVLARSSPDDKFRLVNLLKDRSEVVGVTGDG  706

>PYVX_15150
Length=746

 Score = 29.3 bits (64),  Expect = 9.4, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query  37   FRSVKDAGDPKEVAALVQ--RAQAKIGYLKIVTPRSTADAGVKSF  79
            FRS  D  +   V  +++  R+   + YL +V PR   DA ++ F
Sbjct  614  FRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQHDASLERF  658

Lambda      K        H        a         alpha
   0.319    0.133    0.372    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408956100

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40