Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAP_17746147571169116959650.0
PYIR_13453147571186121129020.0
PYIW_187931475799799227950.0
PYU1_G0017341475780079125650.0
PPTG_17128147571177117624840.0
PITG_18457147571170117124410.0
PHYRA_95901147571075114924080.0
PHALS_06477147571166116523520.0
H310_09212147571113116221280.0
H257_06305147571099115120970.0
SDRG_01764147571092116620710.0
PHYCA_344751475769272020020.0
SPRG_063541475788491418770.0
CCI45122147571105116615750.0
CCA18898147571147116315360.0
PYAR_135811475773041910384e-125
PHYKE_8394147574282236524e-74
PHYSO_3211571475711802843701e-34
CCI41703152394151899940.061
SPRG_192655362220069940.067
H257_023885362229355920.12
PYU1_G00398883760262194890.12
PHYKE_382447891297113900.20
PITG_0563147891859113880.36
SDRG_116725362219365880.36
SPRG_02231140501283158870.39
PHYSO_3891087103102483870.40
PHYRA_9706810613148877860.51
H257_14431143672148101860.53
SPRG_03605123866112140860.57
SPRG_014066161166372860.58
PHYRA_7309647891841105860.63
SPRG_21053108131121117850.67
PYVX_15212143671907101850.68
HYAP_1135847891851112850.82
H257_0099314050134274841.0
PYU1_G01223714367148152841.0
PYAP_1338024621372105831.2
H310_05643123786131656831.2
H310_0037514050131592831.2
PPTG_128797103129884831.2
PYIW_20703495107789821.8
PYAP_2213011179582127811.8
PYAP_2161514050137644812.0
CCA1843410613198549812.1
CCA18292153450198549812.1
PPTG_0279547891861115812.1
PHYSO_360938495120050812.1
H310_025561421110646812.2
PYU1_G008807104789173732.4
PYIW_131544789182669812.5
PPTG_17651143671871104802.5
H257_097374789180073802.7
H310_023525362219353802.8
HYAP_08623140501187150793.5
PYU1_G013320108131348112793.6
PITG_1796314367178349793.7
PHALS_01137495133257794.1
PHYSO_35906247891775105784.3
PYIR_22258495132391784.6
CCI46586126131371130784.7
SDRG_16344123785120263784.9
HYAP_00989495133055784.9
PYAP_13302495124146785.0
PYAP_14743252294733785.1
PITG_085407103108664785.3
PYIW_2199311450132191785.4
CCA20563495130363775.6
CCA18606153619130363775.6
PPTG_1234810613187041775.7
HYAP_1285012378697855776.1
PYU1_G0084564949025354756.1
CCI4663810613198976776.1
CCI49118161986198976776.1
SDRG_0665259281450107776.1
PHYCA_57464714367845127776.1
H257_086551274488647697.6
H257_019521887908127768.5
PITG_1306510613188363768.9
PYIR_138494789140569769.1
H310_112724789179953769.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAP_17746

Length=1169
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAP_17746                                                            2302       0.0   
PYIR_13453                                                            1122       0.0   
PYIW_18793                                                            1081       0.0   
PYU1_G001734                                                          992        0.0   
PPTG_17128                                                            961        0.0   
PITG_18457                                                            944        0.0   
PHYRA_95901                                                           932        0.0   
PHALS_06477                                                           910        0.0   
H310_09212                                                            824        0.0   
H257_06305                                                            812        0.0   
SDRG_01764                                                            802        0.0   
PHYCA_34475                                                           775        0.0   
SPRG_06354                                                            727        0.0   
CCI45122                                                              611        0.0   
CCA18898                                                              596        0.0   
PYAR_13581                                                            404        4e-125
PHYKE_8394                                                            255        4e-74 
PHYSO_321157                                                          147        1e-34 
CCI41703                                                              40.8       0.061 
SPRG_19265                                                            40.8       0.067 
H257_02388                                                            40.0       0.12  
PYU1_G003988                                                          38.9       0.12  
PHYKE_3824                                                            39.3       0.20  
PITG_05631                                                            38.5       0.36  
SDRG_11672                                                            38.5       0.36  
SPRG_02231                                                            38.1       0.39  
PHYSO_389108                                                          38.1       0.40  
PHYRA_97068                                                           37.7       0.51  
H257_14431                                                            37.7       0.53  
SPRG_03605                                                            37.7       0.57  
SPRG_01406                                                            37.7       0.58  
PHYRA_73096                                                           37.7       0.63  
SPRG_21053                                                            37.4       0.67  
PYVX_15212                                                            37.4       0.68  
HYAP_11358                                                            37.4       0.82  
H257_00993                                                            37.0       1.0   
PYU1_G012237                                                          37.0       1.0   
PYAP_13380                                                            36.6       1.2   
H310_05643                                                            36.6       1.2   
H310_00375                                                            36.6       1.2   
PPTG_12879                                                            36.6       1.2   
PYIW_20703                                                            36.2       1.8   
PYAP_22130                                                            35.8       1.8   
PYAP_21615                                                            35.8       2.0   
CCA18434                                                              35.8       2.1   
CCA18292                                                              35.8       2.1   
PPTG_02795                                                            35.8       2.1   
PHYSO_360938                                                          35.8       2.1   
H310_02556                                                            35.8       2.2   
PYU1_G008807                                                          32.7       2.4   
PYIW_13154                                                            35.8       2.5   
PPTG_17651                                                            35.4       2.5   
H257_09737                                                            35.4       2.7   
H310_02352                                                            35.4       2.8   
HYAP_08623                                                            35.0       3.5   
PYU1_G013320                                                          35.0       3.6   
PITG_17963                                                            35.0       3.7   
PHALS_01137                                                           35.0       4.1   
PHYSO_359062                                                          34.7       4.3   
PYIR_22258                                                            34.7       4.6   
CCI46586                                                              34.7       4.7   
SDRG_16344                                                            34.7       4.9   
HYAP_00989                                                            34.7       4.9   
PYAP_13302                                                            34.7       5.0   
PYAP_14743                                                            34.7       5.1   
PITG_08540                                                            34.7       5.3   
PYIW_21993                                                            34.7       5.4   
CCA20563                                                              34.3       5.6   
CCA18606                                                              34.3       5.6   
PPTG_12348                                                            34.3       5.7   
HYAP_12850                                                            34.3       6.1   
PYU1_G008456                                                          33.5       6.1   
CCI46638                                                              34.3       6.1   
CCI49118                                                              34.3       6.1   
SDRG_06652                                                            34.3       6.1   
PHYCA_574647                                                          34.3       6.1   
H257_08655                                                            31.2       7.6   
H257_01952                                                            33.9       8.5   
PITG_13065                                                            33.9       8.9   
PYIR_13849                                                            33.9       9.1   
H310_11272                                                            33.9       9.2   

>PYAP_17746
Length=1169

 Score = 2302 bits (5965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1169/1169 (100%), Positives = 1169/1169 (100%), Gaps = 0/1169 (0%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSVIASNNAGAEIEEILQRAE  60
             MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAEIEEILQRAE
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAEIEEILQRAE  60

Query  61    DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELHDGGSYDL  120
             DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELHDGGSYDL
Sbjct  61    DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELHDGGSYDL  120

Query  121   DIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKHKTTSNARLLPFVNKYD  180
             DIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKHKTTSNARLLPFVNKYD
Sbjct  121   DIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKHKTTSNARLLPFVNKYD  180

Query  181   PTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTSVIQNGSVKLH  240
             PTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTSVIQNGSVKLH
Sbjct  181   PTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTSVIQNGSVKLH  240

Query  241   RREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALPLRAMKTVTI  300
             RREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALPLRAMKTVTI
Sbjct  241   RREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALPLRAMKTVTI  300

Query  301   SFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLRNNVEKIR  360
             SFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLRNNVEKIR
Sbjct  301   SFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLRNNVEKIR  360

Query  361   GYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPL  420
             GYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPL
Sbjct  361   GYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPL  420

Query  421   AYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQA  480
             AYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQA
Sbjct  421   AYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQA  480

Query  481   FFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMR  540
             FFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMR
Sbjct  481   FFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMR  540

Query  541   SQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPFE  600
             SQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPFE
Sbjct  541   SQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPFE  600

Query  601   LSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLV  660
             LSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLV
Sbjct  601   LSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLV  660

Query  661   QGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGT  720
             QGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGT
Sbjct  661   QGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGT  720

Query  721   YDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPP  780
             YDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPP
Sbjct  721   YDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPP  780

Query  781   EYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFHV  840
             EYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFHV
Sbjct  781   EYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFHV  840

Query  841   AGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSA  900
             AGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSA
Sbjct  841   AGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSA  900

Query  901   VGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHR  960
             VGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHR
Sbjct  901   VGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHR  960

Query  961   GVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYN  1020
             GVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYN
Sbjct  961   GVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYN  1020

Query  1021  AFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGRE  1080
             AFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGRE
Sbjct  1021  AFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGRE  1080

Query  1081  VGTQSMVSGDSDIGSSVQLSGNFAEILGLLRHRLSLEKEKEKRDRataiassstaspvps  1140
             VGTQSMVSGDSDIGSSVQLSGNFAEILGLLRHRLSLEKEKEKRDRATAIASSSTASPVPS
Sbjct  1081  VGTQSMVSGDSDIGSSVQLSGNFAEILGLLRHRLSLEKEKEKRDRATAIASSSTASPVPS  1140

Query  1141  ttHEQTPMATPTLRVGKVDQIRRLRRTSQ  1169
             TTHEQTPMATPTLRVGKVDQIRRLRRTSQ
Sbjct  1141  TTHEQTPMATPTLRVGKVDQIRRLRRTSQ  1169

>PYIR_13453
Length=1186

 Score = 1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1211 (51%), Positives = 795/1211 (66%), Gaps = 144/1211 (12%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVG-SNGPGNGSVIASNNAGA----EIEEI  55
             M+Q QQ+HHVEDVGRILLQTQ+QLR +REQ+   S  P +    AS+ A        +EI
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQPDVLAFQEI  60

Query  56    LQRAEDELRMKAELVLSNIV-TAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELHD  114
             LQRAE E+R KAELVL+  V T+  AS            LPTV           KA L  
Sbjct  61    LQRAEVEIRAKAELVLNGFVNTSSQASA-----------LPTVSSSANGNASP-KARLRQ  108

Query  115   G-------------GSYDLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKV  161
                            S + D++YFR RF   AV+  SS +  +P QR          G++
Sbjct  109   NVTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQR-------ITKGQL  161

Query  162   VKHKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSS  221
             VK K   NARLLP VNK DP+AP P LS  DAK G+LSL+NRGFLP   DLTPAF +   
Sbjct  162   VKKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFIN---  218

Query  222   PKSQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSI  281
                  N  S+I+N   +++ R+EQP+R+   ++P  FN+A+LKFD+A  +T  +    S 
Sbjct  219   -----NHGSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENS-  272

Query  282   EPHDESEALPLRAMKTVTISFHNGKSESSPRN-----NARES-------EHDGRREDGND  329
                + SE    R           G S  SPR      N R            G    GN 
Sbjct  273   ---NGSEPSLQRTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNL  329

Query  330   TAPL---------------EREDLDVTADEAANS---------------MEDLRNNVEKI  359
              A +               E E  +   D+  NS               M++LR NVEKI
Sbjct  330   QASVGSVTAAAMLSTDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKI  389

Query  360   RGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVP  419
             RGYNELLD YSLHQFIIHKGRA+R+TPEF SFKRVAQE+WGS+EEVI+ALE LLTRYFVP
Sbjct  390   RGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVP  449

Query  420   LAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQ  479
             LAYIDGQRLMT+A+MEMA  S  +LL+C+VNEDQV SLIRRPGQRYKGKDRKRRAA T+Q
Sbjct  450   LAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQ  509

Query  480   AFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRM  539
              FFRM  ++ ++ + R + +S + IQ+ WR++A  +SL+R+L   R ++  +W+AK++R+
Sbjct  510   NFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRL  569

Query  540   RSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPF  599
             +  W  I+  RRVVIHV S+S+DER+R+S +NFSVKQN+QLSRL GL+D NV+IVYV+PF
Sbjct  570   KRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPF  629

Query  600   ELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRL  659
             EL+ +V+QY +KLLQL GIA+   RV+LV+PE AA+FP HFSL T L+YSP+C+RRIQR 
Sbjct  630   ELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRY  689

Query  660   VQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTG  719
             ++ KEAYLV G+PG ED+RLAVAL VPILG  DP S LPLMT+SGSKRFF++ADVNVPTG
Sbjct  690   IRNKEAYLVTGIPGREDKRLAVALNVPILG-MDPLSALPLMTKSGSKRFFMRADVNVPTG  748

Query  720   TYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRP  779
             TYDIYD DEL+FSLAKLI+SH+ Q+VW+LK+D DP GTGTA+LDVS MT LR+IRREK+ 
Sbjct  749   TYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKS  808

Query  780   PEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFH  839
             PEYWKQP  RD  ARA++ ELER +  L+ P HPE++ SW+EF  AI +FGVVVEA P  
Sbjct  809   PEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSA  868

Query  840   VAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQR----------QRRPAAFVFPQTLV  889
             V G +R N+FIEPSG+VHV ST D+++ +  + S            + +   + FPQT  
Sbjct  869   VIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAA  928

Query  890   PHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSA  949
             P+EAI GAS+A+G++L +E  F GY+S+D  + QE+       A RLWA++L PYLTDSA
Sbjct  929   PYEAIRGASTAIGKLLADECVF-GYSSIDYLVFQEDKT----HAARLWAMALHPYLTDSA  983

Query  950   ATFAAFHALHRGVLNPATGRYNLTAREST-----------------------------PP  980
             +TFA FH L+RG LN ++G Y+L    ++                               
Sbjct  984   STFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQE  1043

Query  981   ESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVG  1040
              + S LVS     L++ GA R+Y V+EY+FHPNVS M Y+AFFHTCRLHGVCFDVERCVG
Sbjct  1044  ATHSGLVS-----LEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVG  1098

Query  1041  SVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLS  1100
             SVFLLADSLTAG+FG++   +SA+ AL +LRTA EVIGREVGTQ+++  D  +G     +
Sbjct  1099  SVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALM--DEFMGGGESET  1156

Query  1101  GNFAEILGLLR  1111
             GNFA++L ++R
Sbjct  1157  GNFADVLAVIR  1167

>PYIW_18793
Length=997

 Score = 1081 bits (2795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/992 (55%), Positives = 700/992 (71%), Gaps = 66/992 (7%)

Query  169   NARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNP  228
             +ARLLP VNK DP+AP P LS  DAK G+LSL+NRGFLP   DLT AF +     S G  
Sbjct  4     HARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVN-----SHGG-  57

Query  229   TSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAV---------------NTV  273
               +IQN   +++ R+EQP+RA  +++P  FN+ATLKFD+AA                   
Sbjct  58    --IIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115

Query  274   TAAENRSIEPHDESEALPLRAMKTVTISFHNGKSESSPRNNAR--ESEHDGRREDGNDT-  330
              A  N S   HD +E    R    +T+SF       +     R  + +H G R   +   
Sbjct  116   LAVVNGSQLDHDSAETRA-RGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQ  174

Query  331   ---APLEREDLDVTADEA---ANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRD  384
                +P    D D+  DE    AN+M++LR NVEKIRGYNELLD YSLHQFIIHKGRA+R+
Sbjct  175   EAESPETNVDEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRE  234

Query  385   TPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCEL  444
             TPEF SFKRVAQE+WGS++EVI+ALE LLTRYFVPLAY+DGQRLMT+A+MEMA  S  +L
Sbjct  235   TPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDL  294

Query  445   LTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLI  504
             L+C+VNEDQV SLIRRPGQRYKGKDRKRRAA T+Q FFRM  ++ ++ + R + +S + I
Sbjct  295   LSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAI  354

Query  505   QKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDER  564
             Q+ WR YA    L+RR+   R+++  +W+AK++R++  W  I+  RRVVIHV S SVDER
Sbjct  355   QRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDER  414

Query  565   TRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTR  624
              RLS +NFSVKQNLQLSRL GLVD NV+IVYV+PFEL+T+V QY +KLLQL GIA+   R
Sbjct  415   LRLSADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVAR  474

Query  625   VRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQ  684
             V+LVFPEHA +FP HFSL T L+YSP+C+RRIQR ++ KEAYLV G+PGPED+RLA+AL 
Sbjct  475   VKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALN  534

Query  685   VPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQN  744
             VPILG  DP S LPLMT+SG KRFF++ADVNVPTGTYDIYD DEL+FSLAKLI+SH+ Q+
Sbjct  535   VPILG-MDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQS  593

Query  745   VWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREI  804
             VW+LK+D DP  TGTA+LDVS M  LR+IRREKR PEYW+QPG RD  AR ++ ELER +
Sbjct  594   VWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTL  653

Query  805   GSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDV  864
             G+L+ P HPE++ SW+++A AI +FGVVVEA P  V G +R N+F+EPSG+VHV ST D+
Sbjct  654   GNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDI  713

Query  865   L-----SGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDL  919
             L        G      + +   + FPQT  P+EAI GAS+A+G++L E++ F GYAS+D 
Sbjct  714   LLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVF-GYASIDF  772

Query  920   QLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTP  979
              + QE+     H A RLWA++L PYLTDSAATF  FH L+RG LN  +G Y L A   T 
Sbjct  773   LVFQED---KSHTA-RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTS  828

Query  980   PE-----------------SDSAL---VSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSY  1019
                                +D  L     S + +L+++GA  +Y V+EY+FHPNVS M Y
Sbjct  829   ASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQY  888

Query  1020  NAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGR  1079
             +AFFHTCRLHGVCFDVERCVGSVFLLADSLTAG+FG++   ++A+ AL +LRTA EV+GR
Sbjct  889   SAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGR  948

Query  1080  EVGTQSMVSGDSDIGSSVQLSGNFAEILGLLR  1111
             EVGTQ++    +  G +   +GNFA++L  +R
Sbjct  949   EVGTQALTDEFTSGGEAE--TGNFADVLAAIR  978

>PYU1_G001734
Length=800

 Score = 992 bits (2565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/791 (60%), Positives = 611/791 (77%), Gaps = 39/791 (5%)

Query  349   MEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQA  408
             M+DLR NVEKIRGYNELLD YSLHQFIIHKG+A+R+TPEF SFKRVAQEIWG +EEVI+A
Sbjct  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  409   LEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGK  468
             LE LLTRYFVPLAY+DGQRLMT+ASMEMA  S  +LL+C+VNEDQV SLIRRPGQRYKGK
Sbjct  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  469   DRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREER  528
             DRKRRAA T+Q  FRM  ++ ++ + RR+ SS +LIQ+ WR+YA  + LRR+L   R+++
Sbjct  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  529   LGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVD  588
               +W+A+++R++ +W  I+  RRV+IHV S+S+DER R+  +NF+VKQNLQLSRL G++D
Sbjct  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240

Query  589   QNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIY  648
              NV+IVYV+PFEL++EV QYF+KLLQL GIA+  TRV+LVFPE A +FP HFSL T L+Y
Sbjct  241   ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  649   SPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRF  708
             SP+C+RRI+R V+GKEAYLV G+PG ED+RLA+AL VPILG  DP + LPLMT+SGSKRF
Sbjct  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILG-MDPLATLPLMTKSGSKRF  359

Query  709   FIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMT  768
             F++ADVNVPTGTYDIYD DEL+FSLAKLI+SH+ QNVWLLK+D DP GTGTAI+D S++T
Sbjct  360   FMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVT  419

Query  769   TLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPE  828
              LR+IRREK+ PEYW+QPG RD  AR ++ ELER IG L+ P HPE++ +W+EFA AI +
Sbjct  420   ALREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQ  479

Query  829   FGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTL  888
             FGVV+EA P  + G IR N+F+EPSG+VHV ST DV+    +T S  +R+ A + FPQT 
Sbjct  480   FGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVIL---STASIHKRKVAGYAFPQTT  536

Query  889   VPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDS  948
              P+EAI GAS A+G+VL ++  F GY+SVD  + +E+    P    RLWA++L PYLTDS
Sbjct  537   APYEAIRGASMAIGKVLVDDSVF-GYSSVDYLVFREDKTHVP----RLWAMALHPYLTDS  591

Query  949   AATFAAFHALHRGVLNPATGRYNLTA-------------------RESTPPESDSALVSS  989
             A+TFA FH L+RG LN  TG+Y+L A                     S+   + SA  ++
Sbjct  592   ASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSAN  651

Query  990   VI---------GTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVG  1040
             ++          +L++ GA R+YAV EY+FHPNVS M Y++FFHTCRLHGVCFDVERC G
Sbjct  652   LVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFG  711

Query  1041  SVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLS  1100
             ++F+LADSLTAG+FG++  G++A+ AL +LRTA EVIGREVGTQ++   D   G     S
Sbjct  712   TIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALT--DDLRGGGDCES  769

Query  1101  GNFAEILGLLR  1111
             GNFAE+L ++R
Sbjct  770   GNFAEVLTVVR  780

>PPTG_17128
Length=1177

 Score = 961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/1176 (47%), Positives = 758/1176 (64%), Gaps = 83/1176 (7%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSN-------GPGNGSVIASNNAGAEIE  53
             ME++QQ+ HVEDVGR+LLQTQ+QLR +REQ+  +         P   S I +        
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiar-----rrrr  108
              ILQ+ E ELR KAELVL+ +V +   +     + G  +P  TV   P  +         
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  109   KAELHDGGSYDLDIEYFRQRFKRTAVDDASSTMTT-APRQRGGGPTPTHAHGKVVKHKTT  167
             K    D  S  + +E+FR++F+ ++V+   S M +  P QR  G    H HG++++ KTT
Sbjct  121   KPRQMDASS--IPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFG---VH-HGRLMRKKTT  174

Query  168   SNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGN  227
              + RLLP VNK DP+AP P L   DAK GVL+L+ RGFLP   DLTPAF   +   S G+
Sbjct  175   QHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNG-TSNGS  233

Query  228   PTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAA--ENRSIEPHD  285
                +++  + +++ R EQ VR+T ++    +NLA+LKFD+ A  T      E++ + P +
Sbjct  234   CGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPE  293

Query  286   ES-------EALPLRAMKTVTISF-HNGKSESSPR----------------NNARESEHD  321
              +       ++  ++    VT+SF  +G    + R                N   + +++
Sbjct  294   STTRRRSVRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNN  353

Query  322   GRREDGNDTAPLEREDLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRA  381
               R   +D +  ++E+ +   DE A  ME+L  NV+KIRGYNELLDAYSLHQF+IHKGR 
Sbjct  354   RGRFSDDDVSDEDQENDENGKDEDAE-MEELGANVDKIRGYNELLDAYSLHQFLIHKGRT  412

Query  382   LRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLST  441
             +RDTPEF SF+RVAQE+WGS+EE ++ALE LLT+YFVPLAY+DGQRL+ LA     + S 
Sbjct  413   MRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSK  472

Query  442   CELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSA  501
              ELL+C+VNEDQ+ S++RRPGQRYKG+DRKRRAATT+QA  RM L R R+ + R +  +A
Sbjct  473   RELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINA  532

Query  502   MLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISV  561
               IQ  WR+Y+C  +L+ RL  VR E+L +W+ ++  ++SQW  I  +RRVV+HV S+S+
Sbjct  533   TKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSL  592

Query  562   DERTRLSMENFSVKQNLQLSRLAGL-VDQNVE-IVYVTPFELSTEVSQYFIKLLQLSGIA  619
             DE  RLS ENF+V+QNLQL+R+  + +D NV+ +VYV+PFEL+ +V QYF+KLLQL G+ 
Sbjct  593   DEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLV  652

Query  620   NAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRL  679
             ++  RV+ VFPE + +FP HFSL++ L+YSP+C+RRI+    GKEAYLVMG+PG EDQRL
Sbjct  653   DSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRL  712

Query  680   AVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIIS  739
             A+AL +PILG   P   LPL+TRSG KR  I+ADVNVP GTY++YD  EL  +LAKL I+
Sbjct  713   AIALDLPILGAP-PAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIA  771

Query  740   HLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQE  799
             H++Q  WL+KLD DPLG G A++D+S +  +R++RREKR PEYW+QPG RD  A+ +L E
Sbjct  772   HMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAE  831

Query  800   LERE--IGSLLKPSHPEIFASWKEFASAIPEFGVVVEALP-------------FHVAGVI  844
             LER   +  L  P H E+F +W+++  A+  FG V+EA+P                   +
Sbjct  832   LERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYV  891

Query  845   RMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRV  904
             R N+F++P G VHV ST +VL+  G  L+   R+  AF FPQT  PHEAI GA +A G++
Sbjct  892   RANLFVDPDGSVHVTSTQNVLATGGGGLN---RKTVAFTFPQTAAPHEAIKGACNAAGKL  948

Query  905   LYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLN  964
             L E + + GY S+D  + Q+E     + A RLWA+++ P+LTDSAA+FA FH L RGVL+
Sbjct  949   LVETNVW-GYVSLDFVVFQDE---KSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLD  1004

Query  965   PATGRY--------NLTARESTPPESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSI  1016
               +G Y         +T R  +   +D  L  + +      GAPR + V  YVFHP+V+ 
Sbjct  1005  TNSGAYRVASKSLTTVTGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTT  1064

Query  1017  MSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEV  1076
             M Y AFFH CRLHGVCFDVER +G++FLLADSLTAG+FGVLS GE+   AL +LRTA EV
Sbjct  1065  MQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEV  1124

Query  1077  IGREVG-TQSMVSGDSDIGSSVQLSGNFAEILGLLR  1111
             IGRE G T +MVS  S   S    SGNFA++L  +R
Sbjct  1125  IGREAGSTINMVSSPSRPVSG--RSGNFAQVLSAVR  1158

>PITG_18457
Length=1170

 Score = 944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/1171 (46%), Positives = 738/1171 (63%), Gaps = 80/1171 (7%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSN-------GPGNGSVIASNNAGAEIE  53
             M+++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   + I +        
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELH  113
              ILQ+ E ELR KAELVL+ +V +  ++     + G L+P  TV   P    R    + +
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  114   DGGSYD---LDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKHKTTSNA  170
                  D   + +E+FR++F+  +V+   S     P +R  G    H HG++++ KTT + 
Sbjct  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL--PEPWERHFG---IH-HGRLMRKKTTQHC  174

Query  171   RLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTS  230
             RLLP VNK DP+ P P L   DAK GVL+L+ RGFLP   DLTP F   S          
Sbjct  175   RLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSG----GG  230

Query  231   VIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEAL  290
             V++  + +++ R EQ VR+T ++    +NLA+LKFD+ A  T       +  P   +   
Sbjct  231   VMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRR  290

Query  291   ----------PLRAMKTVTIS---FHNGKSE----------SSPRNNARESEHDGRREDG  327
                       P    ++V IS     NG+S           ++  N   ++E++  R   
Sbjct  291   STRRSSALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSD  350

Query  328   NDTAPLEREDLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPE  387
             +D +  E+E  +   DE A  ME L  NV+KIRGYNELLD YSLHQF+IHKGR +RDTPE
Sbjct  351   DDISDEEQESDENDKDEYAE-MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPE  409

Query  388   FQSFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTC  447
             F SF+RV QE+WGS+EE ++ALE LL +YFVPLAY+DGQRL+ LA     + S  ELL+C
Sbjct  410   FVSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSC  469

Query  448   VVNEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKT  507
             +VNEDQV S++RRPGQRYKG+DRKRRAATT++A  RM L R R+ + R +  +A  IQ  
Sbjct  470   IVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLA  529

Query  508   WRSYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRL  567
             WR+Y+C  SL+ RL  V  E+L +W+ ++  ++S W  I  +RRVV+HV S+S+DE +RL
Sbjct  530   WRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRL  589

Query  568   SMENFSVKQNLQLSRL-AGLVDQNVE-IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRV  625
               ENF+++QNLQL+R+ A  +D NVE ++YV+PFEL+++VSQYF+KLLQL G+ ++  RV
Sbjct  590   GAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRV  649

Query  626   RLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQV  685
             +LVFPE   +FP HFSL++ L+YSP+C+RRI+    GKEAYLVMG+PG EDQRLA+AL +
Sbjct  650   KLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDL  709

Query  686   PILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNV  745
             PILG   P   LPL+TRSG KR  I+ADVNVP GTY++YD  E+  +LAKL I+H++Q  
Sbjct  710   PILGAP-PAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPR  768

Query  746   WLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELERE--  803
             WL+KLD DPL  G A++D+S M  +R++RREKR PEYW+QPG RD  A+ +L ELER   
Sbjct  769   WLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGM  828

Query  804   IGSLLKPSHPEIFASWKEFASAIPEFGVVVEALP-------------FHVAGVIRMNIFI  850
             +  +  P   EIF  W+EF  A+  FG VVEA+P                   +R N+F+
Sbjct  829   LARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFV  888

Query  851   EPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHA  910
             +P G VH+ ST +VL+  G  L+   R+  AF FPQT  P+EAI GA +A G++L E + 
Sbjct  889   DPDGSVHISSTQNVLAAGGGGLN---RKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNV  945

Query  911   FCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRY  970
             + GY S+D  + Q+E     + A RLWA+++ P+LTDSA +FA FH L RGVL+  +G Y
Sbjct  946   W-GYVSLDFVVFQDE---KSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVY  1001

Query  971   NL------TARESTPPESDSA----LVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYN  1020
              +      TA      ES SA    L  +++     +GA R +    YVFHP+V  M Y 
Sbjct  1002  RVANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYT  1061

Query  1021  AFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGRE  1080
             AFFH CRLHGVCFDVER +G++FLLADSLTAG+FG+LS GE+   AL +LRTA EVIGRE
Sbjct  1062  AFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGRE  1121

Query  1081  VGTQSMVSGDSDIGSSVQLSGNFAEILGLLR  1111
              G+   V+  S   S    SGNFA+IL  +R
Sbjct  1122  AGSTISVAS-SPSRSVASRSGNFAQILSAIR  1151

>PHYRA_95901
Length=1075

 Score = 932 bits (2408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/1149 (47%), Positives = 725/1149 (63%), Gaps = 131/1149 (11%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSN-------GPGNGSVIASNNAGAEIE  53
             ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   S + +        
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELH  113
              ILQ+ E ELR KAELVL  +V +  ++     + G L+P+ TV  PP  R R       
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGY----  116

Query  114   DGGSYDLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTH-------AHGKVVKHKT  166
              G +  + IE+FR++F  ++V+   S M          P+P H        HG++++ KT
Sbjct  117   -GDASSIPIEFFREQFHNSSVEVRQSLM----------PSPQHWQRHLGIQHGRLLRKKT  165

Query  167   TSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQG  226
             T + RLLP VNK DPTAP P L   DAK GVL+L+ R                SS    G
Sbjct  166   TQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR----------------SSGTKDG  209

Query  227   NPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDE  286
               + V++  + +++ R EQP RAT ++    +NLA LKFD+ +  T              
Sbjct  210   --SGVMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGT--------------  253

Query  287   SEALPLRAMKTVTISFHNGKSESSPRNNARESEH-DGRREDGNDTAPLEREDLDVTADEA  345
                               GK++ S  +     EH DG   D +          D   DE 
Sbjct  254   ------------------GKNDRSNDDMEGNREHIDGEISDEDQGGA------DNDKDEE  289

Query  346   ANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEV  405
             A  ME+L  NV+KIRGYN+LLDAYSLHQF+IHKGR++RDTPEF SF+RVAQE+WGS+EE 
Sbjct  290   AE-MEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEA  348

Query  406   IQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRY  465
             ++ALE LLT+YFVPLAY+DGQRL++LA+    + S  ELL C+VNE+QV S++RRPGQRY
Sbjct  349   LRALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRY  408

Query  466   KGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVR  525
             KG+DRKRRAATT+QA  RM   R R+ + R +  SA  IQ  WRSY+C  +L+ RL  VR
Sbjct  409   KGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVR  468

Query  526   EERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-A  584
              E+L  W+A+++ +R+QW  I  +RRVV+HV S+S+DE +RLS ENF+V+QNLQL+R+ A
Sbjct  469   REQLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICA  528

Query  585   GLVDQNVE-IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLA  643
               +D +V+ +VYV+PFEL+ +VSQYF+KLLQL G+A++  RV+LVFPE AA+FP HFSL+
Sbjct  529   AALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLS  588

Query  644   THLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRS  703
             + L+YSP+C+RRI+    GKEAYLVMG+PG EDQRLAVAL +PILG   P   LPL+TRS
Sbjct  589   SLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAP-PAQALPLLTRS  647

Query  704   GSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILD  763
             G KR  I+ADVNVPTGTY++YD  EL  +LAKL ++H+ Q  WLLKLD DPLG G A++D
Sbjct  648   GGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVD  707

Query  764   VSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELERE--IGSLLKPSHPEIFASWKE  821
             +S M  +R++RREKR PEYW+QPG RD  A+ +L ELER   +  L  P H EIF +W++
Sbjct  708   LSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRD  767

Query  822   FASAIPEFGVVVEALPFHVAGV---------------IRMNIFIEPSGDVHVMSTNDVLS  866
             F  AI  FG V+EA+P   AG+               +R N+F+ P G        +VL+
Sbjct  768   FTEAIGHFGCVIEAVP--PAGIAATPESSSLLVEPAYVRANLFVYPDG-------KNVLA  818

Query  867   GNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEE-  925
              +G  L+   R+  AF FPQT  PHEA+ GA  A G++L E   + GY S+D  + Q+E 
Sbjct  819   SSGGGLN---RKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVW-GYVSLDFVVFQDEK  874

Query  926   SLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTA---RESTPPES  982
             +  SP    RLWA+++ P+LTDSAA+FA FH L RG    A     + A   R  +   +
Sbjct  875   NGGSP----RLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGRSGSGGAA  930

Query  983   DSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSV  1042
             D  L  + +      GAPR + V  YVFHP+V+ M Y+AFFH CRLHGVCFDVER +G++
Sbjct  931   DLLLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTL  990

Query  1043  FLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGN  1102
             FLLADSLTAG+FG+LS GE+   AL +LRTA EVIGREVG    ++    + +    +GN
Sbjct  991   FLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSRPVSTR---NGN  1047

Query  1103  FAEILGLLR  1111
             FA++L  +R
Sbjct  1048  FAQVLSAVR  1056

>PHALS_06477
Length=1166

 Score = 910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/1165 (44%), Positives = 727/1165 (62%), Gaps = 88/1165 (8%)

Query  1     MEQLQQRHHVEDVG-------rillqtqdqlrqlreqlVGSNGPGNGSVIASNNAGAEIE  53
             ME++QQ +HVEDVG         L   ++Q+      +  +  P   S + +N       
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELH  113
              +LQ+ E ELR KAELVL+ I+ +  +   +  +    +P  +V  P   + RR  +   
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  114   DGGSYD------LDIEYFRQRFKRTAVDDASSTMTTAP--RQRGGGPTPTHAHGKVVKHK  165
             + G  +        +E+FRQ+F+   V+   S MT+    R++ G         + V+ K
Sbjct  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGA--------RRVRKK  187

Query  166   TTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQ  225
             TT + RLLP VNK DP+ P P L   DA  G+L+L+ RGFLP   DLTPAF   +  KS 
Sbjct  188   TTQHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNG-KSN  246

Query  226   GNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHD  285
             G+    +++ +  ++ R ++  R T       FNLA LKFD    +T ++A     +P+ 
Sbjct  247   GSGGCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAP----KPNH  302

Query  286   E---SEALPLRAMKTVTISFHNGKSE------SSPRN-------NARESEHDGRREDGND  329
                 S ++P     ++  +  +G ++      ++PRN       N   S  D   E+G+D
Sbjct  303   SATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEGSD  362

Query  330   TAPLEREDLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQ  389
                    D D+  DE   S +DL  NV KIR YN+L+DAYSLHQ +I+KGRA+RDTPEF 
Sbjct  363   -------DSDIIKDEGF-STKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFT  414

Query  390   SFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVV  449
             SF+RV  ++WGS+EEV++ALE +L +YFVPLA++DGQRL+ LAS    + S  ELL+C+V
Sbjct  415   SFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIV  474

Query  450   NEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWR  509
             N++QV S++RRPGQRY G+DRK RAATT+QA  RM +  +R+ K R +  +A+ IQ  +R
Sbjct  475   NKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFR  534

Query  510   SYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSM  569
             +Y+   +L+ RL  +R E+  +W+A++   +SQW  I  +RR+V+HV S+S+ E +RL+ 
Sbjct  535   AYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNA  594

Query  570   ENFSVKQNLQLSRL-AGLVDQNVE-IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRL  627
             ENF+V+QNLQL+R+ A  +D  V+ +VYV+P+EL+ +VSQYF KLLQLSG A++  RV+ 
Sbjct  595   ENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKF  654

Query  628   VFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPI  687
             V+PE AA+FP HFSL++ ++YSP C+RRI+    G EAYLVMG+PGPEDQRLA+ L +PI
Sbjct  655   VYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPI  714

Query  688   LGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWL  747
             LG   P+  LPL+TRSG KR  I+AD+NVPTGTY++YD  E+  +LAKL ++H++Q+ WL
Sbjct  715   LGAL-PSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWL  773

Query  748   LKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELER--EIG  805
             +KLD DPLG G A++D+S M  +R++ REKR PEYW+QPG RD  A   L E ER  ++ 
Sbjct  774   IKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLA  833

Query  806   SLLKPSHPEIFASWKEFASAIPEFGVVVEALPFHVAGV-------IRMNIFIEPSGDVHV  858
              L  P H E++ +W+E+A+AI  FG V+EA+P   +         +R NIF++P+G VH+
Sbjct  834   RLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHM  893

Query  859   MSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVD  918
              ST +VL+   TT     R+   F FPQT+ PH AI GA +AVG+ L E + + GY S+D
Sbjct  894   TSTQNVLT---TTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVW-GYVSLD  949

Query  919   LQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNL------  972
               + Q+      + A RLWA+++ P+LT+SAATFA FH L RG L+  +G Y +      
Sbjct  950   FVVFQD---IKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKL  1006

Query  973   ----TARESTPPES-DSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCR  1027
                 TA +S   ++ D  L  + +      GA R Y V  YVFHPNV+   Y  FF  CR
Sbjct  1007  QTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCR  1066

Query  1028  LHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVG-TQSM  1086
             LHGVCFDV R +G++FLLADSLTAG+FG+LS GE+A  AL YLRTA EVIGRE G T+ +
Sbjct  1067  LHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGI  1126

Query  1087  VSGDSDIGSSVQLSGNFAEILGLLR  1111
             VS      SS  + GNFA++L  +R
Sbjct  1127  VS-----SSSRSVLGNFADVLSTVR  1146

>H310_09212
Length=1113

 Score = 824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/1162 (41%), Positives = 685/1162 (59%), Gaps = 89/1162 (8%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSVIASNNAGA-EIEEILQRA  59
             ME+L Q++H EDVGRILLQ QD+LR +RE            V  +NN    +I  IL+RA
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMRE-----------KVHENNNLDVNQIHAILERA  49

Query  60    EDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPT----VrrppiarrrrrKAELHDG  115
             E +LR KAE+VL+ +V        A D  GG   L      + +         +   ++ 
Sbjct  50    EADLRAKAEIVLNGVVNNSMKMLPAIDAPGGQRYLSKFSSKLAQKRDLAATMARENTYEP  109

Query  116   GS--YDLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTH---AHGKVVKHKTTSNA  170
             GS  Y  D  Y             S  +    R R  G  P       G +VKHKTT   
Sbjct  110   GSPTYGHDTSYREH-------PSLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPR  162

Query  171   RLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTS  230
             R+LP +N+ DPTAP P L   DA+ GV +LL RGFLPP+VD+TPAF       + G  TS
Sbjct  163   RILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAF-------THG--TS  213

Query  231   VIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAA-----VNTVTAAENRSIEPHD  285
             VIQN  VK++ R  QPV++  Y++P  FN+A+LKFDM       V  V   +   I P  
Sbjct  214   VIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPINQGGDIPPSK  273

Query  286   ESEALPLRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEA  345
              S   P      + I+F    + + P     E    G    G D A  +    D      
Sbjct  274   TSIPTP------IDITFDGHANNAVPFRP--EQPKGGNDPSGKDCASAD----DGAGGND  321

Query  346   ANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEV  405
             + S+ +LR NVEKIRGYNELLD YSLHQFII KG+ L DTPEF SF+R  +++WGS+ + 
Sbjct  322   STSIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKS  381

Query  406   IQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRY  465
             IQ LE +LT Y VPLAY+DGQ+LM +A+M+     T ELL+C++N D+V+SL+RRPGQR+
Sbjct  382   IQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRF  441

Query  466   KGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVR  525
             KGK     AA  LQ+ +RM + + R +    N  +A +IQ+ +RSY C   L++RL  VR
Sbjct  442   KGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNEDAA-VIQRIYRSYRCFSQLQQRLKSVR  500

Query  526   EERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAG  585
             E  L  W A+++R R+ W  I+ QRRVV+HV S S +ERTRL MENFS++QNLQ++R+  
Sbjct  501   EADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCA  560

Query  586   LVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATH  645
             + D NV+I+Y++PFELS ++ +Y ++LLQL GIA+  TR+R++ PE+  +FP+HFSL T 
Sbjct  561   IADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTV  620

Query  646   LIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGS  705
             L+YSP+C+++I+R V+GK+AY+V G  GPED+RLA+ALQ+P+LG  DP   L   TRSG 
Sbjct  621   LLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLG-MDPDKALLYGTRSGG  679

Query  706   KRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVS  765
             KR F+ ADVN+P G +DIYD DEL+ SL+KLI + ++Q  WL+K+DAD   TG A L+V 
Sbjct  680   KRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVD  739

Query  766   LMTTLRDIRREKR-----PPEYWKQPGIRDTIARALLQEL-EREIGSLLKPSHPEIFASW  819
              M ++   R EKR       EY++QP +RD + R++  EL E    + + P  PE++ASW
Sbjct  740   KMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASW  799

Query  820   KEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRP  879
                       GVV+EA P  V   +R NIFIEPSG VH+ S +DV           +  P
Sbjct  800   AAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVF-----MCPVNKHLP  854

Query  880   AAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVD-LQLSQEESLTSPHKAERLWA  938
                VFPQ+ VP++AI GAS A+   ++ +    GYAS+D +  +  +++ S    +RLWA
Sbjct  855   QCAVFPQSSVPYQAIRGASLAIASSMFIK-GIIGYASIDYISFADPKAMVSGRPRQRLWA  913

Query  939   VSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTARES------------TPPESDSAL  986
             + + P LT++A +F  F  L     NP TG+ +L    +            TP + + A 
Sbjct  914   MQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIAT  973

Query  987   V---SSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVF  1043
             +    S        G  R+Y V +Y++HPN++ + +  FF+TCRLHGV FD++R +G+ +
Sbjct  974   ILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAY  1033

Query  1044  LLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNF  1103
             +LADSLTAG+ G++  GES  +A +  R A E+IG +VG Q++ +  S      +  GNF
Sbjct  1034  ILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLSG-----ERLGNF  1088

Query  1104  AEILGLLRHRLSLEKEKEKRDR  1125
               +L ++R++       ++R R
Sbjct  1089  PHLLAIVRNKSDDPAAADRRKR  1110

>H257_06305
Length=1099

 Score = 812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/1151 (41%), Positives = 679/1151 (59%), Gaps = 85/1151 (7%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSVIASNNAGA-EIEEILQRA  59
             M++L Q++H EDVGRILLQ QD+LR +RE            V   NN    EI  IL+RA
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMRE-----------KVNEKNNVDVNEINAILERA  49

Query  60    EDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELHDGGSYD  119
             E +LR KAE+VL+ +V        A +  GG   L         +R        D  SY+
Sbjct  50    EADLRAKAEIVLNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTRDS-SYE  108

Query  120   LDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTH---AHGKVVKHKTTSNARLLPFV  176
                  +RQ  +          M    R R  G  P       G +VK KTT   RLLP +
Sbjct  109   PASPTYRQEDREPRFGGPIEPME---RDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKM  165

Query  177   NKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTSVIQNGS  236
             N+ DPTAP P L   DA+ GV +L+ RGFLPP+VD+TPAF          + TSVIQN  
Sbjct  166   NRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT---------HGTSVIQNSR  216

Query  237   VKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRS--IEPHDESEALPLRA  294
             VK++ R  QPV++  Y++P  FN+A+LKFDM+     +     +  +   D S+ +    
Sbjct  217   VKIYDRASQPVKSMPYTNPSGFNMASLKFDMSTTPATSTPSPVAAVVSGGDVSKMV----  272

Query  295   MKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLRN  354
             +  + ISF    S   P    +     G   +G D++                ++ +LR 
Sbjct  273   VTPIDISFDAPSSSHPPVEQPKGGATGGDDTNGGDSS----------------TIHNLRR  316

Query  355   NVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLT  414
             NVEKIRGYNELLD YSLHQFII KG+ L DTPEF SF+R  +++WGS+   IQ LE +LT
Sbjct  317   NVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLT  376

Query  415   RYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRA  474
              Y VPLAY+DGQ+LM +A+M+     T ELL+C++N D+V+SL+RRPGQRYKG      A
Sbjct  377   SYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLA  436

Query  475   ATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKA  534
                +Q+ +RM L + R +    N  +A +IQ+ +RSY C   L++RL  VRE  L  W A
Sbjct  437   VVLIQSVWRMFLTKKRLKNHHGNEDAA-VIQRIYRSYRCFSQLQQRLKLVREADLRIWDA  495

Query  535   KVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIV  594
             +++R R+ W  ++ QRRVV+HV S + D+RTRL M+NFS++QNLQ++R+  + D NV+I+
Sbjct  496   QMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVDII  555

Query  595   YVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIR  654
             Y++PFELS ++ +Y ++LLQL GI +  TR+R++ PE+  +FP+HFSL T L+YSP+C++
Sbjct  556   YISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLK  615

Query  655   RIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADV  714
             +I+R V+GK AY+V G  GPED+RLA+ALQ+P+LG  DP   L   TRSG KR F+ ADV
Sbjct  616   KIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLG-MDPDKALLYGTRSGGKRIFMAADV  674

Query  715   NVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIR  774
             N+P G +DIYD DEL+ SL+KLI + ++QN WL+K+DAD   TG A ++V  M ++  +R
Sbjct  675   NIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVR  734

Query  775   REKR-----PPEYWKQPGIRDTIARALLQEL-EREIGSLLKPSHPEIFASWKEFASAIPE  828
              EKR       EY++QP +RD + R++  EL E    + + P  P+++ASW E       
Sbjct  735   AEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALR  794

Query  829   FGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTL  888
              GVV+EA P  V   +R N+FIEPSG VH+ S +D+           +  P   +FPQT 
Sbjct  795   VGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPAN-----KHLPQCALFPQTS  849

Query  889   VPHEAIVGASSAVGRVLYEEHAFCGYASVD-LQLSQEESLTSPHKA-ERLWAVSLFPYLT  946
             VP++AI GAS A+   ++ +    GYAS+D +  +  ++L    +  +RLWA+ + P LT
Sbjct  850   VPYQAIRGASLAIASSMFIK-GIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLT  908

Query  947   DSAATFAAFHALHRGVLNPATGRYNLTARES---------TPPESDSALVSSVIGTLDRI  997
             ++A +F  F  L     NP TG+ +L               P       V +++      
Sbjct  909   NTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVETILSARPPN  968

Query  998   GA-----PRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAG  1052
             GA      R+Y V +Y++HPN++ + ++ FF+TCRL+GV FD++R +G+ F+LADSLTAG
Sbjct  969   GAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAG  1028

Query  1053  IFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGLLRH  1112
             + G++  GE+  +A +  R A E+IG +VG Q++   DS  G  +   GNF  +L ++R+
Sbjct  1029  VMGLMCIGENDKEAFRIARQAVELIGDQVGVQAL--PDSLSGERL---GNFPHLLAIVRN  1083

Query  1113  RLSLEKEKEKR  1123
             +     ++ KR
Sbjct  1084  KSDDPADRRKR  1094

>SDRG_01764
Length=1092

 Score = 802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/1166 (40%), Positives = 687/1166 (59%), Gaps = 118/1166 (10%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSVIASNNAGAE-IEEILQRA  59
             M++L Q++HVEDVGRILLQ QD+LR +RE            V+ SNN   + ++ IL+RA
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMRE-----------QVLTSNNIDIDALQAILERA  49

Query  60    EDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELHDGGSYD  119
             E +LR KAE+VL+ +V     +    +  GG  P         + +  ++ EL D  + D
Sbjct  50    ELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQP----SVSKFSSKLAKQRELADAMARD  105

Query  120   --LD--------IEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTP---THAHGKVVKHKT  166
               LD        +E  RQ+  +  V           R R  G  P   T   G+++K K 
Sbjct  106   GSLDDHRTRSSPVERLRQQLGQPVV--------PVERDRPPGKRPIGRTMQVGRLIKKKV  157

Query  167   TSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQG  226
             T   RLLP VN+ DP AP P L   DAK+GVL+L+NRGF+P + DL+ AF       + G
Sbjct  158   TGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF-------THG  210

Query  227   NPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNT---------VTAAE  277
             +   +IQN  ++L+ R EQPV++  Y +  +FN+A+LK D+A   T         +  A 
Sbjct  211   D--GIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEPDPTPLTRLAVAR  268

Query  278   NRSIEPHDESEALPLRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLERED  337
             N+              A+ TV ++F   K E                    D  P+E   
Sbjct  269   NKK------------SAVATVQLTFPGAKDE-------------------GDVVPVEDPT  297

Query  338   LDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQE  397
              D    E  +++++LRNNVEKIRGYN+LLD YSLHQFII KG+ L +TPEF SFKR+ ++
Sbjct  298   TDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITED  357

Query  398   IWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASL  457
             +WGS+   I+ LE LL  Y VPLAYIDGQ+L+ +A+M+    S  ELLTCV+N D+V + 
Sbjct  358   LWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTF  417

Query  458   IRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSL  517
             + RPGQR+KG+D +  AA  LQ+ +RM L R R R+     S A  IQ+ +R+Y   + +
Sbjct  418   MARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQ-HHGHSYASHIQRVYRTYKSVKEI  476

Query  518   RRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQN  577
             + +L   RE     W+ ++    + W  I+ QRRVV+HV S S +ERTRL+M+NF+++QN
Sbjct  477   QVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQN  536

Query  578   LQLSRLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFP  637
             LQ++RL  + D NV+++Y++PFELS ++ +Y ++LLQL G+A+ H+RVR++ PE+A +FP
Sbjct  537   LQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFP  596

Query  638   QHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSIL  697
             +HFSLAT L+YSP+C+++I+R V+GKEAY+V G  GPED+RLA+ LQ+P+LG  DP   L
Sbjct  597   EHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLG-MDPDRAL  655

Query  698   PLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGT  757
                TRSG+KR F +ADVN+P G +DIYD DEL+ SLAKL  ++L+Q +WL+KLDADP  T
Sbjct  656   LYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDT  715

Query  758   GTAILDVSLMTTLRDIRREKRP---PEYWKQPGIRDTIARALLQELEREIGSLLKPSHPE  814
             G A +D+  +  +  +R EKR     EY+ QP I++ I RA++ EL  +   L+ P  P+
Sbjct  716   GLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPD  775

Query  815   IFASWKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQ  874
             ++ +W+     +   G V+EA P  V   +R N+FIEPSG VH+ S  + L       ++
Sbjct  776   VYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQL-----MQAK  830

Query  875   RQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVD----LQLSQEESLTSP  930
              + +    V+P T VP+ AI GAS AV + +Y      GYAS+D    L +        P
Sbjct  831   NKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGP  889

Query  931   HKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTP-------PESD  983
                 RLWA+ L P LT +A +F  F  L    L+ ATGR  L      P       P ++
Sbjct  890   PHL-RLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTE  948

Query  984   SAL-VSSVIGTLDR---IGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCV  1039
             + L V  ++    R   +G  R+Y   EY+FHPN++ + Y  FF+ CR+HGV FD+++ +
Sbjct  949   TQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSI  1008

Query  1040  GSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQL  1099
             G+ F+LADSLTAG+ G+L  GES  +A++  R A E+IG +VG Q   + D+  G  +  
Sbjct  1009  GAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQP--APDALTGERL--  1064

Query  1100  SGNFAEILGLLRHRLSLEKEKEKRDR  1125
              GNFA +LG +R R     ++ K+ R
Sbjct  1065  -GNFAAVLGAIRSRHDDMVKRAKKAR  1089

>PHYCA_34475
Length=692

 Score = 775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/720 (55%), Positives = 512/720 (71%), Gaps = 47/720 (7%)

Query  360   RGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVP  419
             RGYNELLDAYSLHQF+IHKGR +RDTPEF SF RVAQE+WGS+EE ++ALE LLT YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  420   LAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQ  479
             LAY+DGQRL++LA+    + S  ELL+C+VNE+QV + +RRPGQRYKG+DRKRRAATT+Q
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  480   AFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRM  539
             AF RM   R R+ + R    +A  IQ  WR+Y+C  +L+ RL  VR E+L +W+A++ R+
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  540   RSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-AGLVDQNVE-IVYVT  597
             +SQW  I   RRVV+HV S+S+DE +RLS EN +V+QNLQL+R+ A  +D  V+ +VYV+
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  598   PFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQ  657
             PFEL+T+VSQYFIKLLQL G+A++  RV+L+FPE A +FP HFSL++ L+YSP+C+RRI+
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  658   RLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVP  717
                 GKEAYLVMG+PG EDQRLA+ L +PILG   P   LPL+TRSG KR  I+ADVNVP
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILG-APPAQALPLLTRSGGKRLLIRADVNVP  359

Query  718   TGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREK  777
              GTY++YD  EL  +LAKL ++H++Q  WL KLD DPLG G A++D+S M  +R++RREK
Sbjct  360   AGTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREK  419

Query  778   RPPEYWKQPGIRDTIARALLQELER--EIGSLLKPSHPEIFASWKEFASAIPEFGVVVEA  835
             R PEYW+QPG RD  A+ +L ELER   +  L  P H +IF SW EFA AI  FG V+EA
Sbjct  420   RTPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEA  479

Query  836   LPFHVAGV-------------IRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAF  882
             +P     V             IR N+F++P G VHV ST ++L+  G  L+   RR  AF
Sbjct  480   VPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLN---RRTVAF  536

Query  883   VFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLF  942
              FPQT  PHEA+ GA SA G++L E + + GY S+D  + Q++     + A RLWA+++ 
Sbjct  537   TFPQTAAPHEAVKGACSAAGKLLVETNVW-GYVSLDFVVFQDD---KSNGAPRLWALAVH  592

Query  943   PYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRIGAPRS  1002
             P+LTDSAA+FA FH L RGVL+  +G Y + A  +                      PR 
Sbjct  593   PFLTDSAASFACFHLLARGVLDANSGVYRMAAAST----------------------PRC  630

Query  1003  YAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGES  1062
             + V  YVFHP+V+ M Y AFFH CRLHGVCFDVER +G++FLLADSLTAG+FGVLS GE+
Sbjct  631   FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET  690

>SPRG_06354
Length=884

 Score = 727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/914 (42%), Positives = 569/914 (62%), Gaps = 60/914 (7%)

Query  232   IQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALP  291
             +QN  ++L+ R EQPV++  Y +   FN+A+LK D+A   T    E  ++ P   + A  
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPT----EPDAVPPTRPAVARK  56

Query  292   LRA-MKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSME  350
              ++ + TV +SF   K E                    D  P+E    D    E  ++++
Sbjct  57    RKSTVATVQLSFPGAKDELV------------------DAVPVEDPATDDGPIEPTDTID  98

Query  351   DLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALE  410
             +LRNNVEKIRGYN+LLD YSLHQFII KG+ L +TPEF SFKR+ +++WGS+   I+ LE
Sbjct  99    ELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELE  158

Query  411   ILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDR  470
              LL  Y VPLAYIDGQ+L+ +A+M+    S  ELLTCV+N D+V + + RPGQR+KG D 
Sbjct  159   TLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDG  218

Query  471   KRRAATTLQAFFRMVLHRNRFRKIRRNG--SSAMLIQKTWRSYACQQSLRRRLAHVREER  528
             +  AA  +Q+ +RM  HR R R +R++   S A  IQ+ +R+Y C + ++ +L   RE  
Sbjct  219   RHAAAIVIQSVYRM--HRTR-RLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREAD  275

Query  529   LGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVD  588
                W+ ++    + W  I+ QRRVV+HV S S +ER RL+M+NF+++QNLQ++RL  + D
Sbjct  276   ARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIAD  335

Query  589   QNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIY  648
              NV+++Y++PFELS ++ +Y ++LLQL G+A+ H+RVR++ PE+A +FP+HFSLAT L+Y
Sbjct  336   PNVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLY  395

Query  649   SPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRF  708
             SP+C+++I+R V+GKEAY+V G  GPED+RLA+ LQ+P+LG  DP   L   TRSG+KR 
Sbjct  396   SPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLG-MDPDRALLYGTRSGAKRL  454

Query  709   FIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMT  768
             F +ADVN+P G +DIYD DEL+ SLAKL  ++L+Q +WL+KLDADP  TG A +D+  + 
Sbjct  455   FTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALE  514

Query  769   TLRDIRREKRP---PEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASA  825
              +  +R EKR     EY+ QP I++ I RA++ EL  +   L+ P  P+++ +W+     
Sbjct  515   CVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPV  574

Query  826   IPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFP  885
             +   G V+EA P  V   +R N+FIEPSG VHV S  + L        + + +    V+P
Sbjct  575   VNRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLMH-----VKNKHQSVGAVYP  629

Query  886   QTLVPHEAIVGASSAVGRVLYEEHAFCGYASVD----LQLSQEESLTSPHKAERLWAVSL  941
              T VP+ AI GAS AV + +Y      GYAS+D    L +        P    RLWA+ L
Sbjct  630   PTAVPYAAIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGPPHL-RLWALQL  687

Query  942   FPYLTDSAATFAAFHALHRGVLNPATGRYNL---TAREST---PPESDSAL-VSSVIGTL  994
              P LT +A +F  F  L    L+ ATGR  L     R S+   PP +++ L V  ++G  
Sbjct  688   LPCLTPTAMSFVLFTFLSCATLDAATGRSFLPLPAPRPSSLAGPPATETQLAVEKILGES  747

Query  995   D---RIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTA  1051
                  +GA R+Y   EY+FHPN++ + Y  FF+ CR+HGV FD+++ +G+ F+LADSLTA
Sbjct  748   SPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA  807

Query  1052  GIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGL--  1109
             G+ G+L  GES  +A++  R A E+IG +VG Q   + D+  G  +   GNFA +LG   
Sbjct  808   GVVGLLCIGESDKEAVRLTRAALELIGDQVGVQP--APDALTGERL---GNFAAVLGAIR  862

Query  1110  LRHRLSLEKEKEKR  1123
             LRH   +++ K+ R
Sbjct  863   LRHDDMVKRAKKAR  876

>CCI45122
Length=1105

 Score = 611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/1166 (35%), Positives = 620/1166 (53%), Gaps = 120/1166 (10%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSV------------IASNNA  48
             M+ L+Q+HH ED+GRILLQTQ +LR++R ++ G        +            I S N 
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  49    GAEIE---EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarr  105
               ++E    IL RAE E++ K +L+       G A  G   + G    LP V  PP    
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYK-----GVAHYGRKTQTG----LPFVASPPRQIP  111

Query  106   rrrKAELHDGGSY-DLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKH  164
                 + L    S+ +L ++  R++    +V +    +            PT  H +++  
Sbjct  112   SSANSSLERKSSFQELSVDLIRKQLH--SVKEKYKCL------------PTKQHSELISP  157

Query  165   KTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKS  224
             K  +   L            +P     +A    L  + RG      D + A +      S
Sbjct  158   KRPTQGLL----------TSKPSKKRYNASLRSLPTVQRG---EAGDFSSASRDQIGEAS  204

Query  225   QGNPTS--VIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIE  282
                  +  V+   +  LH R E+P++ T Y++  + N+ ++KFD              + 
Sbjct  205   NTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF-------------MT  251

Query  283   PHDESEALPLRAMKTVTISFHNGKSESSPRNNA------RESEHDGRREDGNDTAPLERE  336
             P  +S   P   M+T          +S  RN A        S   G RED +  +P    
Sbjct  252   PTSQS---PCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDP  308

Query  337   DLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQ  396
                +   +A   +    N+V K     E+   Y    F+IH+G   R  PEF++F+R+A 
Sbjct  309   SKKIGIIKAITPI--FLNDVTK-SLVGEISKTYD---FVIHQGIIDRKRPEFEAFQRIAN  362

Query  397   EIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVAS  456
              IW S++ V++AL  +L+ YF+P+AYI+GQR++TLA  +   L+T +L++C+ NED+V  
Sbjct  363   PIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEVKM  422

Query  457   LIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQS  516
             L+ +PGQR++G +R +RA   LQ+F RM +HR RF  +R        IQ+ WR ++  ++
Sbjct  423   LLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKA  482

Query  517   LRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQ  576
              + ++   RE +   +   +R   S W  IR QRR +IH+ SIS+D R R+  E FS++Q
Sbjct  483   TKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQ  542

Query  577   NLQLSRLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQF  636
             NLQL RL  ++D+NVE++Y+ PFEL+ ++ QY++KLLQL GI++A  R++L+ PE+A++F
Sbjct  543   NLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRF  602

Query  637   PQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSI  696
             P HFSL++ ++YSP  + R+ R ++G+ AY+V G PG ED+R+A  L VPILG  D T  
Sbjct  603   PSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILG-LDSTKS  661

Query  697   LPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLG  756
             L   T SGSKR+F KA+VN      D+YD +EL+FSLAKL+ SH +Q   +L+LD DP G
Sbjct  662   LQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFG  721

Query  757   TGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIF  816
             TG A++D+S + +++++R   +  E W QP I+  + R L+ E++  I S +   HPEIF
Sbjct  722   TGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEIF  781

Query  817   ASWKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLS-GNGTTLSQR  875
              S K F  AI  +GV++E  P    G +R N+FIEPS  V V ST+++ S    T +  R
Sbjct  782   PSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDR  841

Query  876   QR------------RPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQ  923
              R            R     FPQTL+ HE +  AS A+G+ L ++   CGY SVD  +  
Sbjct  842   VRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKD-GICGYISVDFVV--  898

Query  924   EESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHR-GVLNPATGRYN------LTARE  976
                L    + + L+A  L P+LT++AA+FA F  L R G  N  TG  +      L   +
Sbjct  899   --CLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQ  956

Query  977   STPPESDSAL--------VSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRL  1028
             + PP S SA         +S ++  +      R+YA+ EYV +P V+ +S ++FF  CR 
Sbjct  957   NDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRS  1016

Query  1029  HGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVS  1088
              GV FD ER  G+VFLLADSLTAG+FG++   ++   AL   R A E I    GT+  VS
Sbjct  1017  RGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVS  1076

Query  1089  GDSD----IGSSVQLSGNFAEILGLL  1110
               SD    +  + ++   F+EIL  L
Sbjct  1077  KSSDGMNELIRTDRMRDQFSEILRAL  1102

>CCA18898
Length=1147

 Score = 596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/1163 (35%), Positives = 623/1163 (54%), Gaps = 97/1163 (8%)

Query  1     MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSVI------------ASNNA  48
             MEQ++Q++H EDVGRILLQTQ +LR +R ++      G   V+            A+ N 
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  49    GAEIE---EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarr  105
               ++E   +IL RAE E++ K +L+       G A+ G   + G    LP V  PP    
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFR-----GAANFGQMMQTG----LPAVTSPPRQVS  136

Query  106   rrrKAELHDGGSYDLDIEYFRQRFKRTAVDD---ASSTMTTAPRQRGGGPTPTHAHGKVV  162
                K+ L D      + +    R + TA  D    S +M  +       PT      K  
Sbjct  137   TTTKS-LSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKAS  195

Query  163   KHKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLN-RGFLPPNVDLTPAFQSVSS  221
             K +   + + LP V     +     L+  D        LN R   P N          S 
Sbjct  196   KKRYNVSLKSLPAVQNGHASTSSSALA--DQSSETAHFLNSRHGSPLN----------SI  243

Query  222   PKSQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSI  281
               SQ      +   + +LH R E+P+R T  +S  + ++ +LKFD +A   + +     +
Sbjct  244   EISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGK--V  301

Query  282   EPHDESEALPLRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVT  341
             + H++      +A+          +   +  N        G RED +  +P       + 
Sbjct  302   QIHEQVTHFNDQALGECNCRLSTNQVSMALIN--------GFREDNSKLSPSRDHSKKMG  353

Query  342   ADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGS  401
               +   S + +  + E  +G N      S H F IH+G   R   +F+SF+  A ++W +
Sbjct  354   IPKVIKSTK-INTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNN  407

Query  402   IEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRP  461
             +EEV+  LE LL+ YF+P+A+I+GQR++TL+      ++  +LL+CV NE +V  L+ +P
Sbjct  408   VEEVVTTLERLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKP  467

Query  462   GQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRL  521
             GQR++G ++  RAA  +Q+F RM+  R  +  +  N      IQ+ WR YA  ++ + ++
Sbjct  468   GQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKI  527

Query  522   AHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLS  581
               +RE +   +   +R   S W  IR QRR V+H+ SIS+D R R+  E FS++QNLQL 
Sbjct  528   EAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQ  587

Query  582   RLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFS  641
             RL  L+D+NVE++Y+ PFEL+ ++ QY++KLLQL+GI++A  R++L+ PE+A++FP HFS
Sbjct  588   RLCALIDENVELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFS  647

Query  642   LATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMT  701
             L+  ++ SP+ ++R+ R ++G+ AYLV G PG ED+RLA  L++PILG  DP     + T
Sbjct  648   LSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGL-DPAKFFQMTT  706

Query  702   RSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAI  761
              SG KR F K + N   G+ D+YD +EL+FSLAKLI ++ +Q+  +LKLD DP  TGTA+
Sbjct  707   HSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTAL  766

Query  762   LDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKE  821
             +D+S + +++ +R   R  +YW+QP I++ + R ++QE++  I SL+   +PE++ SWK 
Sbjct  767   VDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKS  826

Query  822   FASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLS-GNGTTLSQRQR---  877
             F  AI  +GVV+E  P +  G +R N+FIEPS  V + ST + LS  N      R R   
Sbjct  827   FLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVV  886

Query  878   ---------RPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLT  928
                      R   F FPQTL+ HE +  AS  +G+ L ++   CGY SVD  +     L 
Sbjct  887   FDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKD-GICGYISVDFLV----ILD  941

Query  929   SPHKAERLWAVSLFPYLTDSAATFAAFHALHR-GVLNPATGRYNL-TARESTPPESDS--  984
                + + L+A++L P+LT+SAA+F+ F  L R G  N  TG ++L  A  S    SD+  
Sbjct  942   DQTQNKILYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPS  1001

Query  985   -------------ALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGV  1031
                          A +S ++     +   RSY + EYV +PNV+ +SY +FF  CR  GV
Sbjct  1002  SSSLSATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGV  1061

Query  1032  CFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGD-  1090
              FD+ER +G+VFLLADSLTAG+ G++   ++   AL   R A E I    GT+S +S   
Sbjct  1062  YFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSN  1121

Query  1091  ---SDIGSSVQLSGNFAEILGLL  1110
                +D+  +      F+EIL  L
Sbjct  1122  HSMNDLMRADSTRDRFSEILRAL  1144

>PYAR_13581
Length=730

 Score = 404 bits (1038),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 226/419 (54%), Positives = 279/419 (67%), Gaps = 63/419 (15%)

Query  234  NGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALPLR  293
            NG+V+L+RREEQPVRA                                 P       P +
Sbjct  1    NGAVRLYRREEQPVRAV--------------------------------PDISPRPPPPQ  28

Query  294  AMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLR  353
             + TVTISF +G  ES P+ +  E E D      +       +D D +  + AN+M+DLR
Sbjct  29   QLNTVTISFTDG--ESPPQQSTDEPEMDESPPQLDTEHAQHIDDADASESD-ANAMDDLR  85

Query  354  NNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILL  413
             NVEKIRGYNELLD YSLHQFIIHKGRA+R+TPEFQSFKRV QEIWG+++EVI+ALE LL
Sbjct  86   KNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALL  145

Query  414  TRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRR  473
            TRYF                  MA   T  LL+CVVNEDQVASL+RRPGQRYKGKDRKRR
Sbjct  146  TRYF------------------MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRR  187

Query  474  AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWK  533
            AATTLQAFFRM+ HRNRFR++ R G+SA  IQ TWR +A QQSLRR L   R E+L  W+
Sbjct  188  AATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQ  247

Query  534  AKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVE-  592
             ++ R+RSQWR+I  QRRVV+HV S+S+DE  R+S+++F+V+QNLQL+RLA +VD  VE 
Sbjct  248  LQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVDATVEY  307

Query  593  IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPN  651
            +VYV+PFEL T++S          G+ANA  RV++V PEHAA FP HFSLAT L+YSP+
Sbjct  308  VVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357

 Score = 298 bits (763),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 184/417 (44%), Positives = 232/417 (56%), Gaps = 80/417 (19%)

Query  759   TAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFAS  818
             TA+LDVS +TTLR+IRR  +PP YWKQPGIRDT+ARALLQELER IG+L KP H E F  
Sbjct  388   TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447

Query  819   WKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPS-----GDVHVMSTNDVLSGNGTTLS  873
             W+ FA AI   GVV+EALP  V GV+R+NIF+ P+      DV V+ST + L  +     
Sbjct  448   WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAG---  504

Query  874   QRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKA  933
                R P AF  PQTLVPH+A+VGA+ A+GR+L E++AFCGYASVDLQL ++E+       
Sbjct  505   ---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDETS------  555

Query  934   ERLWAVSLFPY-LTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIG  992
                  + L P    D++A  +    L   VL  A    +L AR S P  S SA       
Sbjct  556   ----GLYLLPSPAVDTSAPLSPATPL---VLQEA----HLLARSSRPLASPSA-------  597

Query  993   TLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAG  1052
                   +PR +   ++  HPN+  M   AFF  CR  GVCFDV R               
Sbjct  598   ------SPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTR---------------  636

Query  1053  IFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGLLRH  1112
                         +A+QYLRTAFEV+ REVG+ S  S D          GNF ++L LLRH
Sbjct  637   ------------RAMQYLRTAFEVLAREVGS-STPSSD----------GNFGDVLALLRH  673

Query  1113  RLSLEKEKEKRDRataiassstaspvpsttHEQTPMATPTLRVGKVDQIRRLRRTSQ  1169
             R+ +EKE+EK   +           +  TT     + TP LRVGK D +RRLRR SQ
Sbjct  674   RVGVEKEREKEAASVRSQQPPPPPAIAETTPATGAVVTPLLRVGKADTLRRLRRGSQ  730

>PHYKE_8394
Length=428

 Score = 255 bits (652),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 162/223 (73%), Gaps = 26/223 (12%)

Query  570  ENFSVKQNLQLSRL-AGLVDQNVEI-VYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRL  627
            ENF+V+QNLQL+R+ A  +D NV++ VYV+PFEL+ +VSQYF+KLLQL G+A++  RV+L
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  628  VFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPI  687
            VFPE A +FP                        GK+AYLVMG+PG EDQRLA+AL +PI
Sbjct  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  688  LGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWL  747
            LG   P   LPL+TRSG KR  I+ADVNVPTGTY++YD  EL  +LAKL ++H++Q  WL
Sbjct  275  LGAP-PAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333

Query  748  LKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRD  790
            LKLD DPLG G AI+D+S M  +R++RREKR PEYW+QPG RD
Sbjct  334  LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 44.3 bits (103),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 17/144 (12%)

Query  1    MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSNGPGNGSVIASNNAGAEIEEILQRAE  60
            ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+         +  A     + +     + E
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT-------AAAEAVEANASPMRHSTVKTE  53

Query  61   DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrr-----ppiarrrrrKAEL---  112
             ELR KAELVL+ +V +        ++ G L+P  TV                K ++   
Sbjct  54   MELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTR  113

Query  113  HDGGSYDLDIEYFRQRFKRTAVDD  136
             DGGS  + +E+FR+RF+ + V+D
Sbjct  114  KDGGS--IPMEFFRERFRNSNVED  135

 Score = 40.4 bits (93),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 1/28 (4%)

Query  343  DEAANSMEDLRNNVEKIRGYNELLDAYS  370
            DE A  ME+L  NV+KIRGYNELLDAY+
Sbjct  151  DEDA-EMEELGANVDKIRGYNELLDAYT  177

 Score = 37.4 bits (85),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 6/40 (15%)

Query  856  VHVMSTNDVL-SGNGTTLSQRQRRPAAFVFPQTLVPHEAI  894
            VHV ST +VL SG+G       R+  A+ FPQT  PHEA+
Sbjct  390  VHVTSTQNVLASGSGLN-----RKTVAYTFPQTAAPHEAV  424

>PHYSO_321157
Length=1180

 Score = 147 bits (370),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 162/284 (57%), Gaps = 28/284 (10%)

Query  1    MEQLQQRHHVEDVGrillqtqdqlrqlreqlVGSN-------GPGNGSVIASNNAGAEIE  53
            ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   S + +        
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  54   EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVrrppiarrrrrKAELH  113
             ILQ+ E ELR KAELVL+ +V +  ++     + G L+P  TV  PP  R R   A+  
Sbjct  61   AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  114  DGGSYD---LDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHA-------HGKVVK  163
               S D   + +E+FR++F+ ++V+   + M          P+P H        HG++++
Sbjct  121  VAKSMDASSIPMEFFREQFRNSSVEVRQTLM----------PSPLHLQRHLGIHHGRLMR  170

Query  164  HKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPK  223
             KTT + RLLP VNK DP+AP P L   DAK GVL+L+ RGFLP   DLTPAF   S   
Sbjct  171  KKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSG-A  229

Query  224  SQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDM  267
            + G+   V++  + ++H R EQ VR T ++    +NLA LKFD+
Sbjct  230  NDGSGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273

>CCI41703
Length=1518

 Score = 40.8 bits (94),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 16/99 (16%)

Query  419   PLAYIDGQRLM-----TLASMEMAKLSTC-ELLTCVVNEDQVASLIRRPGQRYKGKDRKR  472
             PL Y  G+ L+      L  +E  K   C    TC+  +  V   I R  QR++   R  
Sbjct  1263  PLEYQIGKSLIYFKRGVLEELEAMKFEFCYNEATCI--QKVVLGYIER--QRFR---RMV  1315

Query  473   RAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY  511
              A T LQA+ RMV+ R  +R +R   ++ + IQ+ W+ Y
Sbjct  1316  EAVTVLQAWSRMVVERTEYRYVR---NAVITIQRGWKRY  1351

>SPRG_19265
Length=2200

 Score = 40.8 bits (94),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 37/69 (54%), Gaps = 9/69 (13%)

Query  463  QRY------KGKDRKRR---AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYAC  513
            QRY      K  +R RR   AAT +Q   R  L R+RF  +  N  +A L+Q+T R Y C
Sbjct  858  QRYRVYRILKRAERYRRHFAAATCIQRSVRGFLARSRFHALVTNHRAAKLLQRTVRGYLC  917

Query  514  QQSLRRRLA  522
            +Q  RR LA
Sbjct  918  RQFYRRTLA  926

>H257_02388
Length=2293

 Score = 40.0 bits (92),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query  460  RPGQRYKGKDRKRR---AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY  511
            R  +  K  +R RR   AAT +Q +FR    R  FR++ R   SA+LIQ+T+R Y
Sbjct  914  RVARHLKKAERFRRQFDAATVIQRYFRGFWCRQAFRRLVRRHRSALLIQQTYRRY  968

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query  478  LQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVR  537
            LQA+ R+  H  +  + RR   +A +IQ+ +R + C+Q+ RR +   R   L +     R
Sbjct  910  LQAY-RVARHLKKAERFRRQFDAATVIQRYFRGFWCRQAFRRLVRRHRSALLIQ--QTYR  966

Query  538  RMRSQWRDIRQQRR  551
            R R +W     QR+
Sbjct  967  RYRHKWVVYEMQRQ  980

>PYU1_G003988
Length=262

 Score = 38.9 bits (89),  Expect = 0.12, Method: Composition-based stats.
 Identities = 46/194 (24%), Positives = 88/194 (45%), Gaps = 27/194 (14%)

Query  474  AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWK  533
            A  T+Q++ R+ + + R R + R   +A  +Q  WR + C++ L RR  H    R+    
Sbjct  24   ALVTIQSWLRVPIAK-RIRSMHRVQYAATQLQSLWRGFHCRKMLTRRQRH----RMYTHA  78

Query  534  AKV--RRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNV  591
            ++V  R  R+       Q+ +  H A+ ++ +    S++ + +++ L  +    L   + 
Sbjct  79   SRVIQRGFRAHVWRCEFQKFIREHRAACTITQ----SIKRYCLQRRLLRAWYHRLATFHA  134

Query  592  EIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPN  651
             IV            Q +++  Q++ +  A  R ++     A Q  QHF    H +   +
Sbjct  135  TIVI-----------QGWVR-YQIAKLHRARARAKM--HGSAVQMMQHFFKRAHFLLVFD  180

Query  652  CIRRIQRLVQGKEA  665
              RR+QRL+Q K A
Sbjct  181  --RRVQRLLQQKTA  192

>PHYKE_3824
Length=1297

 Score = 39.3 bits (90),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 12/113 (11%)

Query  456  SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
            ++IRR   R K   R+++ AT ++AF RMV+ R R++  R+     +L+Q  WR +A ++
Sbjct  631  AMIRRSLVRRKYL-REKKMATRIEAFGRMVICRQRYQDERK---KIILVQSLWRMHAVRK  686

Query  516  SLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASIS--VDERTR  566
               +R      +R       + R  SQ +  R  R  +I + + S    ERTR
Sbjct  687  QYTKR------DRQITLLQSLWRCHSQAKKYRDTREKIITLQAFSRMTVERTR  733

>PITG_05631
Length=1859

 Score = 38.5 bits (88),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 12/113 (11%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
             ++IRR   R K   R+++ AT ++AF RMV++R R+   R+     +L+Q  WR +    
Sbjct  1025  AMIRRSLVRRKFL-REKKMATRIEAFGRMVIYRQRYLNERK---KIILVQSLWRMH----  1076

Query  516   SLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASIS--VDERTR  566
               R R  + + +R       + R  +Q +  R+ R  +I + + S    ERTR
Sbjct  1077  --RLRREYTKRDRQITLLQSLWRCHAQAKKYRETRDKIITIQAFSRMTLERTR  1127

>SDRG_11672
Length=2193

 Score = 38.5 bits (88),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 35/65 (54%), Gaps = 3/65 (5%)

Query  458  IRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSL  517
            I +  +RY+   R+  AAT +Q   R  L R RF  + RN  +A ++Q+T R Y C+   
Sbjct  874  ILKRAERYR---RQFAAATCIQRSVRGFLARTRFHALVRNHRAAKILQRTVRGYLCRAFY  930

Query  518  RRRLA  522
            R  LA
Sbjct  931  RHTLA  935

>SPRG_02231
Length=1283

 Score = 38.1 bits (87),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (45%), Gaps = 24/158 (15%)

Query  403  EEVIQALE----ILLTRYFVPLA-----YIDGQRLMTLASMEMAKLSTCELLTCVVNEDQ  453
            E +++ALE    + LT Y + +      Y+  +R +++    +   S      C +   +
Sbjct  769  EGILEALEAQRGVALTSYAIRIQKHMKRYLCRKRFVSIQKATIKVQSYLRRWHCQLQYHR  828

Query  454  VASLIRRPGQRYKGK--------DRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQ  505
            + S +     RY+G          R +RA T LQA  R  L R+RF  I+   S    +Q
Sbjct  829  LRSRVIAVQARYRGHIARRRVLAMRTKRALTKLQAVVRGFLARSRFLSIKAAVSK---VQ  885

Query  506  KTWRSYACQQSLRRRLAHVREER-LGEWKAKVRRMRSQ  542
              WR    ++   +RLA  +E R LG   +KV  ++SQ
Sbjct  886  SFWRITYLRRIFVKRLAQEKERRALG---SKVLSLQSQ  920

>PHYSO_389108
Length=1024

 Score = 38.1 bits (87),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 42/83 (51%), Gaps = 1/83 (1%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERL  529
            RK+RAA  +Q F R +    + +++     +A L+Q +W+ +   +   RRL   RE+  
Sbjct  204  RKQRAARRIQTFVRSIRSALQAKRLETENRAASLVQASWKRFVHVRDYPRRLEERREDIE  263

Query  530  GEWKAKVRRMRSQW-RDIRQQRR  551
             +  A+      QW  D+ Q+RR
Sbjct  264  MQQMAQSEEELRQWLADLEQKRR  286

>PHYRA_97068
Length=1488

 Score = 37.7 bits (86),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (47%), Gaps = 16/77 (21%)

Query  460   RPGQRYKGKDRKRR------AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTW-----  508
             R   +Y+ + ++RR      AA  L AF R VL R RFRK++        + + W     
Sbjct  1047  RVQTKYRARTQRRRFLSEKKAAIVLAAFTRQVLQRRRFRKLKACIVKTQAMVRKWEARSR  1106

Query  509   -----RSYACQQSLRRR  520
                  R+  C QSLRR+
Sbjct  1107  FVALRRALVCVQSLRRQ  1123

>H257_14431
Length=2148

 Score = 37.7 bits (86),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 54/101 (53%), Gaps = 12/101 (12%)

Query  453   QVASLIRRPGQRYKGK---DRKRR--AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKT  507
             ++AS I++  + Y+ +   DR RR  AA T+Q  +R    R  F K RR  ++  L+Q++
Sbjct  1404  KLASKIQKAYRAYRARTLADRLRRHKAALTMQRVYRGFKGRLVFDKRRREDAAIRLVQRS  1463

Query  508   WRSYACQQSLR----RRLAHVREERLGE---WKAKVRRMRS  541
             WR    +   +    +RLA +  +R+      + +VRR+R+
Sbjct  1464  WRGKMGRMQFKSTKSQRLAAIEMQRMVRGHVGRLRVRRIRT  1504

>SPRG_03605
Length=1121

 Score = 37.7 bits (86),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 29/40 (73%), Gaps = 0/40 (0%)

Query  473  RAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYA  512
            RA+ TLQ   R  +H +RF++ RR+ ++A+L+Q+ WR +A
Sbjct  263  RASRTLQHAARGFVHYSRFQRYRRSKTAAVLLQRVWRGHA  302

>SPRG_01406
Length=1663

 Score = 37.7 bits (86),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (57%), Gaps = 5/72 (7%)

Query  478  LQAFFRMVL-HRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKV  536
            LQA++RMV  +R+R R   R G +A ++Q+ WR Y  Q  L+    H++E R    KA+ 
Sbjct  562  LQAWWRMVAAYRSRRRYALRIGPAASVLQRAWRRYRSQCHLK----HLKEARANAIKARK  617

Query  537  RRMRSQWRDIRQ  548
               ++  +D RQ
Sbjct  618  LAKKNFRKDQRQ  629

>PHYRA_73096
Length=1841

 Score = 37.7 bits (86),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 53/105 (50%), Gaps = 10/105 (10%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
             ++IRR   R K   R+++ AT ++AF RM++ R R+R  R+     +L+Q  WR ++ ++
Sbjct  1005  AMIRRSLVRRKFL-REKKMATRIEAFGRMIICRQRYRDERK---KIILVQSLWRMHSARK  1060

Query  516   SLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASIS  560
                 R      +R       + R  +Q +  R  R+ +I + + S
Sbjct  1061  QYTMR------DRQVTLLQSLWRCHAQAKKYRDTRKKIIMIQAFS  1099

>SPRG_21053
Length=1121

 Score = 37.4 bits (85),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 63/117 (54%), Gaps = 8/117 (7%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQS-LRRRLAHVREER  528
            R R A   LQA FR      RF ++ +  +SA+++Q+ WR+Y  Q++ LR R A +  + 
Sbjct  777  RVRSAIVRLQANFRCHQRHRRF-QLHKLYTSAVVLQRNWRTYKAQKAYLRLRAAVLAIQG  835

Query  529  LGEWKAKVRRMRSQWRDIRQQRRV--VIHVASISVDE----RTRLSMENFSVKQNLQ  579
              + +A   + + +  ++ +Q+ +   +HV  + +DE    R ++   N +++Q LQ
Sbjct  836  QIKQRALDAKRKLEADELAKQQSIEHELHVLQLRLDEEKAMRAQMEAANSTLQQQLQ  892

>PYVX_15212
Length=1907

 Score = 37.4 bits (85),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 52/101 (51%), Gaps = 12/101 (12%)

Query  452   DQVASLIRRPGQRYKGKD-----RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQK  506
             +Q+AS+I+R  + +  +      ++ R A  LQ  +R  L R +++ +++   +  LIQ+
Sbjct  1135  EQMASVIQRAFRAFYARMLLVRIKRERCAMHLQRLWRAKLARKKYKGLKKEDWAIRLIQR  1194

Query  507   TWRSYACQQSLRRR----LAHVREERLGE-WKA--KVRRMR  540
              WR    + S R R    LA V  +R+   W A  KV R+R
Sbjct  1195  HWRGKMGRDSYRDRIQKYLAAVDIQRITRGWLACRKVERIR  1235

>HYAP_11358
Length=1851

 Score = 37.4 bits (85),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (54%), Gaps = 10/112 (9%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWR-SYACQ  514
             ++IRR   R K   R+++ AT ++AF RM++ R R+R  R   +  +L+Q  WR  YA +
Sbjct  1021  AMIRRSLVRRKFL-REKKMATRIEAFGRMIVCRRRYRDER---NKVILLQSLWRMHYARK  1076

Query  515   QSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTR  566
             Q  +R    +  + L    A+ ++    + D R++   V   A ++V ERTR
Sbjct  1077  QYQKRDRQVILLQSLWRCHAQAKK----YHDTREKIVTVEAFARMTV-ERTR  1123

 Score = 34.7 bits (78),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 45/86 (52%), Gaps = 5/86 (6%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY-ACQ  514
             SL R   Q  K  D  R    T++AF RM + R R+ K+R   S+A ++QKT R++   +
Sbjct  1090  SLWRCHAQAKKYHD-TREKIVTVEAFARMTVERTRYLKMR---SAARVVQKTVRAFLGHR  1145

Query  515   QSLRRRLAHVREERLGEWKAKVRRMR  540
             Q +R R   VR + L     + ++ R
Sbjct  1146  QKVRFRRGLVRTQALCRGYVQRKKYR  1171

>H257_00993
Length=1342

 Score = 37.0 bits (84),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 7/74 (9%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREER-  528
            R+ RAAT LQA  RM  HR R + +R   S +  IQ  WR+   ++ L +R+A  +++R 
Sbjct  879  RRVRAATKLQAAARM--HRQRTQYLREVASIST-IQSFWRTMYRRRKLAKRMAQEQQQRA  935

Query  529  LGEWKAKVRRMRSQ  542
            LG   +KV  ++SQ
Sbjct  936  LG---SKVLHLQSQ  946

>PYU1_G012237
Length=1481

 Score = 37.0 bits (84),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 29/52 (56%), Gaps = 0/52 (0%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRL  521
            +++R A  LQ  +R  L R +++ ++R   +  L+Q+ WR    + S R RL
Sbjct  729  KQQRCAIQLQRLWRARLARKKYKGMKREDWAVRLVQRNWRGKLGRDSFRARL  780

>PYAP_13380
Length=1372

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 16/105 (15%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNG---SSAMLIQKTWRSYACQQSLRRRLAHVRE  526
            R+ RAA  +QA  R  L R R ++IRR+     SA+++Q+ +R Y  ++ L + L   + 
Sbjct  385  RRHRAAVQMQALVRGHLARCRVKRIRRDKLEHESALILQRCYRGYTGKR-LAKALFKAQR  443

Query  527  ERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMEN  571
            E L      VRR++  +R+   QRR+++        +R RL  E 
Sbjct  444  ETLA-----VRRIQRSFRN--HQRRILLRAI-----QRARLEHEK  476

>H310_05643
Length=1316

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 5/56 (9%)

Query  472  RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLR--RRLAHVR  525
            RRA   LQ+  RM   RN+FR++R    +   IQK W ++  + S R  R+LA  R
Sbjct  834  RRAIIVLQSHVRMWTARNKFRRLRL---AVQFIQKAWVAHRAKWSARSERQLAWTR  886

>H310_00375
Length=1315

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 54/92 (59%), Gaps = 8/92 (9%)

Query  453  QVASLIR-RPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY  511
            ++ +L+R R  ++   + R+  AAT  Q+  RM  HR R + +R N S + +IQ  WR+ 
Sbjct  844  KLQALVRGRGARKVVHQLRRVLAATRFQSVVRM--HRQRKQYLRTNASIS-IIQSFWRNT  900

Query  512  ACQQSLRRRLAHVREER-LGEWKAKVRRMRSQ  542
              ++ L +R+A  +++R LG   +KV  +++Q
Sbjct  901  YIRRKLLKRMAQEKQQRALG---SKVLHLQTQ  929

>PPTG_12879
Length=1298

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 39/84 (46%), Gaps = 0/84 (0%)

Query  468  KDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREE  527
            ++RK+RAA  +QAFFR +      R+       A  IQ  W+ +   +   RRL   ++E
Sbjct  431  ENRKQRAAQRIQAFFRDIRSALDARQQAAENRGATCIQAAWKRFVHLKEYPRRLEARKQE  490

Query  528  RLGEWKAKVRRMRSQWRDIRQQRR  551
                   +  R   QW D  +++R
Sbjct  491  VEMLLMVQSEREMRQWMDDMEKKR  514

>PYIW_20703
Length=1077

 Score = 36.2 bits (82),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (52%), Gaps = 13/89 (15%)

Query  473  RAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEW  532
            ++   LQ +      R+ +++ R+   SA+L+Q TWR + C    RRR  ++ E + G  
Sbjct  579  KSVIILQRYCMGYAARSVYQRTRQ---SAILVQTTWRRFTC----RRRFLYIIERQRGAI  631

Query  533  KAKVRRMRSQWRDIRQQRRVVIHVASISV  561
            K     M++  R     RR+V HV +++V
Sbjct  632  K-----MQAAARGF-LSRRMVKHVMAVTV  654

>PYAP_22130
Length=582

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 15/127 (12%)

Query  467  GKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVRE  526
            GK ++R  +  L   +R        RK RR   +A +IQK +RSY  +++ +     V++
Sbjct  4    GKKKQRGKSQKLNPGWR------PGRKKRRGNMAATMIQKCFRSYLLRKAFKETRNAVKD  57

Query  527  ERLGEWKAKVRRMRSQWRDIRQQ--RRVVIHVASISVDERTRLSMENFSVKQNLQLSRLA  584
                 W     R R+ +R I      R  +H+ ++S++  +       + K+ L + R+ 
Sbjct  58   SFQALWAFHHARNRNHYRQINLHTLSRDELHLIALSLNLPS-------TGKKVLLMGRIQ  110

Query  585  GLVDQNV  591
              VDQN+
Sbjct  111  RWVDQNI  117

>PYAP_21615
Length=1376

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 3/44 (7%)

Query  472  RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
            R+ A  LQ   R  + R RF+++R+   SA++IQK WR Y  ++
Sbjct  809  RKYALVLQKTVRCFIMRRRFQRLRK---SAIVIQKYWRRYVSRK  849

>CCA18434
Length=1985

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query  462   GQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAML-IQKTWR  509
              QRYK   R++RAATTL  + R+ L R R  + RR   +A L IQK +R
Sbjct  1063  NQRYKRYIREKRAATTLTHWTRVYLDRTREERHRRLQHNATLRIQKWYR  1111

>CCA18292
Length=1985

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query  462   GQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAML-IQKTWR  509
              QRYK   R++RAATTL  + R+ L R R  + RR   +A L IQK +R
Sbjct  1063  NQRYKRYIREKRAATTLTHWTRVYLDRTREERHRRLQHNATLRIQKWYR  1111

>PPTG_02795
Length=1861

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 57/115 (50%), Gaps = 15/115 (13%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
             ++IRR   R K   R+++ AT ++AF RMV+ R R+   R+     +L+Q  WR +    
Sbjct  1025  AMIRRSLVRRKFL-REKKMATRIEAFGRMVICRQRYLDERK---KIILVQSLWRMH----  1076

Query  516   SLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSME  570
               R R  + + +R       + R  +Q +  R+ +  +I + +      TR+S+E
Sbjct  1077  --RIRKEYTKRDRQVTLLQSLWRCHAQAKKYRETKEKIITIQAF-----TRMSLE  1124

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 57/110 (52%), Gaps = 12/110 (11%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY-ACQ  514
             SL R   Q  K ++ K +   T+QAF RM L R+R+ K+R   S+A ++Q   R+Y   +
Sbjct  1094  SLWRCHAQAKKYRETKEKI-ITIQAFTRMSLERSRYLKLR---SAARVVQSAVRTYLGRR  1149

Query  515   QSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDER  564
             Q +R R   V+ + L  ++  V+R     +  RQ    +I V S+   +R
Sbjct  1150  QFIRFRRGVVKTQAL--YRGYVQR-----KKYRQTVERIIKVQSVFRQQR  1192

>PHYSO_360938
Length=1200

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 32/50 (64%), Gaps = 0/50 (0%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRR  519
            RKRR++  +QA +R     NR+++I R   +A+ +Q+T R +  ++ ++R
Sbjct  711  RKRRSSIRIQAIWRSWSCWNRYQRIIRRERAALTLQRTTRGFLARKQVKR  760

>H310_02556
Length=1106

 Score = 35.8 bits (81),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (59%), Gaps = 5/46 (11%)

Query  471  KRRAATTLQAFFRMVLHRNRFRKIR-----RNGSSAMLIQKTWRSY  511
            +R AA TLQ F R  L R   + +R     R+G +A+++Q  WRSY
Sbjct  700  RRAAALTLQCFVRCFLARQCTQALRLEQRGRHGHAAVVVQAAWRSY  745

>PYU1_G008807
Length=91

 Score = 32.7 bits (73),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (51%), Gaps = 12/73 (16%)

Query  787  GIRDTIA-RALLQELEREIGSLLKPSHPEIFASWK-----------EFASAIPEFGVVVE  834
            G+R T+A RA ++   R  GSL K  H E +++W+           EF +++  +GV+  
Sbjct  6    GVRRTVALRARVENQRRFGGSLSKNKHIENYSNWRGDSEKRFKFDGEFFTSMAAWGVIPF  65

Query  835  ALPFHVAGVIRMN  847
             + + VA   R N
Sbjct  66   TIYYAVASGERHN  78

>PYIW_13154
Length=1826

 Score = 35.8 bits (81),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 39/69 (57%), Gaps = 4/69 (6%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
             ++IRR   R K   R+++ AT ++AF RM++ R RF   R+     +L+Q  WR    ++
Sbjct  1021  AMIRRALVRRKFL-REKKMATRIEAFGRMIICRQRFNDERQR---IVLLQSLWRMQMKRR  1076

Query  516   SLRRRLAHV  524
               +RR+  +
Sbjct  1077  QFKRRMLQI  1085

>PPTG_17651
Length=1871

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 50/104 (48%), Gaps = 9/104 (9%)

Query  471   KRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRR----LAHVRE  526
             + + A  LQ  +R  + R R++ ++R   +A L+Q+ WR    + S ++R    LA +  
Sbjct  1128  REKCAVNLQRLWRARVARKRYKGLKREDWAARLLQRHWRGKMGRTSYKQRMLEYLAALDI  1187

Query  527   ERLGE-WKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSM  569
             +R+   W A+    RS  R  +Q  R ++ V  +      R+ M
Sbjct  1188  QRIARGWLAR----RSVLRRQQQIHRSIVRVQQLMRRYVARMKM  1227

>H257_09737
Length=1800

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 37/73 (51%), Gaps = 4/73 (5%)

Query  470   RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSL-RRRLAHVREER  528
             + +R    +Q+  R  L R  +R I R     +LIQ  WR + C Q+  R+R A V+ + 
Sbjct  1050  KTKRQIVLVQSLVRRYLQRKHYRHIMRQ---FVLIQAMWRRHQCVQTYQRQRWAIVQIQS  1106

Query  529   LGEWKAKVRRMRS  541
             LG+   + RR  +
Sbjct  1107  LGKMIPQRRRFHA  1119

>H310_02352
Length=2193

 Score = 35.4 bits (80),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 3/53 (6%)

Query  459  RRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY  511
            R+  +R++   R+  AAT +Q +FR    R  FR   R   SA+ IQ+T+R Y
Sbjct  827  RKQAERFR---RQFEAATVIQRYFRGYWCRQAFRIFVRRHRSAVAIQRTYRRY  876

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERL  529
            R+R     +   +R+  HR +  + RR   +A +IQ+ +R Y C+Q+ R     VR  R 
Sbjct  809  RRRTWCFYILHAYRVARHRKQAERFRRQFEAATVIQRYFRGYWCRQAFR---IFVRRHRS  865

Query  530  G-EWKAKVRRMRSQW  543
                +   RR R +W
Sbjct  866  AVAIQRTYRRYRQKW  880

>HYAP_08623
Length=1187

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 65/150 (43%), Gaps = 21/150 (14%)

Query  472  RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ---SLRRRLAHVREER  528
            R+ A  LQ   R  L R RF    R     ++IQK WR Y   +    LRR +  ++ + 
Sbjct  621  RKYAIVLQKNVRCWLMRRRFL---RQKQQIVVIQKYWRRYVIHKRYLKLRRGVVKLQAQA  677

Query  529  LGEWKAKVRR-MRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQ-----NLQLSR  582
             G    K+ R ++  +R +R Q    +H+      ER R  M   +VK+        + R
Sbjct  678  RGVSTRKMYRVLKFDYRIVRFQAYCRMHM------ERQRYLMRVSAVKRLQGFFRFSILR  731

Query  583  LAGLVDQNVEIVYVTPFELSTEVSQYFIKL  612
            L  L     E  Y    EL ++V+Q  +KL
Sbjct  732  LVFLRKMEKEKAYK---ELGSKVAQLQMKL  758

>PYU1_G013320
Length=1348

 Score = 35.0 bits (79),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 49/112 (44%), Gaps = 23/112 (21%)

Query  455  ASLIRRPGQRYKGKDRK---RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSY  511
            A LI+R   R+  + R    RR  T LQA  R    R +F   RR     +LIQ  WR  
Sbjct  872  AILIQRTACRWVARKRMMKVRRMITKLQAIQRRRSLRQKFLLTRRR---CVLIQSIWRGV  928

Query  512  ACQ---------------QSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQ  548
            + +               QSL RR  H  ++R   ++  V +M+SQ +  +Q
Sbjct  929  SSRQRSYLLMKETMAIRIQSLYRR--HREQKRFARFRNAVVKMQSQLKMKKQ  978

>PITG_17963
Length=1783

 Score = 35.0 bits (79),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 28/49 (57%), Gaps = 0/49 (0%)

Query  473   RAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRL  521
             R A  LQ  +R  + R R++ ++R   +A L+Q+ WR    + S ++R+
Sbjct  1101  RCAINLQRLWRARVARKRYKGLKREDWAARLLQRHWRGKMGRTSYKQRM  1149

>PHALS_01137
Length=1332

 Score = 35.0 bits (79),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 34/57 (60%), Gaps = 7/57 (12%)

Query  473  RAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYAC----QQSLRRRLAHVR  525
            ++  TLQ +      R+R+++ RR   S++ IQ TWRS++C    Q  +RR+ A V+
Sbjct  828  KSVITLQRYCLGYSKRSRYQRKRR---SSIRIQTTWRSWSCWHWYQGFIRRKRAAVK  881

>PHYSO_359062
Length=1775

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 53/105 (50%), Gaps = 10/105 (10%)

Query  456   SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
             ++IRR   R K   R+++ AT ++AF RMV+ R R+   R+     +++Q  WR ++ ++
Sbjct  952   AMIRRSLVRRKFL-REKKMATRIEAFGRMVICRQRYLDERK---KIIIVQSLWRMHSARK  1007

Query  516   SLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASIS  560
                +R      +R       + R  +Q +  R+ R  +I + + S
Sbjct  1008  QYTKR------DRQVTLLQSLWRCHAQAKKYRETREKIITIQAFS  1046

>PYIR_22258
Length=1323

 Score = 34.7 bits (78),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 45/91 (49%), Gaps = 17/91 (19%)

Query  473  RAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHV--REERLG  530
            ++  TLQ +      R+ +++ R+   SA+LIQ  WR  +C    RRR  H+  RE    
Sbjct  824  KSVITLQRYCLGYAARSVYKRKRQ---SAILIQSAWRRVSC----RRRYLHIIQRERSAI  876

Query  531  EWKAKVRRMRSQWRDIRQQRRVVIHVASISV  561
            + +A  R   S        RR+V HV +++V
Sbjct  877  KLQAAARGFLS--------RRLVRHVKAVTV  899

>CCI46586
Length=1371

 Score = 34.7 bits (78),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 31/130 (24%), Positives = 61/130 (47%), Gaps = 18/130 (14%)

Query  472  RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGE  531
            R AA  +Q +++      R+ ++ R   +A++IQK WR + C+Q +R   A +R ++   
Sbjct  729  RVAAVRIQRWWK-----KRWEEVTRCNLAALMIQKRWRKW-CKQRIRWNFAALRIQK--R  780

Query  532  WKAKV-RRMR--------SQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSR  582
            WK +   R+R         +W + R    +V + A++ + +R R   E   ++ N    R
Sbjct  781  WKKRCEERIRRNFAALIIQKWWEKRCGEVIVWNSAALMIQKRWRKWCEQ-RIRWNFAALR  839

Query  583  LAGLVDQNVE  592
            +     +  E
Sbjct  840  IQKWWKKRCE  849

>SDRG_16344
Length=1202

 Score = 34.7 bits (78),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (54%), Gaps = 17/63 (27%)

Query  474  AATTLQAFFRMVLHRNRFRKIRRNG-----------------SSAMLIQKTWRSYACQQS  516
            +A TLQAF RM+L R R+R+ + +G                 ++A+++Q  +R +  Q+ 
Sbjct  714  SAVTLQAFARMILARTRYRRQQASGRTIQSAVRLWCFRRQRSAAAVVLQSCYRRHRAQRK  773

Query  517  LRR  519
            LR+
Sbjct  774  LRQ  776

>HYAP_00989
Length=1330

 Score = 34.7 bits (78),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 0/55 (0%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHV  524
            RKRR+   +QA +R   +  R++++ R   + + +Q T R YA ++ ++R  A +
Sbjct  844  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVKRMQAAI  898

>PYAP_13302
Length=1241

 Score = 34.7 bits (78),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 27/46 (59%), Gaps = 0/46 (0%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
            R R +A  +QAF+R V  R ++    +   SA+++QK  R YA +Q
Sbjct  781  RHRSSAIRVQAFWRCVRCRRKYLAALKRRRSAIIVQKVLRGYATRQ  826

>PYAP_14743
Length=947

 Score = 34.7 bits (78),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  463  QRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIR  495
            Q +K   R+ RA  T+Q+ +RMVLHR R+ K R
Sbjct  285  QAHKRHLRRERATATIQSMWRMVLHRRRYLKWR  317

>PITG_08540
Length=1086

 Score = 34.7 bits (78),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 6/64 (9%)

Query  467  GKDRKRRAATTLQAFFR---MVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAH  523
             ++RK+RAA  +QAFFR    VLH  R  +  R   +A+++Q  W+     +   RRL  
Sbjct  227  AENRKQRAAKRIQAFFRDVKSVLHAQRCAEKER---AAIILQAAWKRNMHAKEYPRRLEA  283

Query  524  VREE  527
             ++E
Sbjct  284  RKQE  287

>PYIW_21993
Length=1321

 Score = 34.7 bits (78),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 48/91 (53%), Gaps = 9/91 (10%)

Query  460  RPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRN---GSSAMLIQKTWRSYACQQS  516
            R G+++    RK RAA  LQ F R+ + +    + +RN    +SA  IQ+  R +     
Sbjct  340  RLGRKHALSHRKMRAAVQLQRFLRLCIAKCVLERRKRNRLDHASANTIQRGVRDF-----  394

Query  517  LRRRLAHVREERLGEWKAKVRRMRSQWRDIR  547
            L +RL H R + + +W  + RR+++ +R  R
Sbjct  395  LEKRLVHKRRQMVKKW-LQARRIQACYRGHR  424

>CCA20563
Length=1303

 Score = 34.3 bits (77),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 30/63 (48%), Gaps = 0/63 (0%)

Query  460  RPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRR  519
            R  Q+ +   R R     +Q+ +R V  R RF+++      A  IQ  +RSY  Q  +RR
Sbjct  821  RGFQQKRQYQRLRCRTIQIQSMWRCVQCRKRFQRLIYEKKCATTIQSRFRSYVAQMRIRR  880

Query  520  RLA  522
              A
Sbjct  881  EKA  883

>CCA18606
Length=1303

 Score = 34.3 bits (77),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 30/63 (48%), Gaps = 0/63 (0%)

Query  460  RPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRR  519
            R  Q+ +   R R     +Q+ +R V  R RF+++      A  IQ  +RSY  Q  +RR
Sbjct  821  RGFQQKRQYQRLRCRTIQIQSMWRCVQCRKRFQRLIYEKKCATTIQSRFRSYVAQMRIRR  880

Query  520  RLA  522
              A
Sbjct  881  EKA  883

>PPTG_12348
Length=1870

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 24/41 (59%), Gaps = 0/41 (0%)

Query  470   RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRS  510
             R+R+AA  L AF R VL R RF+K++        + + W++
Sbjct  1080  RERKAAIVLAAFVRQVLQRRRFKKLKACIVKTQAMVRKWKT  1120

>HYAP_12850
Length=978

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 0/55 (0%)

Query  470  RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHV  524
            RKRR+   +QA +R   +  R++++ R   + + +Q T R YA ++ ++R  A +
Sbjct  492  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVKRMQAAI  546

>PYU1_G008456
Length=253

 Score = 33.5 bits (75),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 9/54 (17%)

Query  849  FIEPSGD--------VHVMSTNDVLSGNGTTLS-QRQRRPAAFVFPQTLVPHEA  893
            F +P+GD        +H+M TND L      L+   + RPA   FP+ +V H+ 
Sbjct  165  FEDPNGDPILLPFPSIHIMGTNDPLYTESIKLAAMYEERPAGAAFPKIVVEHDG  218

>CCI46638
Length=1989

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 5/76 (7%)

Query  452   DQVASLIRR--PGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWR  509
             ++V  L++R    QRYK   R+++AATTL  + R  L R R  + RR   +A L  + W 
Sbjct  1054  NKVYWLVQRYLTHQRYKRHIREKKAATTLTHWTRAYLIRTRVERHRRLQYNATLKLQKW-  1112

Query  510   SYACQQSLRRRLAHVR  525
              Y  Q+ L     HVR
Sbjct  1113  -YRMQKKL-NAYRHVR  1126

>CCI49118
Length=1989

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 5/76 (7%)

Query  452   DQVASLIRR--PGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWR  509
             ++V  L++R    QRYK   R+++AATTL  + R  L R R  + RR   +A L  + W 
Sbjct  1054  NKVYWLVQRYLTHQRYKRHIREKKAATTLTHWTRAYLIRTRVERHRRLQYNATLKLQKW-  1112

Query  510   SYACQQSLRRRLAHVR  525
              Y  Q+ L     HVR
Sbjct  1113  -YRMQKKL-NAYRHVR  1126

>SDRG_06652
Length=1450

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 52/107 (49%), Gaps = 20/107 (19%)

Query  470  RKRRAATT-LQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLR--RRLAHV--  524
            R+ +A+TT +QAF RM L R+RF   +R+  +   + + + +    + LR  RRLA    
Sbjct  752  RRLKASTTRVQAFARMALQRSRFWTAQRSVHTLQRVARGFLARCVCRRLRSQRRLALYLQ  811

Query  525  -----REERLGEWKAKVR----RMRSQWR------DIRQQRRVVIHV  556
                 R+ER+     K R    R++ QWR        R  RR V+ V
Sbjct  812  AWYRGRQERIAWQCCKERRASLRIQRQWRRHAAQQTYRCTRRDVVRV  858

>PHYCA_574647
Length=845

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 57/127 (45%), Gaps = 12/127 (9%)

Query  471  KRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLG  530
            + + A  LQ  +R  + R R++ ++R   +  L+Q+ WR    + S ++R+         
Sbjct  115  REKCAVNLQRLWRARVARKRYKGLKREDWAVRLLQRHWRGKMGRSSYKQRMLEYLS----  170

Query  531  EWKAKVRRMRSQWRDIRQ--QRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVD  588
                 ++R+   W   R   +RR  IH A++ +    RL M  +  ++ +   RL     
Sbjct  171  --ALDIQRIARGWLAKRGVVRRRQQIHQAAVQIQ---RL-MRRYVARKKMFKQRLQRNAA  224

Query  589  QNVEIVY  595
             N++ V+
Sbjct  225  MNIQRVF  231

>H257_08655
Length=86

 Score = 31.2 bits (69),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 27/47 (57%), Gaps = 0/47 (0%)

Query  237  VKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEP  283
            ++L R E+ PV+A AY   G  ++ATL+    + + V A + +  +P
Sbjct  35   LRLRRHEQDPVKAAAYLRQGEADVATLRLVALSPSLVDAMDRKPPQP  81

>H257_01952
Length=908

 Score = 33.9 bits (76),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 12/127 (9%)

Query  489  NRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKV----------RR  538
            NR   + + GS+   I    +S+     LR++  H+R  R   W+ K           ++
Sbjct  235  NRASVLPQIGSNPHSIDVAAKSFMISTKLRKKAQHIRTTRRETWQKKQVEAQGILLRHKK  294

Query  539  MRSQWRDIRQQRRVVIHVASISVDERTR-LSMENFSVKQNLQLSRLAGLVDQNVEIVYVT  597
            +  Q+ +IR  RR  +H A  ++    R L +  +   +  QL  L  ++ Q+V I Y  
Sbjct  295  VLEQY-NIRTVRREELHEAKPTLTGSNRFLILPTYGWYKGWQLMTLVIVLHQSVYIPYSL  353

Query  598  PFELSTE  604
             FE S +
Sbjct  354  SFESSND  360

>PITG_13065
Length=1883

 Score = 33.9 bits (76),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 32/63 (51%), Gaps = 10/63 (16%)

Query  470   RKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWR----------SYACQQSLRR  519
             R+++AA  L AF R VL R RF+K++ +      + + W+          +    QSLRR
Sbjct  1081  REKKAAIVLAAFVRQVLQRRRFKKLKASIVKTQAMVRKWKARRMFVALRCALVVLQSLRR  1140

Query  520   RLA  522
             + A
Sbjct  1141  QRA  1143

>PYIR_13849
Length=1405

 Score = 33.9 bits (76),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 39/69 (57%), Gaps = 4/69 (6%)

Query  456  SLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQ  515
            ++IRR   R K   R+++ AT ++AF RM++ R R+   R+     +LIQ  WR    ++
Sbjct  564  AMIRRALVRRKFL-REKKMATRIEAFGRMIICRQRYADERQ---KLVLIQSLWRMQIKRR  619

Query  516  SLRRRLAHV  524
              +RR+  +
Sbjct  620  QFKRRMLQI  628

>H310_11272
Length=1799

 Score = 33.9 bits (76),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 6/53 (11%)

Query  472   RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHV  524
             R+AATT+ +  RM L R R+RK R   ++ + +Q  WRS+  +   R  LA V
Sbjct  1122  RKAATTIASGIRMFLARRRYRKSR---AAFVKLQARWRSFVAK---RHYLAQV  1168

Lambda      K        H        a         alpha
   0.318    0.133    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 98974155348

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40