Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_24025284681101105517e-74
PITG_07398624135783730.34
PHALS_133118347179260672.1
PYU1_G0089265346242642672.4
PYIW_18799192790856662.8
H257_12607221062970644.8
CCI50309560333243645.0
PYAP_2011167161041638.1
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_24025

Length=110
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_24025                                                            216        7e-74
PITG_07398                                                            32.7       0.34 
PHALS_13311                                                           30.4       2.1  
PYU1_G008926                                                          30.4       2.4  
PYIW_18799                                                            30.0       2.8  
H257_12607                                                            29.3       4.8  
CCI50309                                                              29.3       5.0  
PYAP_20111                                                            28.9       8.1  

>PPTG_24025
Length=110

 Score = 216 bits (551),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)

Query  1    MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEG  60
            MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEG
Sbjct  1    MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEPLLEG  60

Query  61   ASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  110
            ASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC
Sbjct  61   ASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  110

>PITG_07398
Length=357

 Score = 32.7 bits (73),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 35/83 (42%), Gaps = 21/83 (25%)

Query  30   KGRRDVLCGLGVSPKTGTDVLLGGTEPLLE-------------GASVLERVS-------L  69
             G R +LC +G SP T  DV+LG   P LE             GA+VL  V         
Sbjct  61   NGMRSILC-VGTSPGTLDDVMLGVMSPTLEVTRAKASYLDDLSGAAVLSTVKEPTTHDPF  119

Query  70   KAYSVRVQHLHGRRHLSGLDERR  92
            K+ +V+   L  RR   G  + R
Sbjct  120  KSVAVKWMELDVRRRSIGFVKNR  142

>PHALS_13311
Length=1792

 Score = 30.4 bits (67),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 9/60 (15%)

Query  9     AEEC---QKVVTSAH---KRRRVATPHKGR---RDVLCGLGVSPKTGTDVLLGGTEPLLE  59
             +EEC   ++ V +A    KR+R+   HK     R V+CGL    +  ++VL   T PLL+
Sbjct  1481  SEECLMGKRQVAAAQTLKKRQRLTATHKSYEWARSVICGLSKQAEKFSNVLPAVTSPLLD  1540

>PYU1_G008926
Length=2426

 Score = 30.4 bits (67),  Expect = 2.4, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  69   LKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGRVRSC  110
            L  Y +RVQH    RHLS  D  R +L    V+     VR C
Sbjct  92   LTNYQLRVQHESETRHLSDADATRIALMRVHVKFFKNYVRWC  133

>PYIW_18799
Length=908

 Score = 30.0 bits (66),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 24/56 (43%), Gaps = 0/56 (0%)

Query  1    MLPRCDAGAEECQKVVTSAHKRRRVATPHKGRRDVLCGLGVSPKTGTDVLLGGTEP  56
            MLP     A EC+    S   R +V  P    RD+   LGVS K G  + +    P
Sbjct  738  MLPMFYPMARECKVPHASKTSRYQVIQPEFASRDMALHLGVSVKIGERLQIMSIAP  793

>H257_12607
Length=629

 Score = 29.3 bits (64),  Expect = 4.8, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query  36   LCGLGVSPKTGTDVLLGGTEPLLEGASVLERVSLKAYSVRVQHLHGRRHLSGLDERRTSL  95
             C L +SP  G     GGT P LEGA+++  + +    V V  +   +   G    +  L
Sbjct  497  FCRLRLSPTAG-----GGTFPELEGAALVRELHVYGQLVVVNSVDKSKAQHGGFGTQLML  551

Query  96   PSSEVERDHG  105
             + E+ ++HG
Sbjct  552  KAEEIAQEHG  561

>CCI50309
Length=332

 Score = 29.3 bits (64),  Expect = 5.0, Method: Composition-based stats.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  64   LERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERDHGR  106
            L+RV L+ Y  R+ HL G  +L     R+ S      E+ H +
Sbjct  260  LDRVVLRVYETRIHHLFGNEYLLREYSRKESTVEELGEKGHSK  302

>PYAP_20111
Length=1610

 Score = 28.9 bits (63),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 1/41 (2%)

Query  63   VLERVSLKAYSVRVQHLHGRRHLSGLDERRTSLPSSEVERD  103
            +++R+S +A S+RV+H + RR   G  +++T LP  + E D
Sbjct  232  LMQRISARASSLRVRHAYSRRR-HGHSKQKTELPIYDQEDD  271

Lambda      K        H        a         alpha
   0.318    0.134    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3420511542

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40