Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_171291475874574535590.0
PITG_184581475874774732910.0
PHYCA_5114151475874474830960.0
PHYRA_810981475874175429300.0
PHYSO_3489031475876676428620.0
PHYKE_839514758142075927970.0
PHALS_064761475872675425100.0
HYAP_071041475872174323900.0
PYIR_134181475874777615890.0
PYIW_199691475873376815860.0
PYU1_G0017331475873272715830.0
PYAP_177631475879452314520.0
PYAR_135711475866672014250.0
PYVX_235901475868979312873e-167
CCI44111147585765139102e-112
CCA22843147585865199008e-111
SPRG_06355147587134646416e-72
SDRG_01763147587364186162e-68
SDRG_045751382110032281775e-12
SPRG_126211382110033601741e-11
H310_082921382110073551741e-11
PYVX_215131382114463821722e-11
H257_117731382110264181651e-10
PYAP_222301382111164251598e-10
PYAR_14788138217953781571e-09
H257_0193413355510224421552e-09
SDRG_079831335559912261525e-09
SPRG_1903013355510001721507e-09
PYIR_141071382111764161509e-09
PHYSO_4705331382110843501331e-06
PITG_172501382110463421302e-06
PYIW_157171382111214371194e-05
PPTG_113651382111063501194e-05
PYU1_G002110138219993891169e-05
PHYSO_30027248502636157811.2
PYU1_G0130318423040189801.2
PHYCA_133652506620050771.7
PYIR_233601252822772772.3
PHYSO_5453781252822443762.9
PITG_0658055211214146773.7
PYVX_217761252820340743.9
PYIW_19868167626270119754.0
PITG_1522312293920254764.9
PYU1_G0122671252821740745.2
PHYCA_5718411252824175745.4
PPTG_0254318659137387756.2
PITG_155251252822443736.3
PHALS_000541252822443736.4
PPTG_13828551795868747.4
PYVX_1587846680134787747.4
PPTG_138275521121268747.8
PPTG_070251252822443728.1
PHYRA_828581252822443729.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17129

Length=745
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17129                                                            1375       0.0   
PITG_18458                                                            1272       0.0   
PHYCA_511415                                                          1197       0.0   
PHYRA_81098                                                           1133       0.0   
PHYSO_348903                                                          1107       0.0   
PHYKE_8395                                                            1082       0.0   
PHALS_06476                                                           971        0.0   
HYAP_07104                                                            925        0.0   
PYIR_13418                                                            616        0.0   
PYIW_19969                                                            615        0.0   
PYU1_G001733                                                          614        0.0   
PYAP_17763                                                            563        0.0   
PYAR_13571                                                            553        0.0   
PYVX_23590                                                            500        3e-167
CCI44111                                                              355        2e-112
CCA22843                                                              351        8e-111
SPRG_06355                                                            251        6e-72 
SDRG_01763                                                            241        2e-68 
SDRG_04575                                                            72.8       5e-12 
SPRG_12621                                                            71.6       1e-11 
H310_08292                                                            71.6       1e-11 
PYVX_21513                                                            70.9       2e-11 
H257_11773                                                            68.2       1e-10 
PYAP_22230                                                            65.9       8e-10 
PYAR_14788                                                            65.1       1e-09 
H257_01934                                                            64.3       2e-09 
SDRG_07983                                                            63.2       5e-09 
SPRG_19030                                                            62.4       7e-09 
PYIR_14107                                                            62.4       9e-09 
PHYSO_470533                                                          55.8       1e-06 
PITG_17250                                                            54.7       2e-06 
PYIW_15717                                                            50.4       4e-05 
PPTG_11365                                                            50.4       4e-05 
PYU1_G002110                                                          49.3       9e-05 
PHYSO_300272                                                          35.8       1.2   
PYU1_G013031                                                          35.4       1.2   
PHYCA_133652                                                          34.3       1.7   
PYIR_23360                                                            34.3       2.3   
PHYSO_545378                                                          33.9       2.9   
PITG_06580                                                            34.3       3.7   
PYVX_21776                                                            33.1       3.9   
PYIW_19868                                                            33.5       4.0   
PITG_15223                                                            33.9       4.9   
PYU1_G012267                                                          33.1       5.2   
PHYCA_571841                                                          33.1       5.4   
PPTG_02543                                                            33.5       6.2   
PITG_15525                                                            32.7       6.3   
PHALS_00054                                                           32.7       6.4   
PPTG_13828                                                            33.1       7.4   
PYVX_15878                                                            33.1       7.4   
PPTG_13827                                                            33.1       7.8   
PPTG_07025                                                            32.3       8.1   
PHYRA_82858                                                           32.3       9.3   

>PPTG_17129
Length=745

 Score = 1375 bits (3559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/745 (100%), Positives = 745/745 (100%), Gaps = 0/745 (0%)

Query  1    MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV  60
            MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV
Sbjct  1    MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV  60

Query  61   EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttps  120
            EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPS
Sbjct  61   EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPS  120

Query  121  nYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFelerlrsevlevkeevkAIRREVMNE  180
            NYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNE
Sbjct  121  NYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNE  180

Query  181  LHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdplsAEERAALTRQTSTKT  240
            LHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEERAALTRQTSTKT
Sbjct  181  LHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEERAALTRQTSTKT  240

Query  241  SQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTS  300
            SQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTS
Sbjct  241  SQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTS  300

Query  301  ELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRG  360
            ELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRG
Sbjct  301  ELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRG  360

Query  361  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGK  420
            NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGK
Sbjct  361  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGK  420

Query  421  VLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPS  480
            VLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPS
Sbjct  421  VLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPS  480

Query  481  SKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYL  540
            SKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYL
Sbjct  481  SKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYL  540

Query  541  EFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  600
            EFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL
Sbjct  541  EFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  600

Query  601  QLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLS  660
            QLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLS
Sbjct  601  QLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLS  660

Query  661  DPARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsssDGKATHRASSRVKTSSKTHQ  720
            DPARSEEQFYFSIDDALQALRKMRRVSSSGSSSGHSGSSSDGKATHRASSRVKTSSKTHQ
Sbjct  661  DPARSEEQFYFSIDDALQALRKMRRVSSSGSSSGHSGSSSDGKATHRASSRVKTSSKTHQ  720

Query  721  RAHTRHEPRANPDFKPVGILKRNKL  745
            RAHTRHEPRANPDFKPVGILKRNKL
Sbjct  721  RAHTRHEPRANPDFKPVGILKRNKL  745

>PITG_18458
Length=747

 Score = 1272 bits (3291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/747 (90%), Positives = 706/747 (95%), Gaps = 6/747 (1%)

Query  5    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  64
            MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF
Sbjct  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60

Query  65   YGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttpsnYAA  124
            YGRSTSNTSSDMPQYRTTEQ+R NN+TLSALHEDVEASNVSNVSSSFSQFS TTPSNYAA
Sbjct  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAA  120

Query  125  STPGNFSSTYHGFNTVHSTTGTSRAVSGDFelerlrsevlevkeevkAIRREVMNELHVT  184
            STPG F+ST+ G NT  +TTG SRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVT
Sbjct  121  STPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVT  180

Query  185  RYDVLKELALLKGAIAQLTATQHsappsvsstessssdplsAEERAALTRQTSTKTSQAT  244
            RYDVLKELALLKGAIAQLTATQH AP SVSSTESSSSDPLS +ERAALTRQTSTKTSQAT
Sbjct  181  RYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQAT  240

Query  245  RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAA  304
            RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPL+PQQINEMFPLID TSELAA
Sbjct  241  RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAA  300

Query  305  HARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLA  364
            HARGLTPGTRTWALTRVEEWLDAR+N+GNDTLLAVVGEGGTGKS FCGTVAQQFRGNLLA
Sbjct  301  HARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLA  360

Query  365  AHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD  424
            AHCCQFDRKSKSSPRNVLLSMVHQLVD+LPSFKNQLARLNLKYVLEEADPFLLAGKVLVD
Sbjct  361  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD  420

Query  425  PLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLA  484
            PLNA+EEPMHATF+LVDGIDQCA G NGRNELLE FAQVIPQLPSWVGFL+SSKPSSKLA
Sbjct  421  PLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLA  480

Query  485  KRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTK  544
            KRLPVSSVLDFSAKNGAFVAD SS+VDDIARNFSDDD AEAKKVLKKKSGGNFAYLEFTK
Sbjct  481  KRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTK  540

Query  545  QALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIV  604
            QALSHPG+AAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL+V
Sbjct  541  QALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVV  600

Query  605  GAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPAR  664
            GAAAGPYSP+TEEQAKEHF  T EDLRMLRRSFVDLV+VKHG+YRIESSALCAWLSDPAR
Sbjct  601  GAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPAR  660

Query  665  SEEQFYFSIDDALQALRKMRRV------sssgsssghsgsssDGKATHRASSRVKTSSKT  718
            SEEQFYFS+DDAL ALRK+RRV      S    +S    ++ +G A+ R S+RVKTSSKT
Sbjct  661  SEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSSKT  720

Query  719  HQRAHTRHEPRANPDFKPVGILKRNKL  745
            HQRAHTR+EPR +PD+KPVGILKRNKL
Sbjct  721  HQRAHTRYEPRTSPDYKPVGILKRNKL  747

>PHYCA_511415
Length=744

 Score = 1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/748 (87%), Positives = 682/748 (91%), Gaps = 11/748 (1%)

Query  5    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  64
            M+R+KNKLRSSRLHKKEGAWALDEDSLRLKQ Q DD VRFDRSTTLADTVNVTDDVEEMF
Sbjct  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQ-QQDDAVRFDRSTTLADTVNVTDDVEEMF  59

Query  65   YGRST--SNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttpsnY  122
            YGR+T  S T+S+MPQYRTTEQIR NN+TLSALHE+    + SNVSSSFSQFS TTPSNY
Sbjct  60   YGRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNY  119

Query  123  AASTPGNF-SSTYHGFNTVHSTTGTSRAVSGDFelerlrsevlevkeevkAIRREVMNEL  181
            AASTPGN  ++TYHGF++  +T GTSR +S DFELERLRSEVLEVKEEVKAIRREVMNEL
Sbjct  120  AASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNEL  179

Query  182  HVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdplsAEERAALTRQTSTKTS  241
            HVTRYDVLKEL LLKGAIAQLTA QHS+P   S+  SSS     AEERAALTRQTSTKTS
Sbjct  180  HVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLS-AEERAALTRQTSTKTS  238

Query  242  QATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSE  301
             ATRDRLAASR N+HKTPPPAARASVRLTQLAPVADNALSTPLS QQINEMFPLIDFTS+
Sbjct  239  AATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSD  298

Query  302  LAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGN  361
            LAAHARGLTPG+RTWALTRVEEWLDARFNVG DTLLAVVGEGGTGKSAF GTVAQQFRGN
Sbjct  299  LAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGN  358

Query  362  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKV  421
            LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLP FKNQLARLNLKYVLEEADP LLAGKV
Sbjct  359  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKV  418

Query  422  LVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSS  481
            LVDPLNAMEEP+HATFMLVDGIDQC+AG NGRNELL+FFAQVIPQLPSW+GFL+SSKPSS
Sbjct  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478

Query  482  KLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLE  541
            KLAKRLPVSSVLDFSAKNGAFVADVSS+VDDIARNFSDDD AEAKKVLK KSGGNFAYLE
Sbjct  479  KLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLE  538

Query  542  FTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  601
            FTKQALSHPGM A SKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ
Sbjct  539  FTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  598

Query  602  LIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSD  661
            L+VGAA+GPYSP+TEEQAKEHFK TAEDLRMLRRSFVDLVAVKHG+YRIESSALCAWLSD
Sbjct  599  LVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSD  658

Query  662  PARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsssDGKATH----RASSRVKTSSK  717
            PARSEEQFYFSIDDAL ALRKMRR + S S   HSGSSSD  ATH    RASSRV  SSK
Sbjct  659  PARSEEQFYFSIDDALHALRKMRR-NVSSSGHSHSGSSSDSSATHHTSSRASSRVTASSK  717

Query  718  THQRAHTRHEPRANPDFKPVGILKRNKL  745
            + QR+HTRHEPR NP  KPVGILKR KL
Sbjct  718  SQQRSHTRHEPRTNPG-KPVGILKRGKL  744

>PHYRA_81098
Length=741

 Score = 1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/754 (82%), Positives = 666/754 (88%), Gaps = 22/754 (3%)

Query  1    MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV  60
            MVGTM+R+KNKLR   LHKK+  WALDEDSLRLKQTQDD  +R DRSTTL DTVNVTDDV
Sbjct  1    MVGTMHRLKNKLR---LHKKDANWALDEDSLRLKQTQDD-ALRLDRSTTLTDTVNVTDDV  56

Query  61   EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttps  120
            EEMFYG    +T SD+PQYRTTEQ+R  +MTLSALHED EASN S+  S FS  + +   
Sbjct  57   EEMFYG--GRSTVSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPSN--  112

Query  121  nYAASTPGNFSS--TYHGFNTVHSTTGTSRAVSGDFelerlrsevlevkeevkAIRREVM  178
             YAASTPG+  +   YH F+T HSTT   RA+S  FELERLRSEV+EVKEEVKAIRREVM
Sbjct  113  -YAASTPGHVPNQGAYHDFSTAHSTT---RAISDAFELERLRSEVVEVKEEVKAIRREVM  168

Query  179  NELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdp-lsAEERAALTRQTS  237
            NELHVTRYDVLKELALLKGAIAQL ATQH +P +  S+  SSS   LSA+ERAALTRQTS
Sbjct  169  NELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTS  228

Query  238  TKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLID  297
            TKTS ATR+RLAASR NIHKTPPPAARASVRLTQLAPVADNALSTPL+PQQIN+MFPLID
Sbjct  229  TKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLID  288

Query  298  FTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQ  357
            FTSELAAHAR LTPG+RTWALTRVEEWLDARFNVG+DTLLAVVGEGGTGKSAF GTVAQQ
Sbjct  289  FTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQ  348

Query  358  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLL  417
            FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD+LP FKNQLARLNLKYVLEEADPF+L
Sbjct  349  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVL  408

Query  418  AGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISS  477
            AGKVLVDPLNAMEEPMHATFMLVDGIDQC+AG  GRNELLEFFAQVIP LPSWVGF++SS
Sbjct  409  AGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSS  468

Query  478  KPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNF  537
            KPSSKLAKRLPVSSVLDFSAKNGAFV+DVSS+V+D+ARNFSD+D AEAKKVLK+KSGGNF
Sbjct  469  KPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNF  528

Query  538  AYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  597
            AYLEFTKQALSHPGMAAASKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAK
Sbjct  529  AYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  588

Query  598  PLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCA  657
            PLLQLIVGAAAGPYS +TEEQAK+HF  TAEDLRMLR SFVDLVAV+HGAYRIESSALC 
Sbjct  589  PLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCG  648

Query  658  WLSDPARSEEQFYFSIDDALQALRKMRRVsssgsssghsg------sssDGKATHRASSR  711
            WLSDPARSEEQFYF+IDDA+QALR MRR  SS S S          +S  G  + RASSR
Sbjct  649  WLSDPARSEEQFYFAIDDAIQALRSMRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASSR  708

Query  712  VKTSSKTHQRAHTRHEPRANPDFKPVGILKRNKL  745
            V T+SK++QRAHTRH+PRA  +FKPVGILKRNKL
Sbjct  709  V-TTSKSNQRAHTRHDPRATQEFKPVGILKRNKL  741

>PHYSO_348903
Length=766

 Score = 1107 bits (2862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/764 (78%), Positives = 665/764 (87%), Gaps = 24/764 (3%)

Query  1    MVG-TMNRIKNKLRSSRL--HKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT  57
            MVG TM+RIKNKLRSSRL   KK+ AWALDEDSLRLKQ QDD PVR+DRS TL+DTVNVT
Sbjct  1    MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60

Query  58   DDVEEMFYGR---STSNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqf  114
            DDVE+MFYGR   ST++ +SD+PQYRTTEQ+R  ++TLSALHED E  + +N  SS    
Sbjct  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120

Query  115  -stttpsnYAASTPGNFS------------STY-HGFNTVHSTTGTSRAVSGDFelerlr  160
             S TTPSNYAASTPGNFS            +T+  GF+ + +T G++ A  G+ E  R  
Sbjct  121  FSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAE  180

Query  161  sevlevkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstesss  220
               ++ + +  AIRREVMNELHVTRYDVLKELALLKGA+AQLTA QHS+PPSVSST+SSS
Sbjct  181  VLEVKEEVK--AIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSS  238

Query  221  sdplsAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNAL  280
             DPLSA++RA L RQTSTKTS ATR+RLAASR N+ KTPPP ARASVRLTQLAPVAD+AL
Sbjct  239  LDPLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDAL  298

Query  281  STPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVV  340
            STPL+ QQINEMFPLIDFTSELAAHARGLTPG+RTWALTRVEEWLD+RFN G+D LLAVV
Sbjct  299  STPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVV  358

Query  341  GEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQL  400
            GEGGTGKSAFCGTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VDN P FKNQL
Sbjct  359  GEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQL  418

Query  401  ARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFF  460
            ARLNLKYVLEEADP LLA KVLVDPLNA+EEP+ A FM+VDGIDQCAAG  GRNELLEFF
Sbjct  419  ARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFF  478

Query  461  AQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDD  520
            AQ+IPQLP+WVGFL+SSKPSSKLAKRLPVSSVLDFSA+N AFVADV+ +V+DIARNFSDD
Sbjct  479  AQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDD  538

Query  521  DTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEI  580
            D  +AK +LK+KSGGNFAYLEFTKQALSHPGMAAASKEGAVPL VL++LPETLYDIYAEI
Sbjct  539  DFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEI  598

Query  581  FEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDL  640
            FEDKFGQGRARVWGKAKPLLQL+VGAA+GPYSP+TEEQA+EHF  TAEDLRMLRRSFVDL
Sbjct  599  FEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDL  658

Query  641  VAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsss  700
            VAV+HG+YRIESSALCAWLSDPARSEEQFYFSIDDALQALR+MRR  SSGSSSGHSGSSS
Sbjct  659  VAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSS  718

Query  701  DGKATHRASSRV--KTSSKTHQRAHTRHEPRANPDFKPVGILKR  742
            DG  +    SR   + ++K+H R+H +HEPRANPD+KPVGILKR
Sbjct  719  DGTTSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKR  762

>PHYKE_8395
Length=1420

 Score = 1082 bits (2797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/759 (76%), Positives = 638/759 (84%), Gaps = 33/759 (4%)

Query  8     IKNKLRSSRLHKKEGAWALDEDSLRL-KQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYG  66
             +KNKLRSS+LHKKEGAWALDEDSLRL KQ QD D  RFDR+T + DTVNV+DDVE+MFYG
Sbjct  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDAD--RFDRNTAMTDTVNVSDDVEDMFYG  731

Query  67    RSTSNT----SSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttpsnY  122
             RST+ +    +SD+P YRTTEQ+R  N TL+ALHE+ EA   S    S S  S+      
Sbjct  732   RSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEE-EAMTPSASHLSNSFASSY-----  785

Query  123   AASTPGNFSS--TYHGFNTVHSTTGTSRAVSGDFelerlrsevlevkeevkA----IRRE  176
              ASTPGN+ +  T++GFNT HST G SR +S D       S +    +EVKA    IRRE
Sbjct  786   -ASTPGNYQNPPTFNGFNTTHST-GLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRRE  843

Query  177   VMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdplsAEERAALTRQT  236
             VMNELH+TRYDVLKEL LLKGA+AQL+A Q     SVS + SSSSDPLSAE+RAALTR  
Sbjct  844   VMNELHMTRYDVLKELTLLKGAVAQLSAAQ--TTGSVSPSTSSSSDPLSAEDRAALTRVP  901

Query  237   STKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLI  296
             S  TS+ T+DRLA SR NIH  PPPAARASVRLTQLAPVADNALSTPL+PQQINEMFPLI
Sbjct  902   SKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI  961

Query  297   DFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQ  356
             DFTSELAAHARGL PGTRTWALTRVEEWLDARFNVGNDT+LAVVG+GGTGKSAFCGTVAQ
Sbjct  962   DFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQ  1021

Query  357   QFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFL  416
             QFRGNLLAAHCCQFDRKSKS+PRNVLLS VHQLVDNLP FKNQLARLNLKYVLEE+DPFL
Sbjct  1022  QFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL  1081

Query  417   LAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLIS  476
             LA KV VDPLNA+EEP+HATFMLV+G+DQC+AG NGRNELLEF +Q+IPQLPSWVGF+IS
Sbjct  1082  LAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMIS  1141

Query  477   SKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGN  536
             SKP SK AKRLPVSSVLDFSAKNGAFV+DVSS+VDDIARNFSD+D+AEAK+VLK+KSGGN
Sbjct  1142  SKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGN  1201

Query  537   FAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKA  596
             FAYLEFTKQALSHPGMA ASKEGAVPLEVL +LP++L+DIY EIFEDKFGQGRAR+W KA
Sbjct  1202  FAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKA  1261

Query  597   KPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALC  656
             KPLLQLIVGAAAGPYSP+TE QAKEHF FT EDLRMLRRSFVDLV VKHGAYR+ESSALC
Sbjct  1262  KPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALC  1321

Query  657   AWLSDPARSEEQFYFSIDDALQALRKMRRVsssgsssghsgs----------ssDGKATH  706
             +WLSDPARSEEQFY S+DDAL ALRK+RR  SSGS+S HS S          S+      
Sbjct  1322  SWLSDPARSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTPS  1381

Query  707   RASSRVKTSSKTHQRAHTRHEPRANPDFKPVGILKRNKL  745
             RA+S    SSK+HQRAHTRHEPR NP+FKP+GILKR K+
Sbjct  1382  RATSSRAASSKSHQRAHTRHEPRVNPEFKPMGILKRGKM  1420

>PHALS_06476
Length=726

 Score = 971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/754 (71%), Positives = 603/754 (80%), Gaps = 37/754 (5%)

Query  1    MVGTMNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDV  60
            MVGTM+++KNKLR S L KKE A+ L++DSLR K TQD+  VR DRS TL DTVN+TDDV
Sbjct  1    MVGTMHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDET-VRVDRSATLTDTVNMTDDV  59

Query  61   EEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttp-  119
            EEMFY RST+  +S +PQYRTTEQIR NN+ L ALHED E  + ++ +SS     + T  
Sbjct  60   EEMFYNRSTA--TSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTP  117

Query  120  snYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFelerlrsevlevkeevkAIRREVMN  179
            S+YAASTPGN +  +H F+T+++TT T  A+SGDF+LERL SEVL++K EVK IRREVMN
Sbjct  118  SSYAASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMN  177

Query  180  ELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdplsAE-ERAALTRQTST  238
            ELHVTRYDVLKEL LLKGAIAQL +T+     S  S+  SSS    +  ERAALTRQT T
Sbjct  178  ELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPT  237

Query  239  KTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDF  298
            KTSQATRDRLAA R N +K PP A RAS RLTQLAPVAD+ALSTPL+ QQINE FPLIDF
Sbjct  238  KTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDF  297

Query  299  TSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            TSELAAHAR LTPG+R+WALTR++EWLDARF++GNDTLLAVVGEGG+GKSAFCGTVAQQF
Sbjct  298  TSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQF  357

Query  359  RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLA  418
            RGNLLAAHCCQFDRKSKS PRNVLLSMVHQLVDNLP FKNQLARLNL+YVLEE DPFLLA
Sbjct  358  RGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLA  417

Query  419  GKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSK  478
             KVL+DPLNA+EEP H+TF+L+DGIDQCA G NGRNELLEF +Q+I  LPSWVGFL+SSK
Sbjct  418  NKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSK  477

Query  479  PSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFA  538
            PSSKLAK LPVSSVLDFSAKNGAFVAD SS+V+DI++ FSDDD  EAK++L KKSGGNFA
Sbjct  478  PSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFA  537

Query  539  YLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKP  598
            YLEFTKQALSHPGMA  S  G VPL VL ELPETLYDIYAEIFEDKFGQG AR WGKAKP
Sbjct  538  YLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKP  597

Query  599  LLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAW  658
            LLQLIVGAAAGPYS +TEEQAK+     A+DLRMLRRSFVD+VAVKH             
Sbjct  598  LLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-------------  644

Query  659  LSDPARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsssDGKA------THRASSRV  712
                   EEQFYFSI+DAL ALRKMR  SSS SSSG  G SSD  A        RA+SR 
Sbjct  645  -------EEQFYFSIEDALLALRKMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRG  697

Query  713  KTSSKTHQRAHTRHEPRAN-PDFKPVGILKRNKL  745
            K  +K+      RHEPR N  ++KPVGILKR KL
Sbjct  698  KLPNKSQ-----RHEPRTNFENYKPVGILKRGKL  726

>HYAP_07104
Length=721

 Score = 925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/743 (67%), Positives = 582/743 (78%), Gaps = 24/743 (3%)

Query  5    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  64
            M+R+KNKLR   LHKK+G W LDEDS+RLKQ QD   VR DRS TL DTVN TDDVEEMF
Sbjct  1    MHRLKNKLR---LHKKDGTWDLDEDSMRLKQNQDH-VVRLDRSGTLTDTVNETDDVEEMF  56

Query  65   YGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEAsnvsnvsssfsqfstttpsnYAA  124
            Y  + + +++  PQYR+TEQ+    +TL++L+ED E  +  + +SS     +   ++ ++
Sbjct  57   YSSTQTRSTNGPPQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISS  116

Query  125  STPGNFSSTYHGFNTVHSTTGTSRAVSG-DFelerlrsevlevkeevkAIRREVMNELHV  183
                N +ST+H   T  S     RAV G   ELE+LR E++EVK+EV AIR+ V+NELHV
Sbjct  117  V---NLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHV  173

Query  184  TRYDVLKELALLKGAIAQLTAT-QHsappsvsstessssdplsAEERAALTRQTSTKTSQ  242
            TRYDVLKELALLKGAIAQLT T          S + S S+PLS+ +R ALTRQTST TS 
Sbjct  174  TRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSS  233

Query  243  ATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSEL  302
            ATRDRLAASR N +K PPPAARASVRLTQLAPVAD+ALSTPLS  Q+N++FPLIDFT+EL
Sbjct  234  ATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTEL  293

Query  303  AAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNL  362
            AAHAR LTPG+RTWALTR EEWL++RF  G D LLAVVGEGG+GKSAFCGTVAQQ+RG L
Sbjct  294  AAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQL  353

Query  363  LAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVL  422
            +AAHCCQFDRK KSSPRNVLLS+VHQLV NLP FKNQLARLNLKYVLEEADP LLA KVL
Sbjct  354  VAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVL  413

Query  423  VDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSK  482
            VDPLNA+E+P+   FMLVDGIDQC  G  GRNELLEF AQ+IPQLPSW+G ++SSKPSSK
Sbjct  414  VDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSK  473

Query  483  LAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEF  542
            LAKRLPVSSVLDFSAKN AFVADVSS+VD+IA +F  +D  EAK+VLK KSGGNFAYLEF
Sbjct  474  LAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEF  533

Query  543  TKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  602
            TKQALS  GMA+ SKEG V ++VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +LQL
Sbjct  534  TKQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQL  591

Query  603  IVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDP  662
             +GA AGPYSP+TEEQA+EHF+ T EDLR+LRRSFVDLVAVKHG YRIE+SALCAWL DP
Sbjct  592  AIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDP  651

Query  663  ARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsssDGKATHRASSRVKTSSKTHQRA  722
            AR+EEQFYF+IDDALQALRKMRR          S S+S G+ T   SS    +     R+
Sbjct  652  ARAEEQFYFNIDDALQALRKMRRA---------SASASSGQLTSSGSS----NGSAPGRS  698

Query  723  HTRHEPRANPDFKPVGILKRNKL  745
             +  + +   D +PV ILKR ++
Sbjct  699  QSPQKVQTESDCQPVSILKRGRM  721

>PYIR_13418
Length=747

 Score = 616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/776 (46%), Positives = 480/776 (62%), Gaps = 117/776 (15%)

Query  25   ALDEDSLRLKQTQDDDPVRFDRSTTL------ADTVNVTDDVEEMFY-------------  65
            A DE++LR+ +   ++  RF R+TT+      + +  ++DDVEEMFY             
Sbjct  30   ATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSAS  89

Query  66   GRSTSN----TSSDM----------------------PQYRTTEQIRANNMTLSALHEDV  99
             RST N    T+S M                        YRTTEQ+R  N  L  L ED 
Sbjct  90   ARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTN--LMPLQED-  146

Query  100  EAsnvsnvsssfsqfstttpsnYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFelerl  159
                                   AAS                +TT  + A +G   ++ L
Sbjct  147  -------------------EVLPAAS---------------RATTTMATASNGGNPIDAL  172

Query  160  rsevlevkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQL-TATQHsappsvsstes  218
            R+E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL TA +     S+ ++ +
Sbjct  173  RAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGA  232

Query  219  sssdplsAE----ERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAP  274
            +       E    E   ++R T+  TS+AT++R    R     + P   RAS RLTQLAP
Sbjct  233  AVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAP  288

Query  275  VADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGND  334
            VAD+ALSTPL   QI+EMFPL++ ++EL A A+   P +R WA+ R +EW+D+RFNVG D
Sbjct  289  VADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVD  348

Query  335  TLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLP  394
             LLA+VG+GG+GKS   G +  +F  N++A H C FDRKSKSSPRNVLLS+V+QL+ NLP
Sbjct  349  NLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLP  408

Query  395  SFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRN  454
             FKNQLARLNLKYVLEE DP +LA KVLVDPL A+EEP+ A   + DGIDQC +   GRN
Sbjct  409  LFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KGRN  466

Query  455  ELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIA  514
            +LL+F A +IP+LP+WVG  I+SKPS +L  +L ++S+LDFSAKN  ++ D   +++DI 
Sbjct  467  DLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDII  526

Query  515  RNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLY  574
             NFSD D  +A+++LK+KSGGNF +L+FTKQALSHPGM      G +PL+VLH+LPE++Y
Sbjct  527  GNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIY  584

Query  575  DIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLR  634
            +IY EIFEDKFG+GR+R+W K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +R
Sbjct  585  EIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIR  644

Query  635  RSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVsssgsssg  694
            R+FVD++AV HG YRIE+SAL  WL DP R+ EQFY  +   +  LR++           
Sbjct  645  RAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHH---------  695

Query  695  hsgsssDGKATHRASSRV----KTSSKTHQRAHTRH--EPRANP--DFKPVGILKR  742
                  D   TH A+S        S+ +   +H  +   P A P  +FKPVGILK+
Sbjct  696  -----QDSSDTHSAASSEASSNNVSNVSTASSHLSYVVPPPAAPKVNFKPVGILKK  746

>PYIW_19969
Length=733

 Score = 615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/768 (46%), Positives = 474/768 (62%), Gaps = 111/768 (14%)

Query  23   AWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT------DDVEEMFY-----------  65
            A A DEDSLR+ +   ++  RF R+TT+  +   +      DDVE+MFY           
Sbjct  28   ATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSS  87

Query  66   -------GRST--SNTSSDMPQ------------YRTTEQIRANNMTLSALHEDVEAsnv  104
                   GRST  S  S+D               YRTTEQ+R     L  L ED      
Sbjct  88   VRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGT-ANLIPLQED------  140

Query  105  snvsssfsqfstttpsnYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFelerlrsevl  164
                      ++ T +     T GN+S+   G               G  +L+ LR+E+ 
Sbjct  141  -----EVLPAASRTTTTSQMPTNGNYSNGNSG---------------GGSQLDALRTELS  180

Query  165  evkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdpl  224
            E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL                  +  L
Sbjct  181  EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTA-------------LETKGL  227

Query  225  sAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPL  284
            S +E   ++R T+  TS+AT+DR A   T    + P   RAS RLTQLAPVAD ALSTPL
Sbjct  228  STDEINTISRTTALFTSKATKDRRA---TRDESSSPMLVRASSRLTQLAPVADEALSTPL  284

Query  285  SPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGG  344
               QI+EMFPLI+ + EL A +R     +R WA+ R +EW+D+RFNVG D LLA+VGEGG
Sbjct  285  LQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGG  344

Query  345  TGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLN  404
            +GKS   G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ NLP FKNQLARLN
Sbjct  345  SGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLN  404

Query  405  LKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVI  464
            LKYVLEE+DP +LA K+LVDPL A+EEPM A   ++DG+DQC +   GRN+LL+F A +I
Sbjct  405  LKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVII  462

Query  465  PQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAE  524
            P+LP+W+G  I+SKPS +L  RL +SS+LDFSAKN  ++ D   +++DI  +FSD D  +
Sbjct  463  PELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQ  522

Query  525  AKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDK  584
            A+++LK+KSGGNF +L+FTKQALSHPGM      G +PL+VLH+LPE++Y+IY EIFEDK
Sbjct  523  AREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDK  580

Query  585  FGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVK  644
            FG+GR R+W K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +RRSFVD++ V+
Sbjct  581  FGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVR  640

Query  645  HGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsssDGKA  704
            HG YRIE+SAL  WL DP R+ EQFY  +   + ALR++                 D   
Sbjct  641  HGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHH--------------QDSSE  686

Query  705  TH----------RASSRVKTSSKTHQRAHTRHEPRANPDFKPVGILKR  742
            TH           A+S V T+S     ++    P    +FKPVGILK+
Sbjct  687  THSVGSSDGSSSNATSNVSTASS--HLSYVVPPPVPKVNFKPVGILKK  732

>PYU1_G001733
Length=732

 Score = 614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/727 (47%), Positives = 470/727 (65%), Gaps = 38/727 (5%)

Query  27   DEDSLRLKQTQDDDPVRFDRSTTL------ADTVNVTDDVEEMFY--GRSTSNTSSDMPQ  78
            DED+LR+ +   +D  R+ R+TT+      + +  ++DDVE+MFY  G   + ++SD   
Sbjct  32   DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  91

Query  79   YRTTEQIR-ANNMTLSALHEDVEAsnvsnvsssfsqfstttpsnYAASTPGNFSSTYHGF  137
             RTT  +R AN M  S      +    +    + +           A+            
Sbjct  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLMPLNEDEVLPAA------------  139

Query  138  NTVHSTTGTSRAVSGDFelerlrsevlevkeevkAIRREVMNELHVTRYDVLKELALLKG  197
              + +TTG +     D     LR+E++E+K+E++ IRRE+MNE+HVTRYDVLKE+ +LKG
Sbjct  140  --MRTTTGAAGGSEAD----ALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKG  193

Query  198  AIAQLTATQHsappsvsst--essssdplsAEERAALTRQTSTKTSQATRDRLAASRTNI  255
             I QL A   S           +     LS  +   +TR T+  TS+AT+DRLAA    +
Sbjct  194  TIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAARE--V  251

Query  256  HKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRT  315
               P      + RLTQLAPVAD+ALSTPL   QI++MFPL+DF+++L  HA+   P +R 
Sbjct  252  TAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSRE  311

Query  316  WALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSK  375
            WA  R ++W+D+RFNVG D LLA+VG+GG+GKS   G +  +F  N++A H C+FDRKSK
Sbjct  312  WAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSK  371

Query  376  SSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHA  435
            SSPRNVLLS+V+QL+ NLP FKNQLARLNLKYVLEE DP +LA KVLVDPL A+EEP+ A
Sbjct  372  SSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTA  431

Query  436  TFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDF  495
              +LVDGIDQC +    RN+LL+F A +IP+ P+W+G  I+SKPS +L  +L ++S+LDF
Sbjct  432  KVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDF  489

Query  496  SAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAA  555
            S KN  ++ D   +++DI  NFSD D +EA+ +LK+KSGGNF +L+FTKQALSHPGM   
Sbjct  490  SPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGM--E  547

Query  556  SKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMT  615
             + G VPL+VLH+LPE++Y+IY EIFEDKFG+G  R+W K +PLL LIV AA+GPY+ +T
Sbjct  548  EENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALIT  607

Query  616  EEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDD  675
            EEQA+E F  + +D+RM+RR+F D++ V+HG YR+E+SA+  WL DP RS EQFY +I  
Sbjct  608  EEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISA  667

Query  676  ALQALRKMRRVsssgsssghsgsssDGKATHRASSRVKTSSKTHQRAHTRHEPRANPDFK  735
            ++  LR++ R SS+ + S  S  SS        S+    SS           P    +FK
Sbjct  668  SMDILRRLHRKSSTDTHSVASSESSSHHTPSNVST---ASSYLSLNVPPPAAPAQKVNFK  724

Query  736  PVGILKR  742
            PVGILK+
Sbjct  725  PVGILKK  731

>PYAP_17763
Length=794

 Score = 563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/523 (52%), Positives = 381/523 (73%), Gaps = 14/523 (3%)

Query  172  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssd---------  222
            AI+RE+MNE+H+TRYDVLKE+ +LKG I QL +    +      T ++++          
Sbjct  196  AIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQAN  255

Query  223  plsAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALST  282
             LS EE+ AL+R+T+T  S+ T++R+  +R +  + PP     S RLTQLAPV D+ALST
Sbjct  256  ELSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALST  313

Query  283  PLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGE  342
            PL  +QI++MFPLIDF++E+   +R    G+R W   RV+EWLD+RFNVG D +LA+VG+
Sbjct  314  PLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGD  373

Query  343  GGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLAR  402
             G+GK+    +V  ++   ++A H C+FDRK+KSSPRNVLLS+V+QL  +LP FK+QLAR
Sbjct  374  AGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLAR  433

Query  403  LNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQ  462
            LNLKYVLEE D   L+ KVL+DPLNA+EEP+   F++ D IDQC  G+ G N+L +F + 
Sbjct  434  LNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSA  492

Query  463  VIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDT  522
            +IP+ P W+GFL+SSKPS + A  +PVSSVLDFSA+N  ++ D   +++DIA  F D+D 
Sbjct  493  IIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQ  552

Query  523  AEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFE  582
            AEAK++LK KSGGN++YLEFTKQALS+PGM  AS  G VP++VLH+LP++LY+IY EIFE
Sbjct  553  AEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFE  610

Query  583  DKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVA  642
            DKFG+GR RVW KA P+LQLI  AA+GPY+ +TE+   +   +T +++RMLRR+F+D+++
Sbjct  611  DKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIIS  670

Query  643  VKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRR  685
            ++HG Y I SSA+  WL+D  R  EQ++  ++  ++ LRK+ R
Sbjct  671  IRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  713

>PYAR_13571
Length=666

 Score = 553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/720 (43%), Positives = 436/720 (61%), Gaps = 93/720 (13%)

Query  56   VTDDVEEMFYGRSTSNTSSDMPQYRTTEQI-RANNMTLSALHEDVEAsnvsnvsssfsqf  114
            V +D E+ FY R   N  +D+   R+  QI  A + T SA+  D +  ++ +  SS    
Sbjct  3    VPEDAEDTFYTRGRENNGTDI-SVRSDYQIPSARSTTSSAMSYDDDNDSMYSGYSSDRS-  60

Query  115  stttpsnYAASTPGNFSSTYHGFNT------------VHSTTGTSRAVSGDFelerlrse  162
                     A+TP N  +T +   T            V  +T       GDF      + 
Sbjct  61   --------TATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAA  112

Query  163  vlevkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssd  222
                     AIRRE+MNE+H +RYDVLKE+ +LKG I QL  T                 
Sbjct  113  PAYTPMP--AIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET-----------------  153

Query  223  plsAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA-SVRLTQLAPVADNALS  281
                     + R+T+T  S++T++R+  +R ++    PP  RA SVRLTQLAPV D+ALS
Sbjct  154  ---------MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALS  201

Query  282  TPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVG  341
            TPL+ +QI+E+FPL+DF++E+   AR    GTR WA  RV+EWLD+RFNVG+D LLA+VG
Sbjct  202  TPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVG  261

Query  342  EGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLA  401
            + GTGK+                 H C+F+RK KSSPRNVLLS+V+QL   LP+FK+QLA
Sbjct  262  DAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLA  304

Query  402  RLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFA  461
            RLNLKYVLEE D   LA KVLVDPL ++EEP+ A F+L+DG+DQC    NG N+LL+F +
Sbjct  305  RLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLS  363

Query  462  QVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDD  521
             V+P+ PSW+GFLI++KPS + A+++PV+S+LDFSAKN A+V D + ++ DI   F  +D
Sbjct  364  VVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTED  423

Query  522  TAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIF  581
             A+A ++LK KS GN++YLEFT+QA+S+PGM A   +G+VP++VLH+LP++LY+IY EIF
Sbjct  424  QADATQILKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIF  481

Query  582  EDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLV  641
            EDKFG+GR R+W KA P+LQLI  AA+GPY+ +TE+   +   +  +D+RMLRR+F+D++
Sbjct  482  EDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDII  541

Query  642  AVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVsssgsssghsgsssD  701
            +++HG Y I SSAL  WL+DP R  E ++  +   ++ LR++ R           G+ + 
Sbjct  542  SIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGTPAS  601

Query  702  GKATHRASSRV------------------KTSSKTHQRAHTRHEPRANPDFKPVGILKRN  743
             +AT  + S                    KT   +      RHEP   P  KPVGILKR 
Sbjct  602  ERATTTSRSPASPESSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRT  661

>PYVX_23590
Length=689

 Score = 500 bits (1287),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 330/793 (42%), Positives = 439/793 (55%), Gaps = 156/793 (20%)

Query  5    MNRIKNKLR----SSRLHK------KEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTV  54
            M ++K KLR    SSR  +       +G    D++SLRL +   +D +RF R TTL+   
Sbjct  1    MTKLKTKLRGGGSSSRRERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSAS  60

Query  55   NVTDD-VEEMFY-------------------GRSTSNTSSDMPQYRTTEQIRANNMTLSA  94
            +   D VEEMFY                    RST+ +      YRTTEQ+R+    L  
Sbjct  61   SAMSDDVEEMFYGGGPGGHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTG--LEP  118

Query  95   LHEDVEAsnvsnvsssfsqfstttpsnYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDF  154
            L ED        +  +    S    S   A  PG  ++       V + T          
Sbjct  119  LAED------RVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAET----------  162

Query  155  elerlrsevlevkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvs  214
                            +AIRREVMNELHV RYDVLKE+ +LKGA+AQL A          
Sbjct  163  ----------------QAIRREVMNELHVLRYDVLKEVTVLKGAVAQLLAALAPGGGD--  204

Query  215  stessssdplsAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLT-QLA  273
                            A +R  S  ++ +     ++S   +     PA RA++ +   LA
Sbjct  205  ----------------AGSRPGSAGSATSAATTASSSSAELS----PADRAAIGVAPTLA  244

Query  274  PVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGN  333
            PV D ALS PL P+Q++E+FPL+D ++++AA AR   PGTR WA  RV+EWLD+RFNVG 
Sbjct  245  PVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQ  304

Query  334  DTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  393
            DTLL VVG  GTGKS FCG+V    +GN+LA H C+FDRK+KS+PR VLLS+V Q+V NL
Sbjct  305  DTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANL  364

Query  394  PSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNG-  452
            P FK QLARLNLKYVLEE D F+LAGKVL+DPL A EEP+ A  +++DG+DQC     G 
Sbjct  365  PPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGG  424

Query  453  -RNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVD  511
             RNELLEF A V+PQLPSW+G L+SSKP+ +LA +L  +S+LDFS KN  FV D   +VD
Sbjct  425  VRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVD  484

Query  512  DIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPE  571
            DIA NF+D   AEA+++L+ K+GGNFAYL+FT+QALS PG+     +G + L++LH+LPE
Sbjct  485  DIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL----DDGELELDMLHDLPE  540

Query  572  TLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLR  631
            +LY+IY EIFED                                            +D+R
Sbjct  541  SLYEIYLEIFEDN-------------------------------------------DDMR  557

Query  632  MLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVsssgs  691
            +++RSFVD++AV+ G YRIESSAL  WLSDPARS E F+F  D  +  LR++++  ++ +
Sbjct  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKA  617

Query  692  ssghsgsssDGKATHRASSRVKTS-------------------SKTHQRAHTRHEPRANP  732
                  + + G    R S R                       ++T  R  +R+EP ANP
Sbjct  618  KQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPPPARTSSRVSSRYEPPANP  677

Query  733  DFKPVGILKRNKL  745
              KPVGILKR +L
Sbjct  678  S-KPVGILKRGRL  689

>CCI44111
Length=576

 Score = 355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 198/513 (39%), Positives = 295/513 (58%), Gaps = 10/513 (2%)

Query  173  IRREVMNELHVTRYDVLKELALLKGAIAQLTATQHsappsvsstessssdplsAEERAAL  232
            +R+E++  +  TRYD+LKE+  LKG +A ++    S   +  +  + ++   SA    A 
Sbjct  70   VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGA-  128

Query  233  TRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVR---LTQLAPVADNALSTPLSPQQI  289
                   ++  T DR        H T   +  + +R   L  L  + +  LS PLS  +I
Sbjct  129  -DDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSKPLSKDEI  187

Query  290  NEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSA  349
            +EMFPLID + ++ ++A  L  GTR WAL  + +W+ + F  GN+ +L +VGEGG GKS 
Sbjct  188  DEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKST  247

Query  350  FCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVL  409
              G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q    L  +K QL RLNL+Y+L
Sbjct  248  LAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYIL  307

Query  410  EEADPFLLAGKVLVDPLNAMEEPMHA-TFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLP  468
             E++P ++A K+L+DPL A+ E      F+L DGIDQC    N  N+LLE  + +  + P
Sbjct  308  AESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVK-NQSNDLLELLSHITERFP  366

Query  469  SWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKV  528
            SW+GF+++SK     A RL  +SV+     N  F+ D   +++++   F    T EA  +
Sbjct  367  SWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDI  426

Query  529  LKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  588
            L +KSGGN  YL+F  +ALSHP +    ++  + L+VL ELPE++ +I   IF+DKFGQG
Sbjct  427  LMRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELPESVDEIIFTIFDDKFGQG  484

Query  589  RARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAY  648
              RVW  AKP+L++IV AAAGPY  + E Q K+ F+    + RM+ R+F D++      Y
Sbjct  485  HQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGY  544

Query  649  RIESSALCAWLSDPARSEEQFYFSIDDALQALR  681
            RI +S+L  WL    RS + F+ +     + LR
Sbjct  545  RIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 351 bits (900),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 194/519 (37%), Positives = 301/519 (58%), Gaps = 33/519 (6%)

Query  172  AIRREVMNELHVTRYDVLKELALLKGAIAQL--------TATQHsappsvsstessssdp  223
            ++R+E++  +  TRYD++KE+  L+G +  +          +  +      +T + ++  
Sbjct  76   SVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFS  135

Query  224  lsAEERAALTRQTSTKTSQATRD-----RLAASRTNIHKTPPPAARASVRLTQLAPVADN  278
             SAE+   ++R  + + S    D          R N   T   +   SV      P+ ++
Sbjct  136  ESAEDDEIISRFITPERSTIVADCSYKSGFVTERLN---TKDSSFSTSV------PLDES  186

Query  279  ALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLA  338
             LS PL   + +EMFP ID  S+L ++A  L  GTR WAL RV+EW+++ F   ND +L 
Sbjct  187  QLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILT  246

Query  339  VVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKN  398
            ++GEGG+GKS   G + Q+F   L A H CQFDRKS+SS R+V+LS+V Q     P +K 
Sbjct  247  IIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKNPLYKR  306

Query  399  QLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHAT---FMLVDGIDQCAAGLNGRNE  455
            QL  LNL+Y+L+E++P ++A K+L++PL A+  P+  +   F+L DGIDQC    N  N+
Sbjct  307  QLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVE-NESND  363

Query  456  LLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIAR  515
            LL+  + +  + PS +GF+++SK S     +    S++    +NG F+ D   ++++   
Sbjct  364  LLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSIL  423

Query  516  NFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYD  575
            NF    T EA  +L +KSGGN  YL+FT++ALSHP +    +   + L+VL ELP+++ D
Sbjct  424  NFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ERTFLSLDVLDELPDSVDD  481

Query  576  IYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRR  635
            I+  IFEDKFGQG  RVW   KP+L+ IV AAAG +  + E Q K+ F+   E+ RM++R
Sbjct  482  IFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKR  541

Query  636  SFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSID  674
            SF D++      YRI +S+L AWL    RS+   +F ID
Sbjct  542  SFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  577

>SPRG_06355
Length=713

 Score = 251 bits (641),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 154/464 (33%), Positives = 248/464 (53%), Gaps = 34/464 (7%)

Query  230  AALTRQTSTKTSQATRD--RLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQ  287
            + + R++   +S+ +R+  +L+   + I +      R S R     P+ D AL+ P    
Sbjct  256  STVVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTR----QPIKDQALTQPWE-N  310

Query  288  QINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGK  347
             +N+  P ++        A  + P TRTWA+ +  +W           +L VVG  G GK
Sbjct  311  VLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGK  366

Query  348  SAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKY  407
            S     +   +   ++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y
Sbjct  367  STLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAY  424

Query  408  VLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQL  467
            +++E DP +LA K+L++PL +M  P+ +  +++D +D+ A+   G N L+   A V  + 
Sbjct  425  LIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDAST-PGTN-LISLLADVALEF  482

Query  468  PSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKK  527
            PSWV FL+SS+P   + K LP   VL F  ++  F AD +  V  +      DD      
Sbjct  483  PSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-KNILF  541

Query  528  VLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQ  587
            +LK KS G+F YL+F  QA     M  +  +  + L    ELP+TLY+IY ++FE+K+G+
Sbjct  542  LLKAKSQGSFLYLQFVDQAF---AMIHSEIDAGMIL----ELPKTLYEIYDQVFEEKYGK  594

Query  588  GRARVWGKAKPLLQLIVGAA-------AGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDL  640
            GR RVW K +P+L+ IVGAA       A P+  +TE   +  FK    DL ++ RSF D+
Sbjct  595  GRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDI  652

Query  641  VAVKH--GAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRK  682
            VAV    G YR++S  L  +L D +RS+E  + +++  +  L K
Sbjct  653  VAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)

Query  172  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH  207
             IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H
Sbjct  155  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  190

>SDRG_01763
Length=736

 Score = 241 bits (616),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 142/418 (34%), Positives = 225/418 (54%), Gaps = 28/418 (7%)

Query  274  PVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGN  333
            P+ D AL+ P     +N+  P ++        A  + P TRTWA+ +  +W         
Sbjct  321  PIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375

Query  334  DTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  393
              +L VVG  G GKS     +   +   ++A+H  ++D +   +P  +L+S+ HQ+   L
Sbjct  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433

Query  394  PSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGR  453
            P ++ QL RLNL Y+++E DP +LA K+L++PL +M  P+ +  +++D +D+  +   G 
Sbjct  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVST-PGA  492

Query  454  NELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDI  513
            N L+   A V  + PSWV FL+SS+    + K LP   VL F  ++  F AD +  V  +
Sbjct  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551

Query  514  ARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETL  573
                  DD      +LK KS G+F YL+F  QA S   M  +  +  + L    ELP+TL
Sbjct  552  MDKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMIL----ELPKTL  603

Query  574  YDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAA-------AGPYSPMTEEQAKEHFKFT  626
            ++IY ++FE+K+G+GR RVW K + +L+ IVGAA       A P+  +TE   +  FK  
Sbjct  604  HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLG  661

Query  627  AEDLRMLRRSFVDLVAVKH--GAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRK  682
              DL ++ RSF D+V V    G YR++S  L  +L D ARS+E  + +++  +  L K
Sbjct  662  QPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)

Query  172  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH  207
             IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H
Sbjct  168  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203

>SDRG_04575
Length=1003

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 111/228 (49%), Gaps = 12/228 (5%)

Query  263  ARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVE  322
            A+   RL Q+A      L       ++  +F    F ++++ + +G     R W L +++
Sbjct  399  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  323  EWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAH-CCQFDRKSKSSPRNV  381
            +W        +D +  + G+ GTGKSA    + Q  R  + A H  C+ D +++S  R  
Sbjct  457  QWKQT-----HDQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  382  LLSMVHQLVDNLPSFKNQLARLN-LKYVLEEADPFLLAGKVLVDPLNAMEEPMHATF-ML  439
            +LS+ +QL   LP + + L + + L+ V+  +    L   +LV PL+A+ EP      +L
Sbjct  510  ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  440  VDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRL  487
            +DG+D         N L+     ++ +LPSWV  +++S+    + ++L
Sbjct  570  LDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>SPRG_12621
Length=1003

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 86/360 (24%), Positives = 155/360 (43%), Gaps = 36/360 (10%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAH-CCQFDR  372
            R W L ++++W        +D +  V G+ GTGKSA    + Q  R  + A H  C+ D 
Sbjct  461  REWVLDQLDQWKQT-----HDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDE  514

Query  373  KSKSSPRNVLLSMVHQLVDNLPSFKNQLARLN-LKYVLEEADPFLLAGKVLVDPLNAMEE  431
            +++S  R  +LS+ +QL   LP + + L + + L+ V+  +    L   +LV PL A+ E
Sbjct  515  QTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAE  573

Query  432  PMHATF-MLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRL---  487
            P      +L+DG+D         N L+     ++ +LPSWV  +++S+    + ++L   
Sbjct  574  PATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGF  633

Query  488  PVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTA----EAK-KVLKKKSGGNFAYLEF  542
                 LD  A +     D+ S +      +    TA    EA  + +  ++ G F Y   
Sbjct  634  APQIALDKCADHSR--QDIMSYLQKALLPYLPSTTAGVVPEATLQFIAGRAEGLFLYASH  691

Query  543  TKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  602
               ALS   +   + EG          P  +     + FE +F     +     +PLL++
Sbjct  692  IVHALSQHRLTLDNLEG---------FPTGMGGYLRQFFESQFTPEHYK--EHIRPLLEV  740

Query  603  IVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVK-HGAYRIESSALCAWLSD  661
            +  A    Y P+T +  +   ++ +     +  SF  L+ V      +   +++  WL D
Sbjct  741  LCAA----YEPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTDSNVLKPFHTSVLEWLQD  796

>H310_08292
Length=1007

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 84/355 (24%), Positives = 146/355 (41%), Gaps = 35/355 (10%)

Query  264  RASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEE  323
            + +VR+ QL       L       ++  +F    F +E+A   +G     R W + ++ +
Sbjct  407  KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQ  464

Query  324  WLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLL  383
            W              V G+ GTGK+A    + Q  +  + A H    D +   +PR  +L
Sbjct  465  W-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCIL  518

Query  384  SMVHQLVDNLPSFKNQLARLN-LKYVLEEADPFLLAGKVLVDPLNAMEEPMHATF-MLVD  441
            S+ +QL   LP++   L +   L+ ++  +    L   +LV PLNA+ +P      +L+D
Sbjct  519  SLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLD  578

Query  442  GID--QCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLP--VSSV-LDFS  496
            G+D  Q AA L+  N  +     ++ +LPSWV  + +S+    + ++L   V  V LD  
Sbjct  579  GLDAFQDAAALD--NCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKC  636

Query  497  AKNGAFVADVSSIVDDIARNFSDDDTA-----EAKKVLKKKSGGNFAYLEFTKQALSHPG  551
                +  AD+   +      F   D       E    +  +S G F Y      AL    
Sbjct  637  VDQSS--ADMLKYLQAALVPFVRPDEGAVVPLETLHAIVARSEGLFLYASHIVHAL----  690

Query  552  MAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGA  606
                  +  + L+ L   P  +     + FED+F           +PLL+++  A
Sbjct  691  -----HQKRLTLDKLESFPVGMGGYLRQFFEDQFSAHHYET--SIRPLLEVLCAA  738

>PYVX_21513
Length=1446

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 81/382 (21%), Positives = 157/382 (41%), Gaps = 68/382 (18%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  373
            R W   RV++W++   +  +  +  + G+ G+GK++    + Q F   + A H    +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  374  SKSSPRNVLLSMVHQLVDNLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNAMEEP  432
                 R  +LS+ +QL   LP +   L +R  L+ ++  +    L   +LV+PLN ++ P
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRP  556

Query  433  MHATFMLVDGIDQCAAG---------LNG------RNELLEFFAQVIPQLPSWVGFLISS  477
                 +L+DG++   +G         L G         L+     ++ +LPSWV  ++ S
Sbjct  557  AKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLS  616

Query  478  KPSSKLAKRLPV---SSVLD-FSAKN--------GAFVADVSSIVD--------------  511
            +    +  RL     S V+D F+ +N        G+ +A   S+ D              
Sbjct  617  REDHDVMTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIVEAATAETSGRSR  676

Query  512  --DIARNFS--------DDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAV  561
               +AR+ S           T E  +++ +++ G F Y     Q +         +EG V
Sbjct  677  LTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGI---------EEGRV  727

Query  562  PLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKE  621
             L  L +LP  +     + F+  F     +     +P L+++  A    Y P+T +   +
Sbjct  728  ALNELDKLPTGMGGCLRQFFDSHFDDNTYKT--TIRPALEVLCAA----YEPLTMDALAK  781

Query  622  HFKFTAEDLRMLRRSFVDLVAV  643
              ++   + R +  +F  L+ +
Sbjct  782  VLEWDIYEQREVVATFGSLLTL  803

>H257_11773
Length=1026

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 92/418 (22%), Positives = 170/418 (41%), Gaps = 35/418 (8%)

Query  263  ARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVE  322
             + +VRL QL       L       ++  +F    F +E++   +G     R W + ++ 
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  323  EWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVL  382
            EW        +     + G+ GTGK+A   +V Q  +  + A H    + +   + R  +
Sbjct  479  EW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  383  LSMVHQLVDNLPSFKNQLARLN--LKYVLEEADPFLLAGKVLVDPLNAMEEPMHATF-ML  439
            LS+ +QL   LP +   L + +  L+ ++  +    L   +LV PLNA+ +P      +L
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  440  VDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSK--PS--SKLAKRLPVSSV--L  493
            +DG+D         N  +   A  +  LP WV ++++S+  PS   KL   +P  ++   
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  494  DFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMA  553
                ++        ++V  +A N   D  A   + + ++S G F Y      ALS   + 
Sbjct  653  GHQTRDDMLKYLQLALVQFVA-NADKDVPAATLRFIVERSEGLFLYASHIVNALSQKRLT  711

Query  554  AASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSP  613
                     L+ L   P  +     + FED+F           +PLL+++  A    + P
Sbjct  712  ---------LDKLESFPVGMGGYLRQYFEDQFTALHYET--SVRPLLEVLCAA----FEP  756

Query  614  MTEEQAKEHFKFTAEDLRMLRRSFVDLVAVK-HGAYRIESSALCAWLSDPARSEEQFY  670
            +         K+ +   R    SF  L+ V      +   +++  WL D A +  +F+
Sbjct  757  LHMSTLHNIMKWDSYAHRDFLGSFKSLLYVSDENELKPFHTSVFEWLED-AHAAGRFF  813

>PYAP_22230
Length=1116

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 92/425 (22%), Positives = 153/425 (36%), Gaps = 99/425 (23%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  373
            R W L  + +W++     G+     V G+ G+GK++    + Q     + A H    D  
Sbjct  496  RAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  374  SKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPF----LLAGKVLVDPLNAM  429
                 R  +LS+ +QL   LP +      L     LEE  P      L   +LV+PLNA+
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  610

Query  430  EEPM--HATFMLVDGIDQ---------------------------------CAAGLNGRN  454
              P       +L+DG++                                  C       +
Sbjct  611  ARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSD  670

Query  455  E-LLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPV---SSVLDFSAKNGAFVADVSSIV  510
            E L+     +I +LP WV  ++ S+    +  +L V   S  LD   +     AD+   V
Sbjct  671  ECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENE--ADIREFV  728

Query  511  D---------------------------------DIARNFSDDDTAEAKKVLKKKSGGNF  537
            +                                  ++ N     +AE  +V+ K+S G F
Sbjct  729  EMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLF  788

Query  538  AYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  597
             Y     QA+         +EG + ++ L  LP  L     + FE  F     +   K +
Sbjct  789  LYAANIVQAI---------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYKT--KIR  837

Query  598  PLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAY-RIESSALC  656
            P+L+++  A    Y PMT       F ++  + + +  SF  L+ V    Y R   S++ 
Sbjct  838  PVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVL  893

Query  657  AWLSD  661
             W+ D
Sbjct  894  EWVQD  898

>PYAR_14788
Length=795

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 82/378 (22%), Positives = 141/378 (37%), Gaps = 62/378 (16%)

Query  327  ARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMV  386
            A  N     +  V G+ G GK++    + Q     + A H    +       R  +LS+ 
Sbjct  409  ASINELRSKVFWVTGQIGAGKTSVAAKMVQTIP-EIAAFHFALQEDDQTQLARRCVLSLA  467

Query  387  HQLVDNLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAMEEPM--HATFMLV  440
            +QL   LP++      L     LEE  P      L   +L+ PLNA+  P       +L+
Sbjct  468  YQLTTQLPAYA---VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLI  524

Query  441  DGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLP-VSSVLDFSAKN  499
            DG++  A+   G    +     +I +LPSWV  ++ S+    +  +L   S  +    + 
Sbjct  525  DGLEHLASNTGGAGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRRE  584

Query  500  GAFVADVSSIVD------------------------DIARNFSDDDTA-----------E  524
                 D+   V+                         I  +F++   A           E
Sbjct  585  QENEEDIRGFVEAALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSE  644

Query  525  AKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDK  584
              +++ K+S G F Y     Q++         +EG + ++ L  LP  L     + FE  
Sbjct  645  QVELITKRSEGLFLYAVNIVQSI---------EEGRLSVDQLASLPLGLGGYLRQFFESH  695

Query  585  FGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVK  644
            F     +   K +P+L+++  A    Y PMT       F ++  D   +  SF  L  + 
Sbjct  696  FDDTTYKT--KIRPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCIS  749

Query  645  HGAY-RIESSALCAWLSD  661
               Y R   S++  W+ D
Sbjct  750  DDGYMRPFHSSVLEWVQD  767

>H257_01934
Length=1022

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 100/442 (23%), Positives = 178/442 (40%), Gaps = 59/442 (13%)

Query  253  TNIHKTPPPA--ARASVRLTQLAPVADNALSTPLSPQQINEMFPLID---FTSELAAHAR  307
            ++ H TP     AR S R  QL    +  +      QQ   +F L+    F S+++   +
Sbjct  400  SSFHTTPWTLHDARYSTRREQLIAALNGRVGLDQEGQQ-ARLFSLLSPFSFQSQISTATQ  458

Query  308  GLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHC  367
            G     R W L   +EW+ +  +      L + G  G+GK+A    + Q  R  ++A H 
Sbjct  459  GYC--GRAWVLHEFDEWVTSPPSNARRVFL-LTGVIGSGKTALAAHIIQN-RPEVVAFHL  514

Query  368  CQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEE-------ADPFLLAGK  420
               + +   + R  +L++V+QL   LP++ N L   + K  LEE       AD   L  +
Sbjct  515  ASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLAD---LVQE  569

Query  421  VLVDPLNAMEEPMHATFMLVDGID--QCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSK  478
            +L+ PL  +  P     +L+DGI+   CA      + L+      + + P+W+ F+ +S+
Sbjct  570  LLIAPLERIATPPSTMVILIDGIECFPCA-----DDNLVAILTASLNRWPAWMRFVFTSR  624

Query  479  PSSKLAKRL------PVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKV---L  529
               ++   L      P++  LD +        DV   +D    +  D        V   L
Sbjct  625  EDPRVLSLLQAYMLPPIA--LDLACAQSK--RDVRQYLDTALGSHFDISPPMPPHVIDLL  680

Query  530  KKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFG-QG  588
              ++ G F Y      ++S          G   L+ L  +P T+     + F  +F    
Sbjct  681  VDRTQGLFLYARHLVDSIS---------SGQWNLDNLDNVPTTMGGFLHQNFATQFPVVD  731

Query  589  RARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAY  648
            + +V    +P+L+++  A    + P+T +       F     + L+  F  L     G  
Sbjct  732  KYKV--DVRPVLEVVCAA----HEPLTLDALSAIMHFDVYQAQKLQSDFGSLFHAGEGGV  785

Query  649  RIESS-ALCAWLSDPARSEEQF  669
             +    +L  WL DP  + + F
Sbjct  786  ILPFHLSLLDWLQDPRSAGDYF  807

>SDRG_07983
Length=991

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/226 (27%), Positives = 93/226 (41%), Gaps = 29/226 (13%)

Query  263  ARASVRLTQLAPVADNALSTPLSPQQINEMFPLID---FTSELAAHARGLTPGTRTWALT  319
            AR   R  QL    D  +      QQ   +F L+    F S+++   +      R W L 
Sbjct  391  ARYKTRYHQLLSALDGQIGLDHDGQQ-ARLFSLLSPFSFQSQISKLTQLFV--AREWVLA  447

Query  320  RVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPR  379
            + + W+          +  + G  G+GKSA    + Q  R  + A H    +     S R
Sbjct  448  KYDAWVQ---TPNGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  503

Query  380  NVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAMEEPMHA  435
              +LS+V+QL   LP + N    +N +  LEE  P      L   +L+ PL+A+  P   
Sbjct  504  RCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  560

Query  436  TFMLVDGIDQCAAGLNGRNELLEFFAQVIPQL---PSWVGFLISSK  478
              +L+DGID    G         F A +   +   PSWV F+  ++
Sbjct  561  LVLLIDGIDCFEPG---------FVATLTAHMDLWPSWVRFVFGTR  597

>SPRG_19030
Length=1000

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 74/172 (43%), Gaps = 23/172 (13%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  373
            R W L + + W+          +  V G  G+GKSA    + Q  R  + A H    +  
Sbjct  450  REWVLAKYDAWVQ---TPNGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEED  505

Query  374  SKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAM  429
               S R  +LS+V+QL   LP + N    LN +  LEE  P      L   +L+ PL+A+
Sbjct  506  QTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSAI  562

Query  430  EEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQL---PSWVGFLISSK  478
              P     +L+DGI+    G         F A +   +   PSWV F+  ++
Sbjct  563  AHPASILVLLIDGIECFEPG---------FVATLTAHMDLWPSWVRFVFGTR  605

>PYIR_14107
Length=1176

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 83/416 (20%), Positives = 169/416 (41%), Gaps = 81/416 (19%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  373
            R W   ++E W+ +        +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  550  REWLFMQLENWIASPTAT---QVFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  605

Query  374  SKSSPRNVLLSMVHQLVDNLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNAMEEP  432
               + R  +LS+ +QL   LP +   L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  433  MHAT--FMLVDGIDQCAAGLN--------------------------------GRNELLE  458
                   +L+DG++  ++G N                                G   L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  459  FFAQVIPQLPSWVGFLISSKPSSKLAKRL---PVSSVLDFSAKNGAFVADVSSIVDDI--  513
                ++ +LP+WV  ++ S+    +  +L     S VLD S K+ +   D+   V+++  
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLD-SLKSES-QQDIKRYVENMLG  783

Query  514  -------------------ARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAA  554
                               A  FS+  + E   ++ K+S G F Y     Q++       
Sbjct  784  ESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------  836

Query  555  ASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPM  614
              +E  + ++ L  LP  +   + + F+  F + + +     +P+L+++  +    + P 
Sbjct  837  --EEKRLAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLEVLCAS----FEPF  888

Query  615  TEEQAKEHFKFTAEDLRMLRRSFVDLVAV-KHGAYRIESSALCAWLSDPARSEEQF  669
            +         +   D + +  SF  L+++   G  R   S++C W+ DPA + + F
Sbjct  889  SLWNIVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>PHYSO_470533
Length=1084

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 74/350 (21%), Positives = 140/350 (40%), Gaps = 64/350 (18%)

Query  314  RTWALTRVEEWLDARF---------NVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLA  364
            R W   R ++W+              + N  +  +VG+ G+GK++    + Q     + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  365  AHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLV  423
             H  + + +   + R  +LS+ +QL   LP + + L +   L+ ++  A    L  ++L+
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLI  590

Query  424  DPLNAMEEP--MHATFMLVDGIDQCAAG----------LNGRNELLEFFAQVIP----QL  467
             PLNA+  P    +  +L+DGI+               L+G ++  E    ++P    +L
Sbjct  591  GPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRL  650

Query  468  PSWVGFLISSKPS----SKLAKRLPVSSVLD-FSAKNGAFV------------------A  504
            P WV  ++ S+      SKL    P   ++D F  +N   +                  A
Sbjct  651  PDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFA  710

Query  505  DVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLE  564
              S    D+  N  +    +  +++ ++S G F Y     QA++         EG + L 
Sbjct  711  KASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT---------EGRLRLH  761

Query  565  VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPM  614
             L ELP  +     + F   F         + +P+L+++  A    Y P+
Sbjct  762  ELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLCAA----YEPL  806

>PITG_17250
Length=1046

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 74/342 (22%), Positives = 138/342 (40%), Gaps = 56/342 (16%)

Query  314  RTWALTRVEEWLDARF----NVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQ  369
            R W     + W+         + N  +  V+G+ G+GKS+    + Q     + A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  370  FDRKSKSSPRNVLLSMVHQLVDNLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNA  428
             + +   + R  +LS+ +QL   LP + + L +   L+ ++  A    L   +L+ PLNA
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  429  MEEP--MHATFMLVDGIDQC----AAGLNG------RNE--LLEFFAQVIPQLPSWVGFL  474
            +  P    +  +L+DG++         +NG      ++E  L+     ++ +LP WV  +
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  475  ISSKPSSKLAKRL-----PVSSVLDFSAKNGA----FVADVSSIVDDIARNF--------  517
            + S+    +  +L     P   +  F  +N      F++   S ++    +F        
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIG  688

Query  518  SDDDTAE-----AKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPET  572
            S  DT E       +++ ++S G F Y     QA+S         EG + L  L ELP  
Sbjct  689  SGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS---------EGRLRLHELAELPVG  739

Query  573  LYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPM  614
            +     + F   F         + +P+L++   A    Y P+
Sbjct  740  MGAYLHQFFASHFADHDVYK-HRIRPVLEVCCAA----YEPL  776

>PYIW_15717
Length=1121

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 87/437 (20%), Positives = 167/437 (38%), Gaps = 103/437 (24%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  373
            R W   ++E W+ +        +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLIP-EIAAFHFALQEDE  580

Query  374  SKSSPRNVLLSMVHQLVDNLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNAMEEP  432
               + R  +LS+ +QL   LP + + L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARP  640

Query  433  MHAT---FMLVDGIDQCAAGLN--------------GRNE----------------LLEF  459
              AT    +L+DG++   +  N              GR+                 L+  
Sbjct  641  QTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVSA  700

Query  460  FAQVIPQLPSWVGFLISSKPSSKLAKRLPVSS---VLD-FSAKNGAFVADVSSIVDDI--  513
               ++ +LP WV  ++ S+    +  +L   +   VLD F  +N     D+ S V+ I  
Sbjct  701  LPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTPNVVLDRFERENQ---QDIKSYVEKILG  757

Query  514  ----------------------ARNFSDDDTA------------------EAKKVLKKKS  533
                                   RN S   +                   E   ++ K+S
Sbjct  758  EPSPQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVKRS  817

Query  534  GGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVW  593
             G F Y     Q++         +E  +P+  L  LP  +   + + F+  F + + +  
Sbjct  818  EGLFLYAVNIVQSI---------EERRLPVSQLESLPIGMGGYFRQFFDSHFDEQQYK--  866

Query  594  GKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAV-KHGAYRIES  652
               +P+L+++  +    + P +         ++  D + +  SF  L+ V   G  R   
Sbjct  867  DSIRPVLEVLCAS----FEPFSLATIASILSWSVYDQQEIAASFGSLLFVGADGNIRPFH  922

Query  653  SALCAWLSDPARSEEQF  669
            S++  W+ D A + E F
Sbjct  923  SSVLDWVQDLATAGEYF  939

>PPTG_11365
Length=1106

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 71/350 (20%), Positives = 133/350 (38%), Gaps = 65/350 (19%)

Query  314  RTWALTRVEEWLDARF------NVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHC  367
            R W   + + W+           + N  +  VVG+ G+GK++    + Q     + A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  368  CQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPL  426
               + +   + R  +LS+ +QL   LP + + L +   L+ ++  A    L   +L+ PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  427  NAMEEP--MHATFMLVDGIDQC------------AAGLNGRNELLEFFAQVIP----QLP  468
             A+  P    +  +L+DG++              + G    N+  E F  ++P    +LP
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  469  SWVGFLISSKPSSKLAKRL-----PVSSVLDFSAKNGA-------------------FVA  504
             WV  ++ S+    +  +L     P  ++  F  +N                     F  
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEK  741

Query  505  DVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLE  564
              + I  D   N  +    +  +++ ++S G F Y     QA+S         EG + L 
Sbjct  742  AAAQIGTDSGNN-HEFGMEQVVELIARRSEGLFLYAVNVVQAIS---------EGRLHLH  791

Query  565  VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPM  614
             L ELP  +     + F   F         + +P+L++   A    Y P+
Sbjct  792  ELAELPVGMGAYLQQFFASHFAD-HDMYKHRVRPVLEVCCAA----YEPL  836

>PYU1_G002110
Length=999

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 77/389 (20%), Positives = 153/389 (39%), Gaps = 54/389 (14%)

Query  314  RTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRK  373
            R W + ++ +W+D+        +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  432  RKWLIAQLTKWIDSP---TASQMFWVTGQIGSGKTALAARLVQTI-PEIKAFHFAFEEDE  487

Query  374  SKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAM  429
               + R  +LS+ +QL   L   K+  A L  +  LEE  P      L   +L+ PLN +
Sbjct  488  QTQNARRCVLSLAYQLTTQL---KDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEI  544

Query  430  EEPMHAT---FMLVDGIDQCAAG---------LNGRNELLEFFAQVIP----QLPSWVGF  473
             +         +L+DG++  + G         +  R    +     +P    QLP WV  
Sbjct  545  AQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVRV  604

Query  474  LISSKP----SSKLAKRLPVSSVLDFSAKNGAFVADV--SSIVDDIARNFSDDDTAEAKK  527
            ++ S+     ++KL    P   +  +  +N   +      S+    +   S   T    +
Sbjct  605  IVLSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPDQ  664

Query  528  V--LKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKF  585
            +  + ++S G F Y     Q+L     A           V   LP  +     + F   F
Sbjct  665  IDLIVERSEGLFLYAANVVQSLEEKWFA-----------VGQSLPIGMNGYLYDFFVSHF  713

Query  586  GQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAV-K  644
            G  + +     +P+L+++  A    + P++        K    + + +  +F  L+++  
Sbjct  714  GAKQYK--RLIRPVLEVLCAA----FEPLSLPTIASILKLQTNEQQEIATAFGSLLSIGA  767

Query  645  HGAYRIESSALCAWLSDPARSEEQFYFSI  673
             G+ R   S++  W+ +  +S + FY  +
Sbjct  768  DGSVRPFHSSVLNWVQE-LQSVDPFYVDV  795

>PHYSO_300272
Length=636

 Score = 35.8 bits (81),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 65/157 (41%), Gaps = 28/157 (18%)

Query  251  SRTNIHKTPPPAARASVRLTQ---LAPVADNALSTPLSPQQINEMFPLIDFTSELAAHAR  307
            S   I   PPP    +V+L      +P      ++ L+P     + PL+    E   H  
Sbjct  92   SEAKIGVAPPPVIW-TVQLVHKGTRSPFNKIGPASILAPPGYKTVGPLLAKVHEQCHH--  148

Query  308  GLTPGTRTWALTRVEEWLDARFN-VGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAH  366
                       T V++W + ++N V N+ L  +VG  GTGKS  C  +A  +  N     
Sbjct  149  -----------TFVDQWNEMKWNSVDNEALQWIVGPPGTGKS--CTALAFAYALNASVWD  195

Query  367  CCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARL  403
                D +        L +++ QLVD+L S ++ L  L
Sbjct  196  VLWMDFR--------LQTLLQQLVDSLSSTRSTLVFL  224

>PYU1_G013031
Length=401

 Score = 35.4 bits (80),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (43%), Gaps = 23/89 (26%)

Query  388  QLVDNLPSF------KNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVD  441
            +LVD  PSF      +N L  L   Y L+E   + L+G +  D                 
Sbjct  79   KLVDGFPSFSQLAVAENDLNMLTFLYHLQEDPYYALSGMIAFD----------------Q  122

Query  442  GIDQCAAGLNGRNELLEFFAQVIPQLPSW  470
             + +CA    GR ELL + +++IP   +W
Sbjct  123  DLFRCAVAF-GRLELLIYLSELIPDYATW  150

>PHYCA_133652
Length=200

 Score = 34.3 bits (77),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 0/50 (0%)

Query  40   DPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYRTTEQIRANN  89
            + V++ RS TL D + V  D +     R  S+ + D P+YR+ +  R+ N
Sbjct  102  EEVQYRRSATLTDAITVALDYDRSHAHRGRSDNARDKPRYRSYDSKRSKN  151

>PYIR_23360
Length=227

 Score = 34.3 bits (77),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 39/72 (54%), Gaps = 2/72 (3%)

Query  320  RVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSP  378
            +V+EWL D R +VG+D +LA+VG      S+F    AQQF    + A   +   K+    
Sbjct  109  KVKEWLQDLRHHVGDDIVLAIVGNKCDVASSFNFAKAQQF-AQEIGALVFRTSAKTGDGV  167

Query  379  RNVLLSMVHQLV  390
            +N+  S+  QL+
Sbjct  168  QNLFESVAVQLL  179

>PHYSO_545378
Length=224

 Score = 33.9 bits (76),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  317  ALTRVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +  +++EWL D + +VG+D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQF  141

>PITG_06580
Length=1214

 Score = 34.3 bits (77),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 57/146 (39%), Gaps = 18/146 (12%)

Query  300  SELAAHARGLTPGTRTWALTRVEEWLDARFNV----GNDTL----LAVVGEGGTGKSAFC  351
            ++L A    +   T  W    + + +  RF V     ND L    L +V    T  S+  
Sbjct  403  ADLRAMKFAIEAETCHWTHVVLLQKMQTRFYVLQAEANDLLDDISLKIVNSSRTMSSSKF  462

Query  352  GTVAQQFR----------GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLA  401
             +V Q             GNLL+A     D   K+ P NV +   H  V +L  F+++  
Sbjct  463  ASVQQALERLMAKYTTLYGNLLSADVHSADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFN  522

Query  402  RLNLKYVLEEADPFLLAGKVLVDPLN  427
            R N        +   LA + L+ P+N
Sbjct  523  RKNFSARYRVKNFIKLACRSLLQPVN  548

>PYVX_21776
Length=203

 Score = 33.1 bits (74),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  320  RVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +++EWL D + +VG D +LAVVG      S+F    AQQF
Sbjct  106  KIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQF  145

>PYIW_19868
Length=270

 Score = 33.5 bits (75),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (43%), Gaps = 36/119 (30%)

Query  333  NDTLLAVVGEGGTGKSAFCGTVAQQFRG------------NLLAAHCCQFD------RKS  374
            N  ++ ++GE GTGK+ F   +A   +             +LL A   ++D      +  
Sbjct  25   NSEIICMLGENGTGKTTFIRMLAGLLKSDEMEMAEATGDQDLLDACALRYDSSTISYKPQ  84

Query  375  KSSP-----------RNVLLSMVHQLVDNLPSFKNQLAR-LNLKYVLEEADPFLLAGKV  421
            K +P           R +  S+VH      P F   + R LNL  ++++A PFL  G++
Sbjct  85   KIAPKFQGTVRELLHRRIRESIVH------PQFATDVTRPLNLDNIIDQAVPFLSGGEL  137

>PITG_15223
Length=920

 Score = 33.9 bits (76),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 99/254 (39%), Gaps = 37/254 (15%)

Query  245  RDRLA-ASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELA  303
            RDRL   ++ + HK     +RA    +    V D   + PL  Q ++ + PLI     L 
Sbjct  534  RDRLPRTTKHHFHKPTSIQSRAISLSSSFFSVGDTMCAAPLMQQALDHLTPLILREQRLV  593

Query  304  AH----ARGLTPGTR------TWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGT  353
            A     A   T G +      T+ +  V E L  R N   D         GT  +    +
Sbjct  594  ASLFFPATPSTTGGKHEPEDLTFMMENVFEKLLKRMNEFGDA-------AGTRNTLDALS  646

Query  354  VAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEAD  413
            +     G L A       R+  +   NV++           SF+ Q+ R+ +K+  E+ +
Sbjct  647  LVVLVNGKLEAC------RQQSAFLYNVMV-----------SFQLQMKRMLIKFT-EDQE  688

Query  414  PFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGF  473
             +++A  V    +  +  P      L+  +++  AG +  + L+  +  ++P    W+  
Sbjct  689  AWIIAQSVDTK-MAGVLGPTKKIVNLIARMEESVAGKSSDSTLVSIYNMIVPATMHWIDK  747

Query  474  LISSKPSSKLAKRL  487
            +  ++P      RL
Sbjct  748  VADTRPKYAPLTRL  761

>PYU1_G012267
Length=217

 Score = 33.1 bits (74),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  320  RVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +++EWL D R +V +D +LAVVG      S+F    AQQF
Sbjct  104  KIKEWLQDLRHHVADDIVLAVVGNKCDVASSFNFAKAQQF  143

>PHYCA_571841
Length=241

 Score = 33.1 bits (74),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (55%), Gaps = 2/75 (3%)

Query  317  ALTRVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSK  375
            +  +++EWL D + +VG+D +LAVVG      S F  + AQQF  + + A   +   KS 
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFSKAQQF-ADEIGALVFRTSAKSG  157

Query  376  SSPRNVLLSMVHQLV  390
               +++  S+  QL+
Sbjct  158  EGVQSLFESLAVQLL  172

>PPTG_02543
Length=1373

 Score = 33.5 bits (75),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 41/87 (47%), Gaps = 6/87 (7%)

Query  335  TLLAVVGEGGTGKSAFCGTVAQQF--RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDN  392
            T+  V+G+ G+GKSA    ++ QF    N+       ++      P+  ++  V Q V+ 
Sbjct  102  TITLVLGQPGSGKSALMKMLSAQFPVESNITVEGEITYN----GVPQKDVIKRVPQFVEY  157

Query  393  LPSFKNQLARLNLKYVLEEADPFLLAG  419
            +P      A L ++  LE A  F+ AG
Sbjct  158  VPQSDKHFATLTVRETLEYAHKFIGAG  184

>PITG_15525
Length=224

 Score = 32.7 bits (73),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  317  ALTRVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +  +++EWL D + +VG+D +LAVVG      S F    AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQF  141

>PHALS_00054
Length=224

 Score = 32.7 bits (73),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  317  ALTRVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +  +++EWL D + +VG+D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFSKAQQF  141

>PPTG_13828
Length=958

 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  360  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAG  419
            GNLL+A     D   K+ P NV +   H  V +L  F+++  R N        +   LA 
Sbjct  227  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  286

Query  420  KVLVDPLN  427
            + L+ P+N
Sbjct  287  RSLLQPVN  294

>PYVX_15878
Length=1347

 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 39/87 (45%), Gaps = 6/87 (7%)

Query  335  TLLAVVGEGGTGKSAFCGTVAQQF--RGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDN  392
            T+  V+G+ G+GKSA    ++ QF    N+      + D      P+  L+  V Q ++ 
Sbjct  105  TITLVLGQPGSGKSALMKMLSGQFPVESNI----TVEGDITYNGVPQKELIKRVPQFIEY  160

Query  393  LPSFKNQLARLNLKYVLEEADPFLLAG  419
            +P      A L  +  LE A  F+  G
Sbjct  161  VPQSDKHFATLTTRETLEYAHKFVGGG  187

>PPTG_13827
Length=1212

 Score = 33.1 bits (74),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  360  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAG  419
            GNLL+A     D   K+ P NV +   H  V +L  F+++  R N        +   LA 
Sbjct  481  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  540

Query  420  KVLVDPLN  427
            + L+ P+N
Sbjct  541  RSLLQPVN  548

>PPTG_07025
Length=224

 Score = 32.3 bits (72),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  317  ALTRVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +  +++EWL D + +VG+D +LAVVG      S F    AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQF  141

>PHYRA_82858
Length=224

 Score = 32.3 bits (72),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  317  ALTRVEEWL-DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQF  358
            +  +++EWL D + +VG+D +LAVVG      S F    AQQF
Sbjct  99   SFDKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFAKAQQF  141

Lambda      K        H        a         alpha
   0.317    0.130    0.371    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 59876405796

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40