Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_17128147571177117754760.0
PITG_18457147571170117947890.0
PHYSO_321157147571180117445410.0
PHYRA_95901147571075117942250.0
PHALS_06477147571166118437790.0
PHYCA_344751475769272229020.0
PYIR_13453147571186123127630.0
PYIW_1879314757997104025800.0
PYAP_17746147571169117824020.0
PYU1_G0017341475780081823000.0
H310_09212147571113121118380.0
SPRG_063541475788493316340.0
SDRG_0176414757109279815820.0
H257_0630514757109981714680.0
CCA18898147571147115914660.0
CCI4512214757110576213592e-167
PHYKE_8394147574282228481e-101
PYAR_13581147577303057265e-81
H310_112724789179940970.026
PPTG_1622114050125943831.2
CCI4663810613198948831.3
CCI49118161986198948831.3
PHYRA_8453414050136843812.1
PHYCA_539991405094743802.6
PYAR_23813495109723793.3
HYAP_0862314050118743793.7
PYVX_21490799342926131793.9
PHYSO_51769810613191141784.5
CCA1843410613198549784.9
CCA18292153450198549784.9
SDRG_1669920076647776.6
SPRG_1882620076647766.8
PHYRA_96309343297436767.9
SPRG_13978129683475150758.3
CCA14389151856118744759.9
PYVX_2107866641475427510.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17128

Length=1177
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17128                                                            2113       0.0   
PITG_18457                                                            1849       0.0   
PHYSO_321157                                                          1753       0.0   
PHYRA_95901                                                           1632       0.0   
PHALS_06477                                                           1460       0.0   
PHYCA_34475                                                           1122       0.0   
PYIR_13453                                                            1068       0.0   
PYIW_18793                                                            998        0.0   
PYAP_17746                                                            929        0.0   
PYU1_G001734                                                          890        0.0   
H310_09212                                                            712        0.0   
SPRG_06354                                                            634        0.0   
SDRG_01764                                                            613        0.0   
H257_06305                                                            570        0.0   
CCA18898                                                              569        0.0   
CCI45122                                                              528        2e-167
PHYKE_8394                                                            331        1e-101
PYAR_13581                                                            284        5e-81 
H310_11272                                                            42.0       0.026 
PPTG_16221                                                            36.6       1.2   
CCI46638                                                              36.6       1.3   
CCI49118                                                              36.6       1.3   
PHYRA_84534                                                           35.8       2.1   
PHYCA_53999                                                           35.4       2.6   
PYAR_23813                                                            35.0       3.3   
HYAP_08623                                                            35.0       3.7   
PYVX_21490                                                            35.0       3.9   
PHYSO_517698                                                          34.7       4.5   
CCA18434                                                              34.7       4.9   
CCA18292                                                              34.7       4.9   
SDRG_16699                                                            34.3       6.6   
SPRG_18826                                                            33.9       6.8   
PHYRA_96309                                                           33.9       7.9   
SPRG_13978                                                            33.5       8.3   
CCA14389                                                              33.5       9.9   
PYVX_21078                                                            33.5       10.0  

>PPTG_17128
Length=1177

 Score = 2113 bits (5476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1177/1177 (100%), Positives = 1177/1177 (100%), Gaps = 0/1177 (0%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
             AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180
             KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL
Sbjct  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180

Query  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240
             PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ
Sbjct  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240

Query  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPEsttrrrs  300
             RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTRRRS
Sbjct  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTRRRS  300

Query  301   vrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFsdd  360
             VRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFSDD
Sbjct  301   VRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFSDD  360

Query  361   dvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI  420
             DVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI
Sbjct  361   DVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI  420

Query  421   SFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  480
             SFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV
Sbjct  421   SFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  480

Query  481   NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540
             NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR
Sbjct  481   NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540

Query  541   AYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA  600
             AYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA
Sbjct  541   AYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA  600

Query  601   ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660
             ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF
Sbjct  601   ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660

Query  661   VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpi  720
             VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPI
Sbjct  661   VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPI  720

Query  721   lgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780
             LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI
Sbjct  721   LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780

Query  781   KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR  840
             KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR
Sbjct  781   KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR  840

Query  841   LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD  900
             LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD
Sbjct  841   LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD  900

Query  901   GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL  960
             GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL
Sbjct  901   GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL  960

Query  961   DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV  1020
             DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV
Sbjct  961   DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV  1020

Query  1021  TGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC  1080
             TGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC
Sbjct  1021  TGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVC  1080

Query  1081  FDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvssps  1140
             FDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSPS
Sbjct  1081  FDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSPS  1140

Query  1141  rpvsgrsgNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177
             RPVSGRSGNFAQVLSAVRASTGGGKSDRLGKMQRRRR
Sbjct  1141  RPVSGRSGNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177

>PITG_18457
Length=1170

 Score = 1849 bits (4789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1179 (87%), Positives = 1092/1179 (93%), Gaps = 11/1179 (1%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             M+KVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+AIVTTAEVQAFN
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
             AILQQTETELR+KAELVLNGMVNSS++A+NNQ QSG  LPAVTVAA PS  HRSGY+ AN
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180
             KPRQMDASSIP+EFFREQFRN+SVEIRQSL   PEPW+RHFG+HHGRLMRKKTTQHCRLL
Sbjct  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL---PEPWERHFGIHHGRLMRKKTTQHCRLL  177

Query  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240
             PSVNK DPS P PELREEDAKHGVLNLVTRGFLPAYADLTP F+G   TS+GS GG+MKQ
Sbjct  178   PSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSG---TSDGSGGGVMKQ  234

Query  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPEsttrrrs  300
             RATRIY+RSEQ VRSTPFTQSTGYNLASLKFDL APPTPPP +PE+     P+STTRRRS
Sbjct  235   RATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATF---PDSTTRRRS  291

Query  301   vrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFsdd  360
              R+SSA+QGPN  T S P S +K+KN RSAH TSLMSAAVAAFTNQGED +NNR RFSDD
Sbjct  292   TRRSSALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSDD  351

Query  361   dvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI  420
             D+SDE+QE+DEN KDE AEME+LGANVDKIRGYNELLD YSLHQFLIHKGRTMRDTPEF+
Sbjct  352   DISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFV  411

Query  421   SFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  480
             SFRRV QELWGSVEEALRALE LL QYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV
Sbjct  412   SFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  471

Query  481   NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540
             NEDQ+MSVLRRPGQRYKGRDRKRRAATT++AC+RMWLVRRRYAR+RASD NA+KIQLAWR
Sbjct  472   NEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWR  531

Query  541   AYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA  600
             AYSCHT+LK RLREV  EKLEKWEKRM  LKS W QIA RRRVVVHVPSLSLDEH RL A
Sbjct  532   AYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGA  591

Query  601   ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660
             ENFA+QQNLQLTRVCA ALDSNV+LL+YVSPFELT+DV QYFLKLLQLGGLVDS PRVK 
Sbjct  592   ENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKL  651

Query  661   VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpi  720
             VFPEQ+TRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLA+ALDLPI
Sbjct  652   VFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPI  711

Query  721   lgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780
             LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHE+CAALAKLAIAHMDQP+WLI
Sbjct  712   LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLI  771

Query  781   KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR  840
             KLDYDPL VGEAVVDLSN+QAMRELRREKRTPEYWRQPGPRDAAAK+ILAELERPGMLAR
Sbjct  772   KLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLAR  831

Query  841   LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD  900
             +A PM +E+FP WR++IDAVGHFGCV+EAVPPTAIAAS EAST LVEPAYVRANLFVDPD
Sbjct  832   IATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPD  891

Query  901   GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL  960
             GSVH++STQNVLA GGGGLNRKTVAFTFPQTAAP+EAIKGACNAAGKLLVETNVWGYVSL
Sbjct  892   GSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSL  951

Query  961   DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV  1020
             DFVVFQDEKSN APRLWALAVHPFLTDSA SFACFHLLARGVLDTNSG YRVA+KSLTT 
Sbjct  952   DFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTA  1011

Query  1021  -TGRNG-SGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHG  1078
              +GR   SG  TDLLLREA LAK SL GA RCFV CSYVFHPHV TMQYTAFFHACRLHG
Sbjct  1012  NSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHG  1071

Query  1079  VCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvss  1138
             VCFDVERTLGTLFLLADSLTAGVFG+LSIGET EGALAFLRTALEVIGREAGSTI++ SS
Sbjct  1072  VCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASS  1131

Query  1139  psrpvsgrsgNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177
             PSR V+ RSGNFAQ+LSA+R STGGGKSDRLGKM++R+R
Sbjct  1132  PSRSVASRSGNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170

>PHYSO_321157
Length=1180

 Score = 1753 bits (4541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 968/1174 (82%), Positives = 1064/1174 (91%), Gaps = 11/1174 (1%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             MEKVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSA+VTTAEVQAFN
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
             AILQQTE ELR+KAELVLNGMVNSS++AQNNQ+QSG  LPAVTVAA PST+HRSGY    
Sbjct  61    AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180
               + MDASSIPMEFFREQFRNSSVE+RQ+LMPSP   QRH G+HHGRLMRKKTTQHCRLL
Sbjct  121   VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180

Query  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240
             PSVNKVDPSAP PELREEDAKHGVLNLVTRGFLPAYADLTPAFAGP+G ++GS GG+MKQ
Sbjct  181   PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGVMKQ  240

Query  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPEsttrrrs  300
             RATRI+DRSEQ+VR TPFTQSTGYNLA+LKFDL AP TPPPP PES       +TTRRRS
Sbjct  241   RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPPAPESSPPA--TATTRRRS  298

Query  301   vrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFsdd  360
              R+ SA  GP++VTMSFP+S    K+ RS  Q+SL+SAA+AAFTNQ +D+++NR RFS+ 
Sbjct  299   TRRGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSEQ  358

Query  361   ---dvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  417
                ++SDE+QE+DEN KDE+AEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP
Sbjct  359   PDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  418

Query  418   EFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLS  477
             EF+SFRRVAQELWGSVEEALRALE LLTQYFVPLAY DGQRLL+LA TGQPRFSKRELLS
Sbjct  419   EFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLS  478

Query  478   CIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQL  537
             CIVNE+Q+M+VLRRPGQRYKGRDRKRRAATT+QAC+RMW +RRRY RSRASD +ATKIQL
Sbjct  479   CIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQL  538

Query  538   AWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYR  597
             AWRA+SCH ALK RLRE+RRE+L+ WE +M  LK+QW QIA RRRVVVHVPSLSLDEH R
Sbjct  539   AWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSR  598

Query  598   LSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPR  657
             LSAENFAVQQNLQLTR+CA ALDSNVDLLVYV+PFELTADV  YFLKLLQLGGL DS PR
Sbjct  599   LSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPR  658

Query  658   VKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALD  717
             VK VFPEQ+ RFPAHFSLSS+LLYSPHCLRRIRHYT GK+AYLVMGLPG EDQRLAIALD
Sbjct  659   VKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALD  718

Query  718   lpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPK  777
             LPILGAPP QALPLLTRSGGKRLLIRADVNVP GTYELYDEHEL AALAKLA+AHMDQP+
Sbjct  719   LPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPR  778

Query  778   WLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGM  837
             WL+KLDYDPLGVGEAVVDLS +QAMRELRREK+TPEYWRQPGPRDAA+K++LAELERPG+
Sbjct  779   WLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGV  838

Query  838   LARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFV  897
             LARLA PMH+E+FP+WR+Y +A+ HFGCV+EAVPPT+  ASPE +++ VEPAYVRANLF+
Sbjct  839   LARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFI  898

Query  898   DPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGY  957
             DPDG+VH+TSTQNVLA+ GGGLNRKTVAFTFPQT APHEA+KGAC AAGKLLVETNVWGY
Sbjct  899   DPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGY  957

Query  958   VSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSL  1017
             VSLDFVVFQD+KS GAPRLWALAVHPFLTDSAASFACFHLLARGVLD +SG YR+A+ + 
Sbjct  958   VSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAAN-  1016

Query  1018  TTVTGRN----GSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHA  1073
             +T+   N    G G TTDLLLREASLAK + AG PRC+VVCSYVFHPHVTTMQYTAFFHA
Sbjct  1017  STLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHA  1076

Query  1074  CRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTI  1133
             CRLHGVCFDVERTLGTLFLL DSLTAGVFGVLS+GET +GALAF+RTALEVIGREAG+T+
Sbjct  1077  CRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATV  1136

Query  1134  NMvsspsrpvsgrsgNFAQVLSAVRASTGGGKSD  1167
              M +SPSRP S RSGNFAQVLSAVRASTGGGK D
Sbjct  1137  EMATSPSRPGSARSGNFAQVLSAVRASTGGGKGD  1170

>PHYRA_95901
Length=1075

 Score = 1632 bits (4225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 903/1179 (77%), Positives = 983/1179 (83%), Gaps = 106/1179 (9%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             MEKVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSA+VTTAEVQAFN
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
             AILQQTE ELR+KAELVL GMVNSS++AQ NQ+QSG  LP VTVAA PST+HRSGY    
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYG---  117

Query  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180
                  DASSIP+EFFREQF NSSVE+RQSLMPSP+ WQRH G+ HGRL+RKKTTQHCRLL
Sbjct  118   -----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLL  172

Query  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240
             PSVNKVDP+AP PELREEDAKHGVLNLVTR                +GT +GS  G+MKQ
Sbjct  173   PSVNKVDPTAPTPELREEDAKHGVLNLVTRS---------------SGTKDGS--GVMKQ  215

Query  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPEsttrrrs  300
             RATRIYDRSEQ  R+TPFTQSTGYNLA+LKFDL                           
Sbjct  216   RATRIYDRSEQPARATPFTQSTGYNLAALKFDL---------------------------  248

Query  301   vrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFsdd  360
                               +S    KN RS                  +DM+ NR     +
Sbjct  249   ------------------RSTGTGKNDRS-----------------NDDMEGNREHIDGE  273

Query  361   dvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI  420
                ++    D +  +E AEMEELGANVDKIRGYN+LLDAYSLHQFLIHKGR+MRDTPEF+
Sbjct  274   ISDEDQGGADNDKDEE-AEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFV  332

Query  421   SFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  480
             SFRRVAQELWGSVEEALRALE LLTQYFVPLAYVDGQRLL+LA TGQPRFSK ELL+CIV
Sbjct  333   SFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIV  392

Query  481   NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540
             NE+Q+MSVLRRPGQRYKGRDRKRRAATT+QAC+RMW +RRRY RSRASDI+AT+IQLAWR
Sbjct  393   NEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWR  452

Query  541   AYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA  600
             +YSCH ALKTRLREVRRE+LE+WE RM  L++QW QIA RRRVVVHVPSLSLDEH RLSA
Sbjct  453   SYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSA  512

Query  601   ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660
             ENFAVQQNLQLTR+CA ALDS+VDLLVYVSPFELTADV QYFLKLLQLGGL DS PRVK 
Sbjct  513   ENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  572

Query  661   VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpi  720
             VFPEQ+ RFP HFSLSSLLLYSPHCLRRIRHYT GKEAYLVMGLPGAEDQRLA+ALDLPI
Sbjct  573   VFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPI  632

Query  721   lgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780
             LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYDEHEL AALAKLA+AHM+QPKWL+
Sbjct  633   LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLL  692

Query  781   KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR  840
             KLDYDPLG+GEAVVDLS +QAMRELRREKRTPEYWRQPGPRDAAAK++LAELERPG+LAR
Sbjct  693   KLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLAR  752

Query  841   LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD  900
             LA PMH+E+FP WRD+ +A+GHFGCVIEAVPP  IAA+PE+S+ LVEPAYVRANLFV PD
Sbjct  753   LATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPD  812

Query  901   GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL  960
             G       +NVLA+ GGGLNRKTVAFTFPQTAAPHEA++GAC+A GKLLVET+VWGYVSL
Sbjct  813   G-------KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSL  865

Query  961   DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRV-ASKSLTT  1019
             DFVVFQDEK+ G+PRLWALAVHPFLTDSAASFACFHLLAR       GAYRV AS S+  
Sbjct  866   DFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLAR-------GAYRVAASNSMVN  918

Query  1020  VT-GRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHG  1078
                GR+GSG   DLLLREASL K +LAGAPRCFVVCSYVFHPHVTTMQY+AFFHACRLHG
Sbjct  919   ANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHG  978

Query  1079  VCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvss  1138
             VCFDVERTLGTLFLLADSLTAGVFG+LS+GET EGALAFLRTALEVIGRE G+TI M  +
Sbjct  979   VCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEM--A  1036

Query  1139  psrpvsgrsgNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177
              SRPVS R+GNFAQVLSAVRASTGGGK DRLGKM+R RR
Sbjct  1037  TSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075

>PHALS_06477
Length=1166

 Score = 1460 bits (3779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/1184 (68%), Positives = 915/1184 (77%), Gaps = 47/1184 (4%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             MEKVQQ  HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+++T AEVQAF+
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
             A+LQQTE+ELR+KAELVLNG++NSSN+  N+Q Q    LPAV+VAA    KHR G + A+
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  121   K---PRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHC  177
             +     ++D +S  MEFFR+QFRN+ VEIRQSLM SPE W+R  G    R +RKKTTQH 
Sbjct  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192

Query  178   RLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGI  237
             RLLP VNK DPS P P+LREEDA  G+LNLVTRGFLPAYADLTPAFAGPNG SNGS G  
Sbjct  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252

Query  238   MKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPEsttr  297
             +K RAT IYDRS+++ R TP   S G+NLA LKFD                         
Sbjct  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDF------------------------  288

Query  298   rrsvrkssAVQGPNR---VTMSFPKSG-NKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNN  353
              R+    S+   PN    V+ S P +  + +  + S+      S  VAA  NQ ED++NN
Sbjct  289   -RTSSTPSSAPKPNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENN  347

Query  354   RGRFsdddvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTM  413
                  +D   +E  ++ +  KDE    ++L  NV KIR YN+L+DAYSLHQ LI+KGR +
Sbjct  348   CTHSFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAI  407

Query  414   RDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKR  473
             RDTPEF SFRRV  +LWGSVEE LRALEA+L QYFVPLA+VDGQRL+ALA T QP+FS+R
Sbjct  408   RDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRR  467

Query  474   ELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINAT  533
             ELLSCIVN++Q+MSVLRRPGQRY GRDRK RAATT+QAC RMW+V  RY +SR+S+INA 
Sbjct  468   ELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAI  527

Query  534   KIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLD  593
             KIQ A+RAYS  TALK RLRE+R EK  KWE RM   KSQWSQIAARRR+VVHVPS+SL 
Sbjct  528   KIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLG  587

Query  594   EHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVD  653
             EH RL+AENFAVQQNLQLTR+CA ALD  VDLLVYVSP+ELTADV QYF KLLQL G  D
Sbjct  588   EHSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPAD  647

Query  654   SGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLA  713
             S PRVKFV+PEQ+ RFPAHFSLSSL+LYSP+CLRRIRHYT G EAYLVMGLPG EDQRLA
Sbjct  648   SRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLA  707

Query  714   IALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHM  773
             I LDLPILGA P+QALPLLTRSGGKRLLI+AD+NVP GTYELYDEHE+  ALAKLA+AH+
Sbjct  708   ITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHI  767

Query  774   DQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELE  833
             DQ KWLIKLDYDPLGVGEAVVDLS++QAMREL REKRTPEYWRQPG RDAAA + L E E
Sbjct  768   DQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFE  827

Query  834   RPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRA  893
             RPG LARL  P+H+E++PTWR+Y  A+GHFGCVIEAVPPTA AAS E      EP Y+RA
Sbjct  828   RPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASME------EPTYLRA  881

Query  894   NLFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETN  953
             N+FVDP+G+VH+TSTQNVL T  GGL+RK+  F FPQT APH AIKGACNA GK L ETN
Sbjct  882   NIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETN  941

Query  954   VWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRV-  1012
             VWGYVSLDFVVFQD KSN A RLWALA+HPFLT+SAA+FACFHLL RG LD NSG YRV 
Sbjct  942   VWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVP  1001

Query  1013  ASKSLTTVTGRNGSGC--TTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAF  1070
              +K L T      SG     DLLLREASL K    GA RC+VVCSYVFHP+VT  QYT F
Sbjct  1002  GTKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTF  1061

Query  1071  FHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAG  1130
             F  CRLHGVCFDV R LGTLFLLADSLTAGVFG+LSIGET + AL++LRTALEVIGREAG
Sbjct  1062  FQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAG  1121

Query  1131  STINMvsspsrpvsgrsgNFAQVLSAVRASTGGGKSDRLGKMQR  1174
             +T  +    S       GNFA VLS VRASTGGG S+RLG++ R
Sbjct  1122  ATKGI---VSSSSRSVLGNFADVLSTVRASTGGGSSNRLGQVHR  1162

>PHYCA_34475
Length=692

 Score = 1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/722 (84%), Positives = 647/722 (90%), Gaps = 30/722 (4%)

Query  391   RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVP  450
             RGYNELLDAYSLHQFLIHKGRTMRDTPEFISF RVAQELWGSVEEALRALE LLT YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  451   LAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQ  510
             LAYVDGQRLL+LA TGQPRFSKRELLSCIVNE+Q+M+ LRRPGQRYKGRDRKRRAATT+Q
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  511   ACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTL  570
             A +RMW  RRRYARSRA DINAT+IQLAWRAYSCH ALK RLREVRRE+LEKWE RM  L
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  571   KSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVS  630
             KSQW+QIA+ RRVVVHVPSLSLDE+ RLSAEN AV+QNLQLTR+CA ALDS VDLLVYVS
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  631   PFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIR  690
             PFELT DV QYF+KLLQLGGL DS PRVK +FPEQ+TRFPAHFSLSSLLLYSPHCLRRIR
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  691   HYTTGKEAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPN  750
             HYT GKEAYLVMGLPGAEDQRLA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  751   GTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKR  810
             GTYELYDEHEL +ALAKLA+AHMDQPKWL KLDYDPLGVGEAVVDLS +QAMRELRREKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  811   TPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAV  870
             TPEYWRQPGPRDAAAK++L ELERPG LARLA P+H ++FP+W ++ +A+GHFGCVIEAV
Sbjct  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  871   PPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQ  930
             P TAIA +PE STAL+EPAY+RANLFVDPDGSVHVTST N+LATGGGGLNR+TVAFTFPQ
Sbjct  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  931   TAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAA  990
             TAAPHEA+KGAC+AAGKLLVETNVWGYVSLDFVVFQD+KSNGAPRLWALAVHPFLTDSAA
Sbjct  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  991   SFACFHLLARGVLDTNSGAYRVASKSLTTVTGRNGSGCTTDLLLREASLAKDSLAGAPRC  1050
             SFACFHLLARGVLD NSG YR+A+                              A  PRC
Sbjct  601   SFACFHLLARGVLDANSGVYRMAA------------------------------ASTPRC  630

Query  1051  FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET  1110
             FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET
Sbjct  631   FVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGET  690

Query  1111  ME  1112
              E
Sbjct  691   TE  692

>PYIR_13453
Length=1186

 Score = 1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/1231 (50%), Positives = 818/1231 (66%), Gaps = 100/1231 (8%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRH-SAIVTTAEVQAF  59
             M++ QQQ HVEDVGR+LLQTQEQLR+MREQM A +       S MR  S+  +  +V AF
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPS---SSMRFASSGASQPDVLAF  57

Query  60    NAILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAA----LPSTKHRSG  115
               ILQ+ E E+R+KAELVLNG VN+S+ A          LP V+ +A     P  + R  
Sbjct  58    QEILQRAEVEIRAKAELVLNGFVNTSSQASA--------LPTVSSSANGNASPKARLRQN  109

Query  116   YNGANKPRQMD--ASSIP-MEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKK  172
                    R+    AS  P +++FR +F N +VE   S +  P P QR   +  G+L++KK
Sbjct  110   VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPV-LPSPVQR---ITKGQLVKKK  165

Query  173   TTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNG  232
               Q+ RLLPSVNK DPSAP PEL E+DAK G+L+LV RGFLP  ADLTPAF   +G+   
Sbjct  166   MAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGS---  222

Query  233   SCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPP  292
                 I+K   TRIYDR EQ +RS P T  +G+N+ASLKFD+  P T       S    P 
Sbjct  223   ----IIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPS  278

Query  293   EsttrrrsvrkssA-----------------VQGPNRVTMSFPKSGNKVKNSRSAHQTSL  335
                T   +   S                    +G   VT++F   G+ V+ +  A   S+
Sbjct  279   LQRTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNF--QGDAVRGNLQASVGSV  336

Query  336   MSAAVAAFTNQGEDMDNNRGRFsdddvsdedqendenGKDEDAEMEELGANVDKIRGYNE  395
              +AA+ + T+Q ++ ++      D+  S  +   D++  D  A M+EL  NV+KIRGYNE
Sbjct  337   TAAAMLS-TDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSA-MDELRKNVEKIRGYNE  394

Query  396   LLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVD  455
             LLD YSLHQF+IHKGR MR+TPEF+SF+RVAQE+WGSVEE +RALEALLT+YFVPLAY+D
Sbjct  395   LLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYID  454

Query  456   GQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRM  515
             GQRL+ +A      FSKR+LLSCIVNEDQ+ S++RRPGQRYKG+DRKRRAA T+Q   RM
Sbjct  455   GQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRM  514

Query  516   WLVRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWS  575
             W  +++Y R R    +   IQ  WRA++ H +LK +L+  R ++ E+WE +M  LK  W+
Sbjct  515   WWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWT  574

Query  576   QIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELT  635
              I   RRVV+HVPSLS+DE  R+SA+NF+V+QN+QL+R+C + +D NVD+ VYVSPFELT
Sbjct  575   HIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGL-IDPNVDI-VYVSPFELT  632

Query  636   ADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTG  695
             ADV QY +KLLQLGG+ D   RVK V+PEQ+ RFPAHFSL++LLLYSPHCLRRI+ Y   
Sbjct  633   ADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRN  692

Query  696   KEAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYEL  755
             KEAYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +RADVNVP GTY++
Sbjct  693   KEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDI  752

Query  756   YDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYW  815
             YDE EL  +LAKL ++H++Q  W++K+DYDP G G A++D+S +  +RE+RREK++PEYW
Sbjct  753   YDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYW  812

Query  816   RQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAI  875
             +QP  RD AA+ I+AELER   LA L  P+H E++P+W++++DA+  FG V+EA P   I
Sbjct  813   KQPSTRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVI  870

Query  876   AASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLAT-------------GGGGLNRK  922
                           +VRANLF++P G VHV+STQ+++ T               G    K
Sbjct  871   -------------GHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSK  917

Query  923   TVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVH  982
             TV + FPQTAAP+EAI+GA  A GKLL +  V+GY S+D++VFQ++K++ A RLWA+A+H
Sbjct  918   TVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALH  976

Query  983   PFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV-------------TGRNGSGCT  1029
             P+LTDSA++FA FHLL RG L+ +SG Y +   + +                        
Sbjct  977   PYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSA  1036

Query  1030  TDLLLREAS---LAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERT  1086
              DL+++EA+   L     AGA R +VV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER 
Sbjct  1037  ADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERC  1096

Query  1087  LGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvsspsrpvsgr  1146
             +G++FLLADSLTAGVFG++   ++  GAL FLRTALEVIGRE G T  ++          
Sbjct  1097  VGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESE  1155

Query  1147  sgNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177
             +GNFA VL+ +RA T GGKS +L K++R RR
Sbjct  1156  TGNFADVLAVIRALT-GGKSAKLEKIRRLRR  1185

>PYIW_18793
Length=997

 Score = 998 bits (2580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/1040 (53%), Positives = 707/1040 (68%), Gaps = 83/1040 (8%)

Query  175   QHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSC  234
             QH RLLPSVNK DPSAP PEL E+DAK+G+L+LV RGFLP   DLT AF         S 
Sbjct  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVN-------SH  55

Query  235   GGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDL-----CApptppppipESKDL  289
             GGI++   TRIYDR EQ +R+ P T  +G+N+A+LKFDL     C          + K  
Sbjct  56    GGIIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115

Query  290   MPPEsttrrrsvrkssAVQGPNRVTMSF---PKSGNKVKNSRSA--------HQTSLMSA  338
             +   + ++       +  +GPN +T+SF    + GN     RSA        H  S    
Sbjct  116   LAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQE  175

Query  339   AVAAFTNQGEDMDNNRGRFsdddvsdedqendenGKDEDAE-MEELGANVDKIRGYNELL  397
             A +  TN  ED+  +                    KD+DA  M+EL  NV+KIRGYNELL
Sbjct  176   AESPETNVDEDLMYDE-------------------KDDDANAMDELRKNVEKIRGYNELL  216

Query  398   DAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQ  457
             D YSLHQF+IHKGR MR+TPEF+SF+RVAQE+WGSV+E ++ALEALLT+YFVPLAYVDGQ
Sbjct  217   DTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQ  276

Query  458   RLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWL  517
             RL+ +A      +SKR+LLSCIVNEDQ+ S++RRPGQRYKG+DRKRRAA T+Q   RMW 
Sbjct  277   RLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWW  336

Query  518   VRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQI  577
              +++Y+R R    +   IQ  WR Y+ H  LK R++  R ++  +WE +M  LK  W +I
Sbjct  337   NQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRI  396

Query  578   AARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTAD  637
                RRVV+HVPS S+DE  RLSA+NF+V+QNLQL+R+C + +DSNVD+ VYVSPFELT D
Sbjct  397   KGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNVDI-VYVSPFELTTD  454

Query  638   VLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKE  697
             V+QY +KLLQLGG+ D   RVK VFPE + RFP HFSL++LLLYSPHCLRRI+ Y   KE
Sbjct  455   VVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKE  514

Query  698   AYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYD  757
             AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +RADVNVP GTY++YD
Sbjct  515   AYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYD  574

Query  758   EHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQ  817
             E EL  +LAKL ++H++Q  W++K+DYDP   G A++D+S + A+RE+RREKR+PEYWRQ
Sbjct  575   EDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQ  634

Query  818   PGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAA  877
             PG RD AA++I+AELER   L  L  P+H E++P+W+DY DA+  FG V+EA P   +  
Sbjct  635   PGTRDNAARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVV--  690

Query  878   SPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVL--------ATGGGGLNRKTVAFTFP  929
                         +VRANLFV+P G VHV+STQ++L           GG    K+V + FP
Sbjct  691   -----------GHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFP  739

Query  930   QTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSA  989
             QTAAP+EAI+GA  A GKLL E NV+GY S+DF+VFQ++KS+ A RLWA+A+ P+LTDSA
Sbjct  740   QTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSA  798

Query  990   ASFACFHLLARGVLDTNSGAYRVASKSLTTVT---------GRNGSGCTTDLLLREAS--  1038
             A+F  FHLL RG L+T SG Y + + ++T+ +                  DL+L EA+  
Sbjct  799   ATFTTFHLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAAFASGASAADLVLHEATHS  858

Query  1039  -LAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSL  1097
              L      GA   +VV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++FLLADSL
Sbjct  859   GLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSL  918

Query  1098  TAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvsspsrpvsgrsgNFAQVLSAV  1157
             TAGVFG++   +T  GAL FLRTALEV+GRE G T  +    +      +GNFA VL+A+
Sbjct  919   TAGVFGLMCCSDTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAI  977

Query  1158  RASTGGGKSDRLGKMQRRRR  1177
             RA T GGKS +L K++R RR
Sbjct  978   RALT-GGKSAKLEKIRRLRR  996

>PYAP_17746
Length=1169

 Score = 929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/1178 (46%), Positives = 743/1178 (63%), Gaps = 87/1178 (7%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             ME++QQ+ HVEDVGR+LLQTQ+QLR +REQ+  +         P   S I +        
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSN-------GPGNGSVIASNNAGAEIE  53

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
              ILQ+ E ELR KAELVL+ +V +   +     + G  +P  TV   P  +         
Sbjct  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIAR-----RRRR  108

Query  121   KPRQMDASS--IPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFG---VH-HGRLMRKKTT  174
             K    D  S  + +E+FR++F+ ++V+   S M +  P QR  G    H HG++++ KTT
Sbjct  109   KAELHDGGSYDLDIEYFRQRFKRTAVDDASSTMTT-APRQRGGGPTPTHAHGKVVKHKTT  167

Query  175   QHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNG-TSNGS  233
              + RLLP VNK DP+AP P L   DAK GVL+L+ RGFLP   DLTPAF   +   S G+
Sbjct  168   SNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGN  227

Query  234   CGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPE  293
                +++  + +++ R EQ VR+T ++    +NLA+LKFD+ A  T      E++ + P +
Sbjct  228   PTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAA--ENRSIEPHD  285

Query  294   sttrrrsvrkssAVQGPNRVTMSFPKSGNKV---KNSRSAHQTSLMSAAVAAFTNQGEDM  350
              +           ++    VT+SF    ++     N+R +               + ED+
Sbjct  286   ESEAL-------PLRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDL  338

Query  351   DNNRGRFsdddvsdedqendenGKDEDAE-MEELGANVDKIRGYNELLDAYSLHQFLIHK  409
             D                       DE A  ME+L  NV+KIRGYNELLDAYSLHQF+IHK
Sbjct  339   D--------------------VTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHK  378

Query  410   GRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPR  469
             GR +RDTPEF SF+RVAQE+WGS+EE ++ALE LLT+YFVPLAY+DGQRL+ LA     +
Sbjct  379   GRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAK  438

Query  470   FSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASD  529
              S  ELL+C+VNEDQ+ S++RRPGQRYKG+DRKRRAATT+QA  RM L R R+ + R + 
Sbjct  439   LSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNG  498

Query  530   INATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPS  589
              +A  IQ  WR+Y+C  +L+ RL  VR E+L +W+ ++  ++SQW  I  +RRVV+HV S
Sbjct  499   SSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVAS  558

Query  590   LSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLG  649
             +S+DE  RLS ENF+V+QNLQL+R+  + +D NV+ +VYV+PFEL+ +V QYF+KLLQL 
Sbjct  559   ISVDERTRLSMENFSVKQNLQLSRLAGL-VDQNVE-IVYVTPFELSTEVSQYFIKLLQLS  616

Query  650   GLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAED  709
             G+ ++  RV+ VFPE + +FP HFSL++ L+YSP+C+RRI+    GKEAYLVMG+PG ED
Sbjct  617   GIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPED  676

Query  710   QRLAIALDl-pilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKL  768
             QRLA+AL +  +    P   LPL+TRSG KR  I+ADVNVP GTY++YD  EL  +LAKL
Sbjct  677   QRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKL  736

Query  769   AIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMI  828
              I+H++Q  WL+KLD DPLG G A++D+S +  +R++RREKR PEYW+QPG RD  A+ +
Sbjct  737   IISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARAL  796

Query  829   LAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEP  888
             L ELER   +  L  P H E+F +W+++  A+  FG V+EA+P                 
Sbjct  797   LQELERE--IGSLLKPSHPEIFASWKEFASAIPEFGVVVEALP-------------FHVA  841

Query  889   AYVRANLFVDPDGSVHVTSTQNVLATGGGGLN---RKTVAFTFPQTAAPHEAIKGACNAA  945
               +R N+F++P G VHV ST +VL+  G  L+   R+  AF FPQT  PHEAI GA +A 
Sbjct  842   GVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAV  901

Query  946   GKLLVETNVW-GYVSLDFVVFQDE---KSNGAPRLWALAVHPFLTDSAASFACFHLLARG  1001
             G++L E + + GY S+D  + Q+E     + A RLWA+++ P+LTDSAA+FA FH L RG
Sbjct  902   GRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRG  961

Query  1002  VLDTNSGAYRVASKSLTTVTGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPH  1061
             VL+  +G Y         +T R  +   +D  L  + +      GAPR + V  YVFHP+
Sbjct  962   VLNPATGRY--------NLTARESTPPESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPN  1013

Query  1062  VTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTA  1121
             V+ M Y AFFH CRLHGVCFDVER +G++FLLADSLTAG+FGVLS GE+   AL +LRTA
Sbjct  1014  VSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTA  1073

Query  1122  LEVIGREAGS-TINMvsspsrpvsgrsgNFAQVLSAVR  1158
              EVIGRE G+ ++    S        SGNFA++L  +R
Sbjct  1074  FEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGLLR  1111

>PYU1_G001734
Length=800

 Score = 890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/818 (56%), Positives = 606/818 (74%), Gaps = 40/818 (5%)

Query  380   MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealra  439
             M++L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEF+SF+RVAQE+WG VEE ++A
Sbjct  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  440   leallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGR  499
             LE LLT+YFVPLAYVDGQRL+ +A      FSK++LLSCIVNEDQ+ S++RRPGQRYKG+
Sbjct  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  500   DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrevrrek  559
             DRKRRAA T+Q   RMW  +++Y+R R    +   IQ  WRAY+ H  L+ +L+  R+++
Sbjct  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  560   lekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVAL  619
              E+WE RM  L+ +W +I A RRV++HVPSLS+DE +R+ A+NFAV+QNLQL+R+C + +
Sbjct  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-I  239

Query  620   DSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLL  679
             D+NVD+ VYVSPFELT++V QYF+KLLQLGG+ D   RVK VFPEQ+TRFPAHFSL+++L
Sbjct  240   DANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVL  298

Query  680   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKR  739
             LYSPHCLRRIR    GKEAYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR
Sbjct  299   LYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKR  358

Query  740   LLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNI  799
               +RADVNVP GTY++YDE EL  +LAKL ++H++Q  WL+K+DYDP G G A+VD S +
Sbjct  359   FFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVV  418

Query  800   QAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDA  859
              A+RE+RREK++PEYWRQPG RD AA+MI+AELER   + +L  P+H E++PTW+++ DA
Sbjct  419   TALREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADA  476

Query  860   VGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGL  919
             +  FG VIEA P   +              Y+RANLFV+P G VHV+STQ+V+ +     
Sbjct  477   IAQFGVVIEAAPSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIH  523

Query  920   NRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWAL  979
              RK   + FPQT AP+EAI+GA  A GK+LV+ +V+GY S+D++VF+++K++  PRLWA+
Sbjct  524   KRKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAM  582

Query  980   AVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV-----------------TG  1022
             A+HP+LTDSA++FA FHLL RG L+ ++G Y + + + + V                 T 
Sbjct  583   ALHPYLTDSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTR  642

Query  1023  RNGSGCTTDLLLREAS---LAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGV  1079
               GS  + +L+L+EA+   L     AGA R + V  Y+FHP+V+TMQY++FFH CRLHGV
Sbjct  643   AAGSATSANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGV  702

Query  1080  CFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvssp  1139
             CFDVER  GT+F+LADSLTAGVFG++  G+T   AL FLRTALEVIGRE G T  +    
Sbjct  703   CFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDL  761

Query  1140  srpvsgrsgNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177
                    SGNFA+VL+ VR  T GGKS +L K++R RR
Sbjct  762   RGGGDCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLRR  798

>H310_09212
Length=1113

 Score = 712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/1211 (38%), Positives = 688/1211 (57%), Gaps = 135/1211 (11%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
             MEK+ QQ H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43

Query  61    AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
             AIL++ E +LR+KAE+VLNG+VN+S             LPA+        ++ S ++   
Sbjct  44    AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAIDAPG--GQRYLSKFSSKL  91

Query  121   KPRQMDASSIPMEFFREQF-----RNSSVEIRQSLMPSPEPWQRHFG---------VHHG  166
               ++  A+++  E   E        ++S     SL    EP +R            V  G
Sbjct  92    AQKRDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAG  151

Query  167   RLMRKKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGP  226
              L++ KTT+  R+LP +N++DP+AP P L ++DA+ GV NL+TRGFLP   D+TPAF   
Sbjct  152   SLVKHKTTKPRRILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAFT--  209

Query  227   NGTSNGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApp---tppppi  283
             +GTS      +++    +IYDR+ Q V+S P+T  +G+N+ASLKFD+  P        PI
Sbjct  210   HGTS------VIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPI  263

Query  284   pESKDLMPPEsttrrrsvrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAF  343
              +  D+ P +++              P  + ++F    N                AV   
Sbjct  264   NQGGDIPPSKTSI-------------PTPIDITFDGHANN---------------AVPFR  295

Query  344   TNQGEDMDNNRGRFsdddvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLH  403
               Q +  ++  G+       D    +D  G ++   +  L  NV+KIRGYNELLD YSLH
Sbjct  296   PEQPKGGNDPSGK-------DCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLH  348

Query  404   QFLIHKGRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALA  463
             QF+I KG+T+ DTPEFISF+R  ++LWGSV ++++ LEA+LT Y VPLAYVDGQ+L+ +A
Sbjct  349   QFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIA  408

Query  464   GTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYA  523
                       ELLSCI+N D++ S++RRPGQR+KG+     AA  +Q+  RM++ ++R  
Sbjct  409   AMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLK  468

Query  524   RSRASDINATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRV  583
                 ++ +A  IQ  +R+Y C + L+ RL+ VR   L  W+ +M   ++ W  I  +RRV
Sbjct  469   NHHGNE-DAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRV  527

Query  584   VVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFL  643
             VVHVPS S +E  RL  ENF++QQNLQ+ R+CA+A D NVD+ +Y+SPFEL+ D+ +Y +
Sbjct  528   VVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVDI-IYISPFELSPDIQKYQV  585

Query  644   KLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMG  703
             +LLQLGG+ D   R++ + PE   RFP HFSL+++LLYSPHCL++I+ +  GK+AY+V G
Sbjct  586   RLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTG  645

Query  704   LPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCA  763
               G ED+RLAIAL LP+LG  P +AL   TRSGGKR+ + ADVN+P G +++YDE EL  
Sbjct  646   NVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQ  705

Query  764   ALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKR-----TPEYWRQP  818
             +L+KL  A +DQ +WLIK+D D    G A +++  +Q++ + R EKR       EY++QP
Sbjct  706   SLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQP  765

Query  819   GPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAAS  878
               RDA  + + +EL      A +  P   EM+ +W          G VIEA P   +   
Sbjct  766   DVRDAVLRSVYSELNESYFAANV-TPCFPEMYASWAAMRPIALRVGVVIEAYPSKVL---  821

Query  879   PEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGLNRK-TVAFTFPQTAAPHEA  937
                       ++VR N+F++P G VH+TS  +V       +N+       FPQ++ P++A
Sbjct  822   ----------SHVRTNIFIEPSGGVHITSAHDVFMC---PVNKHLPQCAVFPQSSVPYQA  868

Query  938   IKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS--NGAP--RLWALAVHPFLTDSAASFA  993
             I+GA  A    +    + GY S+D++ F D K+  +G P  RLWA+ V P LT++A SF 
Sbjct  869   IRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFV  928

Query  994   CFHLLARGVLDTNSGA--YRVASKSLTTVTGRNGSGCTTD-----LLLREASLAKDSLAG  1046
              F  L+    +  +G    +VA   + T++  N     T      +L   +S A  S+ G
Sbjct  929   MFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILSPPSSAAAASVCG  988

Query  1047  APRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLS  1106
               R ++V  Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  ++LADSLTAGV G++ 
Sbjct  989   PERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLIC  1048

Query  1107  IGETMEGALAFLRTALEVIGREAGSTINMvsspsrpvsgrsgNFAQVLSAVRASTGGGKS  1166
             IGE+ + A    R A+E+IG + G    + + P+     R GNF  +L+ VR      KS
Sbjct  1049  IGESDKEAFRIARQAVELIGDQVG----VQALPNSLSGERLGNFPHLLAIVR-----NKS  1099

Query  1167  DRLGKMQRRRR  1177
             D      RR+R
Sbjct  1100  DDPAAADRRKR  1110

>SPRG_06354
Length=884

 Score = 634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/933 (41%), Positives = 543/933 (58%), Gaps = 83/933 (9%)

Query  238   MKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipESKDLMPPEsttr  297
             M+    R+YDRSEQ V+S P+  S+G+N+ASLK DL  PPT         D +PP     
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPT-------EPDAVPPTRPAV  53

Query  298   rrsvrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRF  357
              R  + + A      V +SFP + +++ ++                    ED   + G  
Sbjct  54    ARKRKSTVAT-----VQLSFPGAKDELVDAVPV-----------------EDPATDDGPI  91

Query  358   sdddvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  417
                              +    ++EL  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TP
Sbjct  92    -----------------EPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETP  134

Query  418   EFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLS  477
             EFISF+R+ ++LWGSV  A+R LE LL  Y VPLAY+DGQ+LL +A       SK ELL+
Sbjct  135   EFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLT  194

Query  478   CIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQL  537
             C++N D++ + + RPGQR+KG D +  AA  +Q+  RM   RR   R       AT IQ 
Sbjct  195   CVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRR-LLRQHHGHSYATHIQR  253

Query  538   AWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYR  597
              +R Y C   ++ +LR  R      WE +M T  + W +I  +RRVVVHVPS S +E  R
Sbjct  254   VYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERAR  313

Query  598   LSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPR  657
             L+ +NFA++QNLQ+ R+CA+A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D   R
Sbjct  314   LNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSR  371

Query  658   VKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALD  717
             V+ + PE + RFP HFSL+++LLYSPHCL++I+ Y  GKEAY+V G  G ED+RLAI L 
Sbjct  372   VRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQ  431

Query  718   lpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPK  777
             LP+LG  P +AL   TRSG KRL  +ADVN+P G +++YDE EL  +LAKL  A++ Q  
Sbjct  432   LPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGM  491

Query  778   WLIKLDYDPLGVGEAVVDLSNIQAMRELRREKR---TPEYWRQPGPRDAAAKMILAELER  834
             WLIKLD DP   G A +D+  ++ + ++R EKR     EY+ QP  ++   + I+AEL  
Sbjct  492   WLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSE  551

Query  835   PGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRAN  894
                  RL +P   +++PTW+     V   G VIEA PP  +A              VRAN
Sbjct  552   --QFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLAR-------------VRAN  596

Query  895   LFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNV  954
             +F++P G VHVTS Q  L         ++V   +P TA P+ AI+GA  A  + +  + +
Sbjct  597   VFIEPSGGVHVTSAQEQLMHVKN--KHQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGI  654

Query  955   WGYVSLDFVVFQDEKS----NGAP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNSG  1008
              GY S+D+V F D K+     G P  RLWAL + P LT +A SF  F  L+   LD  +G
Sbjct  655   IGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG  714

Query  1009  AYRVASKSLTTVTGRNGSGCTTDLLLREASLAKDSLA---GAPRCFVVCSYVFHPHVTTM  1065
                +   +    +   G   T   L  E  L + S A   GA R ++   Y+FHP++ T+
Sbjct  715   RSFLPLPA-PRPSSLAGPPATETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATL  773

Query  1066  QYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVI  1125
             QY  FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+I
Sbjct  774   QYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELI  833

Query  1126  GREAGSTINMvsspsrpvsgrsgNFAQVLSAVR  1158
             G + G    +  +P      R GNFA VL A+R
Sbjct  834   GDQVG----VQPAPDALTGERLGNFAAVLGAIR  862

>SDRG_01764
Length=1092

 Score = 613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/798 (44%), Positives = 490/798 (61%), Gaps = 48/798 (6%)

Query  380   MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealra  439
             ++EL  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEFISF+R+ ++LWGSV  A+R 
Sbjct  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368

Query  440   leallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGR  499
             LE LL  Y VPLAY+DGQ+LL +A       SK ELL+C++N D++ + + RPGQR+KG 
Sbjct  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428

Query  500   DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrevrrek  559
             D +  AA  +Q+  RM L RRR  R       A+ IQ  +R Y     ++ +LR  R   
Sbjct  429   DSRHAAAILLQSVYRMHLTRRRL-RQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREAD  487

Query  560   lekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVAL  619
                WE +M    + W +I  +RRVVVHVPS S +E  RL+ +NFA++QNLQ+ R+CA+A 
Sbjct  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-  546

Query  620   DSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLL  679
             D NVD+ +Y+SPFEL+AD+ +Y ++LLQLGG+ D   RV+ + PE + RFP HFSL+++L
Sbjct  547   DPNVDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  605

Query  680   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKR  739
             LYSPHCL++I+ Y  GKEAY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KR
Sbjct  606   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  665

Query  740   LLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNI  799
             L  +ADVN+P G +++YDE EL  +LAKL  A++ Q  WLIKLD DP   G A +D+  +
Sbjct  666   LFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHAL  725

Query  800   QAMRELRREKR---TPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDY  856
             + + ++R EKR     EY+ QP  ++   + I+AEL       RL +P   +++PTW+  
Sbjct  726   ECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  783

Query  857   IDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGG  916
                V   G VIEA PP  +             A VRAN+F++P G VH+TS Q  L    
Sbjct  784   RPVVNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAK  830

Query  917   GGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS----NG  972
                  ++V   +P T  P+ AI+GA  A  + +  + + GY S+D+V F D K+     G
Sbjct  831   N--KHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888

Query  973   AP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTVTGRNGSGCTT  1030
              P  RLWAL + P LT +A SF  F  L+   LD  +G      +S       + S  T 
Sbjct  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG------RSFLPQPAPHPSPATG  942

Query  1031  DLLLREASLA---------KDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCF  1081
              L + E  LA         + S  G  R ++   Y+FHP++ T+QY  FF+ CR+HGV F
Sbjct  943   QLPVTETQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSF  1002

Query  1082  DVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvsspsr  1141
             D+++++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+IG + G    +  +P  
Sbjct  1003  DLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDA  1058

Query  1142  pvsgrsgNFAQVLSAVRA  1159
                 R GNFA VL A+R+
Sbjct  1059  LTGERLGNFAAVLGAIRS  1076

 Score = 179 bits (454),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/277 (40%), Positives = 156/277 (56%), Gaps = 30/277 (11%)

Query  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
            M+++ QQ HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43

Query  61   AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
            AIL++ E +LRSKAE+VLNG+VN++          G   P+V+  +    K R   +   
Sbjct  44   AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103

Query  121  KPRQMD---ASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHC  177
            +   +D     S P+E  R+Q     V + +   P   P  R   V  GRL++KK T   
Sbjct  104  RDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQV--GRLIKKKVTGPQ  161

Query  178  RLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGI  237
            RLLP VN++DP AP P+L ++DAK GVLNLV RGF+P  ADL+ AF      ++G   GI
Sbjct  162  RLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF------THGD--GI  213

Query  238  MKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLC  274
            ++    R+YDRSEQ V+S P+  S+ +N+ASLK DL 
Sbjct  214  IQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLA  250

>H257_06305
Length=1099

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/817 (40%), Positives = 488/817 (60%), Gaps = 44/817 (5%)

Query  376   EDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVee  435
             + + +  L  NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEFISF+R  ++LWGSV  
Sbjct  307   DSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVST  366

Query  436   alraleallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQR  495
             +++ LE +LT Y VPLAYVDGQ+L+ +A          ELLSCI+N D++ S++RRPGQR
Sbjct  367   SIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQR  426

Query  496   YKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrev  555
             YKG      A   +Q+  RM+L ++R      ++ +A  IQ  +R+Y C + L+ RL+ V
Sbjct  427   YKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNE-DAAVIQRIYRSYRCFSQLQQRLKLV  485

Query  556   rreklekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVC  615
             R   L  W+ +M   ++ W  +  +RRVVVHVPS + D+  RL  +NF+++QNLQ+ R+C
Sbjct  486   READLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMC  545

Query  616   AVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSL  675
             A+A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D   R++ + PE   RFP HFSL
Sbjct  546   AIA-DPNVDI-IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSL  603

Query  676   SSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRS  735
             ++LLLYSPHCL++I+ +  GK AY+V G  G ED+RLAIAL +P+LG  P +AL   TRS
Sbjct  604   TTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRS  663

Query  736   GGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVD  795
             GGKR+ + ADVN+P G +++YDE EL  +L+KL  A +DQ +WL+K+D D    G A ++
Sbjct  664   GGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASIN  723

Query  796   LSNIQAMRELRREKR-----TPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMF  850
             +  +Q++ ++R EKR       EY++QP  RDA  + I  EL      A +  P   +++
Sbjct  724   VQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANI-TPCFPDVY  782

Query  851   PTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQN  910
              +W +        G VIEA P   ++              VRAN+F++P G VH+TS  +
Sbjct  783   ASWAELRPVALRVGVVIEAYPSKVLSQ-------------VRANVFIEPSGGVHITSAHD  829

Query  911   VLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS  970
             +  +             FPQT+ P++AI+GA  A    +    + GY S+D++ F D K+
Sbjct  830   LFMSPAN--KHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKT  887

Query  971   ---NGAP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRV------ASKSLTT  1019
                 G P  RLWA+ V P LT++A SF  F  L+    +  +G   +         +  T
Sbjct  888   LVGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASAT  947

Query  1020  VTGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGV  1079
             V     +    + +L         + G  R ++V  Y++HP++ T+ ++ FF+ CRL+GV
Sbjct  948   VAPITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGV  1007

Query  1080  CFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvssp  1139
              FD++R +G  F+LADSLTAGV G++ IGE  + A    R A+E+IG + G    + + P
Sbjct  1008  SFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG----VQALP  1063

Query  1140  srpvsgrsgNFAQVLSAVRASTGGGKSDRLGKMQRRR  1176
                   R GNF  +L+ VR      KSD     ++RR
Sbjct  1064  DSLSGERLGNFPHLLAIVR-----NKSDDPADRRKRR  1095

 Score = 166 bits (419),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 155/283 (55%), Gaps = 46/283 (16%)

Query  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
            M+K+ QQ H EDVGR+LLQ Q++LR MRE++                       +V   N
Sbjct  1    MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEK-----------------NNVDVNEIN  43

Query  61   AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
            AIL++ E +LR+KAE+VLNG+VN+S             LPA+      ++  +     A 
Sbjct  44   AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAIEAPGGKTSLSKFSSKLAQ  93

Query  121  KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSP-EPWQRHFG---------VHHGRLMR  170
            K R++ A+      +         E R+     P EP +R            +  G L++
Sbjct  94   K-RELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVK  152

Query  171  KKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTS  230
            KKTT+  RLLP +N+ DP+AP+P+L EEDA+ GV NLVTRGFLP   D+TPAF   +GTS
Sbjct  153  KKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT--HGTS  210

Query  231  NGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDL  273
                  +++    +IYDR+ Q V+S P+T  +G+N+ASLKFD+
Sbjct  211  ------VIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247

>CCA18898
Length=1147

 Score = 569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/1159 (33%), Positives = 629/1159 (54%), Gaps = 123/1159 (11%)

Query  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaa---aveanaSPMR--HSAIVT---  52
             ME+V+Q+ H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  53    TAEVQAFNAILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTV---AALPS  109
             + +++  + IL + E E+++K +L+  G  N     Q         LPAVT        +
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTG-------LPAVTSPPRQVSTT  138

Query  110   TKHRSGYNGANKPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPE-PWQRHFGVHHGRL  168
             TK  S    + +  ++D +   +   ++ ++  S  ++QS + SP+ P Q   G+   + 
Sbjct  139   TKSLSDQIFSTQESKVDGTRKQLTAAKDDYK-CSPSMQQSELISPKRPTQ---GLLTSKA  194

Query  169   MRKKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNG  228
              +K+     + LP+V     S  +  L ++ ++       T  FL +          P  
Sbjct  195   SKKRYNVSLKSLPAVQNGHASTSSSALADQSSE-------TAHFLNS------RHGSPLN  241

Query  229   T---SNGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCApptppppipE  285
             +   S  +    + QR  ++++R E+ +R+TP T +  +++ SLKFD  AP         
Sbjct  242   SIEISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTI-------  294

Query  286   SKDLMPPEsttrrrsvrkssAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTN  345
                L  P              VQ   +VT    ++  +     S +Q S+  A +  F  
Sbjct  295   ---LQSP------------GKVQIHEQVTHFNDQALGECNCRLSTNQVSM--ALINGFRE  337

Query  346   QGEDMDNNRGRFsdddvsdedqendenGKDEDAEMEELGANVDKIRGYNELLDAYSLHQF  405
                 +  +R              + + G  +  +  ++  + +  +G N      S H F
Sbjct  338   DNSKLSPSRDH------------SKKMGIPKVIKSTKINTDTESHKGNNS-----SNHDF  380

Query  406   LIHKGRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLALAGT  465
              IH+G   R   +F SF+  A ++W +VEE +  LE LL+ YF+P+A+++GQR+L L+  
Sbjct  381   TIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTLSQE  440

Query  466   GQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARS  525
                  + R+LLSC+ NE ++  +L +PGQR++G ++  RAA  VQ+ +RM   RR Y   
Sbjct  441   NNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTYLLM  500

Query  526   RASDINATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRRVVV  585
              ++      IQ  WR Y+ + A K ++  +R  +   + + M +  S W +I  +RR V+
Sbjct  501   ISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRRTVM  560

Query  586   HVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKL  645
             H+PS+S+D  +R+  E F++QQNLQL R+CA+ +D NV+L +Y+ PFELT D++QY++KL
Sbjct  561   HIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQYYMKL  618

Query  646   LQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLP  705
             LQL G+ D+  R+K + PE ++RFP+HFSLS+++L SPH ++R+  Y  G+ AYLV G P
Sbjct  619   LQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFP  678

Query  706   GAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAAL  765
             G ED+RLA  L +PILG  PA+   + T SG KR   + + N   G+ +LYDE+EL  +L
Sbjct  679   GTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSL  738

Query  766   AKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAA  825
             AKL  A+  Q   ++KLDYDP   G A+VD+S +Q+++ LR   RT +YWRQP  ++   
Sbjct  739   AKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLI  798

Query  826   KMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTAL  885
             + I+ E++   +++ L   ++ E++P+W+ ++ A+  +G VIE  P              
Sbjct  799   RNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN------------  844

Query  886   VEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGLN----------------RKTVAFTFP  929
                 YVRANLF++P   V ++STQ  L+      N                 +T+ FTFP
Sbjct  845   -RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFP  903

Query  930   QTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSA  989
             QT   HE +K A    G+ L +  + GY+S+DF+V  D+++     L+A+A+ PFLT+SA
Sbjct  904   QTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPFLTNSA  962

Query  990   ASFACFHLLAR-GVLDTNSGAYR----VASKSLTTVTGRNGSGCTTDLLLREASLA---K  1041
             ASF+ F  L+R G  ++ +G +     + S  +T+ T  + S   TDL++REA L+    
Sbjct  963   ASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVS  1022

Query  1042  DSLAGAP-RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAG  1100
             + L   P R +V+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT+FLLADSLTAG
Sbjct  1023  NELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAG  1082

Query  1101  VFGVLSIGETMEGALAFLR  1119
             V G++ I +T + AL   R
Sbjct  1083  VLGIMCISDTRKNALLSCR  1101

>CCI45122
Length=1105

 Score = 528 bits (1359),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 300/762 (39%), Positives = 455/762 (60%), Gaps = 53/762 (7%)

Query  403   HQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealraleallTQYFVPLAYVDGQRLLAL  462
             + F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY++GQR+L L
Sbjct  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397

Query  463   AGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRY  522
             A       + ++L+SCI NED++  +L +PGQR++G +R +RA   +Q+ IRM + R+R+
Sbjct  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457

Query  523   ARSRASDINATKIQLAWRAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARRR  582
                R      T IQ  WR +S H A K ++   R  +   +   M +  S W +I  +RR
Sbjct  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517

Query  583   VVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYF  642
              ++H+PS+S+D   R+  E F++QQNLQL R+CAV +D NV+ L+Y+ PFELT D++QY+
Sbjct  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVE-LIYICPFELTDDIVQYY  575

Query  643   LKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVM  702
             +KLLQLGG+ D+  R+K + PE ++RFP+HFSLSS++LYSP  L R+     G+ AY+V 
Sbjct  576   MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  635

Query  703   GLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELC  762
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  636   GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  695

Query  763   AALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRD  822
              +LAKL  +H  Q   +++LDYDP G G A++D+S +Q+++E+R   +T E W QP  + 
Sbjct  696   FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQA  755

Query  823   AAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEAS  882
                + ++ E++    ++     +H E+FP+ + ++ A+  +G +IE  P           
Sbjct  756   KLIRNLVLEMQ--NNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK---------  804

Query  883   TALVEPAYVRANLFVDPDGSVHVTSTQNV--LATGGG--------GLNR------KTVAF  926
                    +VRANLF++P   V V+ST  +  L T           GL++      +T   
Sbjct  805   ----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGV  860

Query  927   TFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLT  986
             TFPQT   HE +K A  A G+ L +  + GY+S+DFVV  D+++     L+A  + PFLT
Sbjct  861   TFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFLT  919

Query  987   DSAASFACFHLLARGVLDTNSGAYRVASKSL------TTVTGRN---GSGCTTDLLLREA  1037
             ++AASFA F LL+RG      G+Y   + SL        V  +N    S   TDL++REA
Sbjct  920   NTAASFALFQLLSRG------GSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREA  973

Query  1038  SLA---KDSLAGAP-RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLL  1093
              L+    + L   P R + +  YV +P V T+  ++FF  CR  GV FD ER  GT+FLL
Sbjct  974   RLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLL  1033

Query  1094  ADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINM  1135
             ADSLTAGVFG++ I +T + AL+  R A+E I   AG+ +++
Sbjct  1034  ADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSV  1075

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 125/283 (44%), Gaps = 44/283 (16%)

Query  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaS--------PMRHSAIVT  52
            M+ ++Q+ H ED+GR+LLQTQ++LR +R +++      E   +        P    ++  
Sbjct  1    MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  53   TAEVQAFNAILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKH  112
            + +++    IL + E E+++K +L+  G+ +                   T   LP    
Sbjct  61   SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRK---------------TQTGLPFV--  103

Query  113  RSGYNGANKPRQMDASSIPMEFFREQFRNSSVE-IRQSLMPSPEPWQRHFGVHHGRLMR-  170
                  A+ PRQ+ +S+      +  F+  SV+ IR+ L    E ++      H  L+  
Sbjct  104  ------ASPPRQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYKCLPTKQHSELISP  157

Query  171  KKTTQHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTS  230
            K+ TQ   LL S          P  +  +A    L  V RG    ++  +    G    +
Sbjct  158  KRPTQG--LLTS---------KPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIGEASNT  206

Query  231  NGSCGGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDL  273
                  ++ QR   +++R E+ +++TP+T +  +N+ S+KFD 
Sbjct  207  LSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  249

>PHYKE_8394
Length=428

 Score = 331 bits (848),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 178/222 (80%), Positives = 188/222 (85%), Gaps = 23/222 (10%)

Query  601  ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660
            ENFAVQQNLQLTR+CA ALDSNVDLLVYVSPFELTADV QYFLKLLQLGGL DS PRVK 
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  661  VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDlpi  720
            VFPEQ+ RFP                       TGK+AYLVMGLPGAEDQRLAIALDLPI
Sbjct  238  VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  721  lgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780
            LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HEL AALAKLA+ HMDQP+WL+
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  781  KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRD  822
            KLDYDPLGVGEA++DLS +QAMRELRREKR PEYWRQPGPRD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 111/148 (75%), Gaps = 17/148 (11%)

Query  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAIVTTAEVQAFN  60
            MEK+QQQ HVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS +          
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV----------  50

Query  61   AILQQTETELRSKAELVLNGMVnssnnaqnnqtqsgnFLPAVTVAALPSTKHRSGYNGAN  120
                +TE ELR+KAELVLNGMVNSS+N Q+NQ Q G  LPAVTV A PS + R GY+   
Sbjct  51   ----KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  106

Query  121  KPR---QMDASSIPMEFFREQFRNSSVE  145
            KP+   + D  SIPMEFFRE+FRNS+VE
Sbjct  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 1/37 (3%)

Query  903  VHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIK  939
            VHVTSTQNVLA+G G LNRKTVA+TFPQTAAPHEA+K
Sbjct  390  VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 28/28 (100%), Gaps = 0/28 (0%)

Query  374  KDEDAEMEELGANVDKIRGYNELLDAYS  401
            +DEDAEMEELGANVDKIRGYNELLDAY+
Sbjct  150  RDEDAEMEELGANVDKIRGYNELLDAYT  177

>PYAR_13581
Length=730

 Score = 284 bits (726),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 165/305 (54%), Positives = 211/305 (69%), Gaps = 28/305 (9%)

Query  380  MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVeealra  439
            M++L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RA
Sbjct  81   MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRA  140

Query  440  leallTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGR  499
            LEALLT+YF+                    F    LLSC+VNEDQ+ S+LRRPGQRYKG+
Sbjct  141  LEALLTRYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGK  182

Query  500  DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTAlktrlrevrrek  559
            DRKRRAATT+QA  RM   R R+ R      +AT+IQ  WR ++   +L+  L   R E+
Sbjct  183  DRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQ  242

Query  560  lekwekrMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVAL  619
            L  W+ +M  L+SQW +I+ +RRVVVHVPSLSLDEH R+S ++FAVQQNLQL R+ AV +
Sbjct  243  LRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAV-V  301

Query  620  DSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLL  679
            D+ V+ +VYVSPFEL  D+           G+ ++  RVK V PE +  FP HFSL++ L
Sbjct  302  DATVEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQL  352

Query  680  LYSPH  684
            LYSPH
Sbjct  353  LYSPH  357

 Score = 172 bits (437),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 130/386 (34%), Positives = 170/386 (44%), Gaps = 107/386 (28%)

Query  792   AVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFP  851
             A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  LA P HSE FP
Sbjct  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446

Query  852   TWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDP-----DGSVHVT  906
              WR +  A+G  G VIEA+P            A V    VR N+FV P     D  V V 
Sbjct  447   DWRAFAQAIGRDGVVIEALP------------ARVR-GVVRVNIFVTPASSDHDADVPVV  493

Query  907   STQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVW-GYVSLDFVVF  965
             STQ  L    G   R  +AF  PQT  PH+A+ GA  A G+LL E   + GY S+D  + 
Sbjct  494   STQEALRASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLC  550

Query  966   QDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTVTGRNG  1025
             +DE S                         +LL    +DT++                  
Sbjct  551   RDETSG-----------------------LYLLPSPAVDTSAPL----------------  571

Query  1026  SGCTTDLLLREASLAKDSL------AGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGV  1079
                 T L+L+EA L   S       + +PRCFV   +  HP++ TM   AFF ACR  GV
Sbjct  572   -SPATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGV  630

Query  1080  CFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMvssp  1139
             CFDV R                            A+ +LRTA EV+ RE GS+       
Sbjct  631   CFDVTRR---------------------------AMQYLRTAFEVLAREVGSST------  657

Query  1140  srpvsgrsgNFAQVLSAVRASTGGGK  1165
                     GNF  VL+ +R   G  K
Sbjct  658   ----PSSDGNFGDVLALLRHRVGVEK  679

>H310_11272
Length=1799

 Score = 42.0 bits (97),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 3/40 (8%)

Query  503   RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAY  542
             R+AATT+ + IRM+L RRRY +SRA+ +   K+Q  WR++
Sbjct  1122  RKAATTIASGIRMFLARRRYRKSRAAFV---KLQARWRSF  1158

>PPTG_16221
Length=1259

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  503  RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCH  545
            R+ A  +Q  +R WL+RRRY R +   +    IQ  WR Y  H
Sbjct  698  RKYAIVLQKNVRCWLMRRRYLRQKQQIV---VIQKYWRRYVVH  737

>CCI46638
Length=1989

 Score = 36.6 bits (83),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query  494   QRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINAT-KIQLAWR  540
             QRYK   R+++AATT+    R +L+R R  R R    NAT K+Q  +R
Sbjct  1067  QRYKRHIREKKAATTLTHWTRAYLIRTRVERHRRLQYNATLKLQKWYR  1114

>CCI49118
Length=1989

 Score = 36.6 bits (83),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query  494   QRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINAT-KIQLAWR  540
             QRYK   R+++AATT+    R +L+R R  R R    NAT K+Q  +R
Sbjct  1067  QRYKRHIREKKAATTLTHWTRAYLIRTRVERHRRLQYNATLKLQKWYR  1114

>PHYRA_84534
Length=1368

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  503  RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCH  545
            R+ A  +Q  +R WL+RRR+ R +    +   IQ  WR Y  H
Sbjct  801  RKYAIVLQKNVRCWLMRRRFLRKKQ---HIVAIQKYWRRYVVH  840

>PHYCA_53999
Length=947

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  503  RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCH  545
            R+ A  +Q  +R WL+RRR+ R +   +    IQ  WR Y  H
Sbjct  698  RKYAIVLQKNVRCWLMRRRFLRQKQQIV---VIQKYWRRYVVH  737

>PYAR_23813
Length=1097

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 19/23 (83%), Gaps = 0/23 (0%)

Query  501  RKRRAATTVQACIRMWLVRRRYA  523
            R+R+AAT +Q+ +R WLVRR Y+
Sbjct  676  RRRKAATVIQSFVRGWLVRREYS  698

>HYAP_08623
Length=1187

 Score = 35.0 bits (79),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  503  RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCH  545
            R+ A  +Q  +R WL+RRR+ R +   +    IQ  WR Y  H
Sbjct  621  RKYAIVLQKNVRCWLMRRRFLRQKQQIV---VIQKYWRRYVIH  660

>PYVX_21490
Length=2926

 Score = 35.0 bits (79),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 62/131 (47%), Gaps = 5/131 (4%)

Query  471   SKRELLSCIVNEDQIMSVLRRPGQRYKG-RDRKRRAATTVQACIRMWLVRRRYA-RSRAS  528
             +K  +L C       +  +R+  +R +  R+RK +A  T++ C+R W++RRR A   R +
Sbjct  998   AKETILRCWRRMQARLRRVRKQQERLRQQRERKDQAIRTIKQCLREWILRRRLAVAQRQT  1057

Query  529   DINATKIQLAW-RAYSCHTAlktrlrevrreklekwekrMCTLKSQWSQIAARR-RVVVH  586
                  K  L W +A   H  + +  ++ R E   K    +  L+ +W Q  A R ++  H
Sbjct  1058  RQTMFKENLKWTKAKRDHEKILSLEKKRRDELSSKLTSNLAELEQKWQQTDAERIKLAAH  1117

Query  587   VPSLSLDEHYR  597
                + L +H R
Sbjct  1118  NEKV-LKQHQR  1127

>PHYSO_517698
Length=1911

 Score = 34.7 bits (78),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 3/41 (7%)

Query  503   RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYS  543
             RR+  T+Q C+  WL+ R++ R+R +   + +IQ  WR++S
Sbjct  1184  RRSTRTLQYCVTSWLLCRQFRRARKA---SRRIQKTWRSHS  1221

>CCA18434
Length=1985

 Score = 34.7 bits (78),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query  493   GQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINAT-KIQLAWR  540
              QRYK   R++RAATT+    R++L R R  R R    NAT +IQ  +R
Sbjct  1063  NQRYKRYIREKRAATTLTHWTRVYLDRTREERHRRLQHNATLRIQKWYR  1111

>CCA18292
Length=1985

 Score = 34.7 bits (78),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query  493   GQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINAT-KIQLAWR  540
              QRYK   R++RAATT+    R++L R R  R R    NAT +IQ  +R
Sbjct  1063  NQRYKRYIREKRAATTLTHWTRVYLDRTREERHRRLQHNATLRIQKWYR  1111

>SDRG_16699
Length=766

 Score = 34.3 bits (77),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query  498  GRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSC  544
             + +  RAA TVQA  R  LVR+ Y + R +   A K+Q A R   C
Sbjct  689  AKQKMERAAVTVQAATRSMLVRKSYLQQRNT---AIKVQAAARGILC  732

>SPRG_18826
Length=766

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query  498  GRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSC  544
             + +  RAA TVQA  R  LVR+ Y + R +   A K+Q A R   C
Sbjct  690  AKQKMERAAVTVQAATRSMLVRKSYLQQRNT---AIKVQAAARGILC  733

>PHYRA_96309
Length=974

 Score = 33.9 bits (76),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (3%)

Query  505  AATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540
            AA T+Q+C+R WL RRR    + + ++A ++Q AWR
Sbjct  127  AARTIQSCVRKWL-RRREHLLQLTVMHAARLQAAWR  161

>SPRG_13978
Length=475

 Score = 33.5 bits (75),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 58/150 (39%), Gaps = 11/150 (7%)

Query  757  DEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMR--ELRREKRTPEY  814
            D H L A  A+ +I + D P WL  L    LG    ++   + QA+    +  +  T   
Sbjct  29   DAHALAALTAETSIGNNDMP-WLSPLISAVLGTTVLLLGFFHFQAIHPESVAPDAYTEAL  87

Query  815  WRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTA  874
            W+   P      + L+ L+   +LA        ++      YI  + +F   I  VP  +
Sbjct  88   WQ---PNSWELPLFLSALQHVAVLALTKNNNRPQLV-----YIRFLDNFSWSIFLVPSLS  139

Query  875  IAASPEASTALVEPAYVRANLFVDPDGSVH  904
               +P  STA+      R     DP G V 
Sbjct  140  ATTAPSTSTAVSTAVLGRGLTSYDPSGFVQ  169

>CCA14389
Length=1187

 Score = 33.5 bits (75),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 25/44 (57%), Gaps = 1/44 (2%)

Query  501  RKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSC  544
            R+R AA  +Q  +R +L R RY   RA+   A + + A+R Y C
Sbjct  760  RQRSAAIRIQCLLRCYLARTRYLSLRANHC-AAQTETAYRKYHC  802

>PYVX_21078
Length=1475

 Score = 33.5 bits (75),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  500  DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRA  541
            +R +RAA  V+A  R  L  R+Y ++RAS I        WRA
Sbjct  821  ERAKRAAIIVEAAFRTHLAMRQYRKTRASTIVVQTFVRRWRA  862

Lambda      K        H        a         alpha
   0.321    0.133    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 99734033700

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40