Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_171271475635135117100.0
PITG_184561475635135115970.0
PHYSO_4715231475634835114840.0
PHYRA_811001475634935114830.0
PHYCA_5561621475635135114720.0
PHALS_064781475634535114110.0
PHYKE_83931475632635112212e-168
PYU1_G001735147563423528732e-115
PYAP_17762147563483578551e-112
PYIR_13451147563593638456e-111
PYVX_18171147562943407521e-97
PYIW_19971147563483647561e-97
PYAR_13570147563223266653e-84
CCA18899147563433396179e-77
CCI45123147563013114902e-58
SPRG_06336147563353364576e-53
SDRG_01781147563353354568e-53
H257_06294147563583583838e-42
H310_09223147563333383642e-39
CCI451271609872022042355e-22
PYAR_23286161286071241511e-09
PHYRA_849161612815411151378e-08
PYU1_G0063471612810951151361e-07
PYIW_17381161289521321351e-07
HYAP_086451612815141161351e-07
PHYSO_3617471612815231151323e-07
CCI447521612815261251306e-07
PYIR_215891612815681321297e-07
PPTG_188981612815591141298e-07
PITG_205621612815591141298e-07
PHYKE_19901612814991151243e-06
PYVX_204381612813461191217e-06
CCA188751612815141251217e-06
H257_067221612814821191208e-06
SDRG_127631251091317441172e-05
SPRG_060581612812581381172e-05
PYAP_169971612810181191153e-05
PHYKE_247914459171531093e-05
H310_0023012510912481191154e-05
PYU1_G00106314459783351144e-05
PYAP_1729014459835361144e-05
PYIW_1317214459939351145e-05
PYIR_1530914459937351145e-05
SPRG_060591251091312441136e-05
H310_002311612814951121128e-05
H257_067211251091238401111e-04
PYAR_1991414459788351111e-04
PYVX_1357414459950351101e-04
CCI4122514459981351101e-04
PHALS_0653314459930351082e-04
PITG_1806714459924541083e-04
PPTG_1340114459927541083e-04
PYIR_17453951126191131083e-04
PHYRA_7783414459936351073e-04
CCI42457152926906351073e-04
CCA1648714459975351073e-04
PHYCA_503112152926214341034e-04
PYU1_G008848152677651291064e-04
CCA17102152926884351055e-04
PPTG_193711526711951471056e-04
SDRG_12762161281392401057e-04
PYIR_183821526711541291048e-04
PYIW_21108951125931301040.001
PHYRA_825431526711991471030.001
PITG_192131526712011471000.002
PYAP_18636152671009140990.003
CCI1048915870977737980.003
PHALS_0669914313884133980.004
PHYSO_55616414313765135980.004
PHYSO_544598152671163148980.004
PITG_11303931829334950.005
PHALS_035401690479970.005
PITG_1789314313747118960.007
PYIW_1698715267821114950.008
SDRG_00080124544298109940.008
PYAR_15463152671091110950.008
PHYRA_7353514313875135950.009
PPTG_0455314313904118950.010
SDRG_055678195980132950.010
H257_0982314313654110940.011
CCI3936728852046163940.013
CCA18023152671138110940.013
H257_0336112342869960930.014
PYVX_13312152671016110940.014
CCI46235152671155110930.015
SPRG_060218195983113930.017
H257_0309315267975110930.018
PYVX_18338241774649920.019
PHYSO_3436291445997730920.019
SPRG_16312131322261109900.019
PHYRA_73534696861210135920.020
H310_063781445983735920.021
PHYCA_506137241781037910.024
PHYSO_344112241781337910.024
PPTG_05519241781037910.024
PYIW_18480241775537910.024
H257_135671445983635910.024
PITG_02762241781037910.026
PHYRA_79281241780937910.026
HYAP_08026241779837910.027
SPRG_091281431362030910.028
SDRG_0140715267815119910.028
PYAP_22646241781537910.028
SPRG_143129639661133910.028
PYIW_1987356695185123870.029
CCA21715241778237900.031
CCA2186015507878237900.031
H310_0484315267968110910.031
SDRG_088001445988135900.031
H310_0091295112182126910.033
H257_0517516430678121900.034
PHALS_04098152671183145900.035
PYVX_2334914313924114900.036
PPTG_14630185339856890.039
PHYKE_5678241780944900.040
H310_0466716430680153890.041
SPRG_119001660547890.041
PYIW_20891185329156880.043
SPRG_054491445972335890.044
PYU1_G004386241783742890.052
SDRG_048711643068755880.052
SPRG_082171643068755880.053
PHALS_03645241783042890.054
H310_1362714313678110880.056
SPRG_0089015267883110880.058
SPRG_1702213189210739820.060
PITG_02109185352256880.061
PHYCA_504801185339856870.061
SDRG_0560811092121127820.065
SDRG_142861431367030880.065
PYAP_161619866188939880.067
PYAR_19883241783337880.068
PYIR_13120241781437880.070
PYAP_136951853348133860.086
H310_070709639680117870.087
PHYKE_666215267765146870.087
PHYKE_4910185237548860.089
SDRG_05150241778739860.095
PYAP_2347885060897167860.098
PYIR_2458885060909111860.10
PYU1_G0092499511258062870.10
SPRG_08346241779739860.10
PYU1_G0032291681045860.11
PYIW_2190185060913117860.11
SDRG_062881664155850.12
PYAR_1929185060711128850.13
PYIW_1961312330131471860.13
H310_06666863288734850.13
PYU1_G01081856695169126820.13
H257_02642640397551850.14
PYAR_2606510677931460840.14
PYU1_G012870185335256840.14
SPRG_0250211092121125790.15
PYVX_2343212330151060850.16
HYAP_061012885984119850.17
H310_0666713886889652830.22
HYAP_0445715267120334830.25
H257_039319639695124830.25
PHYRA_9440928851270119830.25
CCA268906147153062830.25
CCI43793134791117162830.26
HYAP_0640312330103760830.26
CCI40991241780173830.26
H257_01308863289734830.28
PITG_0210618501015143830.29
PHYKE_491118534632720.30
PYAR_14615863251734820.31
PYAR_157921109212142770.32
PHYSO_24848128851283119820.32
H310_01921185334166810.38
HYAP_0930413479114432820.39
SPRG_01860863267433810.39
SDRG_08236863286433810.41
H310_07701241781137810.41
PHYKE_7856288534632800.42
PYU1_G0128591850118365810.42
H257_07514241781037810.43
PYVX_199821643070055810.45
PHALS_06336185251156810.45
PPTG_1171495112444128810.46
PYIW_150141643070255800.49
PYIR_214731643066755800.49
H257_081821685953810.50
PYAR_166741643065155800.51
PITG_175941408869455800.53
PHALS_06568185338856800.54
H257_06469219447630720.58
SPRG_0275212342883157800.58
SDRG_1448712342896459800.60
PHYRA_72718379732124800.61
PHYSO_478611185352256790.62
PHYRA_8307195112300130800.64
PYU1_G0007249278718936770.67
H310_09363140947195479800.68
H257_03363185331666780.68
PITG_033182885134335800.70
H310_14473749061359790.72
PPTG_160442885137835790.73
PYAP_237441109212357740.76
PPTG_1898913479121332790.77
SDRG_021352194430634780.80
CCI420883199100727790.81
PHYKE_1044863252139780.86
PYVX_145276030126956790.88
PYU1_G00742385060928130790.88
HYAP_137571151726231770.93
PHALS_092733199663155780.94
PHYCA_5054411643069455780.94
PHALS_0793013479120032780.95
SDRG_08383123078132159780.98
PHYRA_8194413479114932780.99
SDRG_0215412656882256781.0
PPTG_161741643069355781.0
PHYRA_845671643069655781.1
PITG_210261643069455781.1
PITG_104628632102834781.1
PHYSO_3047841643069455771.1
PHYSO_558498863296734781.1
PYIR_1511813479122232781.1
H257_09270142234884136781.1
PHALS_09729863294934781.1
PHYRA_73430185339556771.1
CCI47145185339056771.2
PYU1_G0095089576532832761.2
PHYSO_50691837975848771.2
SPRG_02010123078132659781.2
PPTG_08785863294434771.2
PHALS_0558728851361117781.2
PYIR_1316828851353112771.2
PYAR_233668366382872771.2
CCA24531185337456761.2
PYAP_22195863290134771.3
PHYRA_820408632105434771.3
PYIR_2337215835141536771.3
PHALS_027391643064855771.3
PYIW_1891113479119632771.3
PHYCA_564296863295734771.3
PYVX_14593185096450771.3
PYIR_13555185335556761.4
CCI434561109212639721.4
CCA1551328851341114771.4
SDRG_14486185330857761.4
PYAR_162289866186239771.4
SPRG_02753185330957761.4
SDRG_06927144484793771.4
PHYSO_4845411691179771.5
PYVX_1308413479126771771.5
SPRG_09805144483877761.6
PYIR_144941681933761.6
H310_140199204683161761.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17127

Length=351
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17127                                                            663        0.0   
PITG_18456                                                            619        0.0   
PHYSO_471523                                                          576        0.0   
PHYRA_81100                                                           575        0.0   
PHYCA_556162                                                          571        0.0   
PHALS_06478                                                           548        0.0   
PHYKE_8393                                                            474        2e-168
PYU1_G001735                                                          340        2e-115
PYAP_17762                                                            333        1e-112
PYIR_13451                                                            330        6e-111
PYVX_18171                                                            294        1e-97 
PYIW_19971                                                            295        1e-97 
PYAR_13570                                                            260        3e-84 
CCA18899                                                              242        9e-77 
CCI45123                                                              193        2e-58 
SPRG_06336                                                            180        6e-53 
SDRG_01781                                                            180        8e-53 
H257_06294                                                            152        8e-42 
H310_09223                                                            144        2e-39 
CCI45127                                                              95.1       5e-22 
PYAR_23286                                                            62.8       1e-09 
PHYRA_84916                                                           57.4       8e-08 
PYU1_G006347                                                          57.0       1e-07 
PYIW_17381                                                            56.6       1e-07 
HYAP_08645                                                            56.6       1e-07 
PHYSO_361747                                                          55.5       3e-07 
CCI44752                                                              54.7       6e-07 
PYIR_21589                                                            54.3       7e-07 
PPTG_18898                                                            54.3       8e-07 
PITG_20562                                                            54.3       8e-07 
PHYKE_1990                                                            52.4       3e-06 
PYVX_20438                                                            51.2       7e-06 
CCA18875                                                              51.2       7e-06 
H257_06722                                                            50.8       8e-06 
SDRG_12763                                                            49.7       2e-05 
SPRG_06058                                                            49.7       2e-05 
PYAP_16997                                                            48.9       3e-05 
PHYKE_2479                                                            46.6       3e-05 
H310_00230                                                            48.9       4e-05 
PYU1_G001063                                                          48.5       4e-05 
PYAP_17290                                                            48.5       4e-05 
PYIW_13172                                                            48.5       5e-05 
PYIR_15309                                                            48.5       5e-05 
SPRG_06059                                                            48.1       6e-05 
H310_00231                                                            47.8       8e-05 
H257_06721                                                            47.4       1e-04 
PYAR_19914                                                            47.4       1e-04 
PYVX_13574                                                            47.0       1e-04 
CCI41225                                                              47.0       1e-04 
PHALS_06533                                                           46.2       2e-04 
PITG_18067                                                            46.2       3e-04 
PPTG_13401                                                            46.2       3e-04 
PYIR_17453                                                            46.2       3e-04 
PHYRA_77834                                                           45.8       3e-04 
CCI42457                                                              45.8       3e-04 
CCA16487                                                              45.8       3e-04 
PHYCA_503112                                                          44.3       4e-04 
PYU1_G008848                                                          45.4       4e-04 
CCA17102                                                              45.1       5e-04 
PPTG_19371                                                            45.1       6e-04 
SDRG_12762                                                            45.1       7e-04 
PYIR_18382                                                            44.7       8e-04 
PYIW_21108                                                            44.7       0.001 
PHYRA_82543                                                           44.3       0.001 
PITG_19213                                                            43.1       0.002 
PYAP_18636                                                            42.7       0.003 
CCI10489                                                              42.4       0.003 
PHALS_06699                                                           42.4       0.004 
PHYSO_556164                                                          42.4       0.004 
PHYSO_544598                                                          42.4       0.004 
PITG_11303                                                            41.2       0.005 
PHALS_03540                                                           42.0       0.005 
PITG_17893                                                            41.6       0.007 
PYIW_16987                                                            41.2       0.008 
SDRG_00080                                                            40.8       0.008 
PYAR_15463                                                            41.2       0.008 
PHYRA_73535                                                           41.2       0.009 
PPTG_04553                                                            41.2       0.010 
SDRG_05567                                                            41.2       0.010 
H257_09823                                                            40.8       0.011 
CCI39367                                                              40.8       0.013 
CCA18023                                                              40.8       0.013 
H257_03361                                                            40.4       0.014 
PYVX_13312                                                            40.8       0.014 
CCI46235                                                              40.4       0.015 
SPRG_06021                                                            40.4       0.017 
H257_03093                                                            40.4       0.018 
PYVX_18338                                                            40.0       0.019 
PHYSO_343629                                                          40.0       0.019 
SPRG_16312                                                            39.3       0.019 
PHYRA_73534                                                           40.0       0.020 
H310_06378                                                            40.0       0.021 
PHYCA_506137                                                          39.7       0.024 
PHYSO_344112                                                          39.7       0.024 
PPTG_05519                                                            39.7       0.024 
PYIW_18480                                                            39.7       0.024 
H257_13567                                                            39.7       0.024 
PITG_02762                                                            39.7       0.026 
PHYRA_79281                                                           39.7       0.026 
HYAP_08026                                                            39.7       0.027 
SPRG_09128                                                            39.7       0.028 
SDRG_01407                                                            39.7       0.028 
PYAP_22646                                                            39.7       0.028 
SPRG_14312                                                            39.7       0.028 
PYIW_19873                                                            38.1       0.029 
CCA21715                                                              39.3       0.031 
CCA21860                                                              39.3       0.031 
H310_04843                                                            39.7       0.031 
SDRG_08800                                                            39.3       0.031 
H310_00912                                                            39.7       0.033 
H257_05175                                                            39.3       0.034 
PHALS_04098                                                           39.3       0.035 
PYVX_23349                                                            39.3       0.036 
PPTG_14630                                                            38.9       0.039 
PHYKE_5678                                                            39.3       0.040 
H310_04667                                                            38.9       0.041 
SPRG_11900                                                            38.9       0.041 
PYIW_20891                                                            38.5       0.043 
SPRG_05449                                                            38.9       0.044 
PYU1_G004386                                                          38.9       0.052 
SDRG_04871                                                            38.5       0.052 
SPRG_08217                                                            38.5       0.053 
PHALS_03645                                                           38.9       0.054 
H310_13627                                                            38.5       0.056 
SPRG_00890                                                            38.5       0.058 
SPRG_17022                                                            36.2       0.060 
PITG_02109                                                            38.5       0.061 
PHYCA_504801                                                          38.1       0.061 
SDRG_05608                                                            36.2       0.065 
SDRG_14286                                                            38.5       0.065 
PYAP_16161                                                            38.5       0.067 
PYAR_19883                                                            38.5       0.068 
PYIR_13120                                                            38.5       0.070 
PYAP_13695                                                            37.7       0.086 
H310_07070                                                            38.1       0.087 
PHYKE_6662                                                            38.1       0.087 
PHYKE_4910                                                            37.7       0.089 
SDRG_05150                                                            37.7       0.095 
PYAP_23478                                                            37.7       0.098 
PYIR_24588                                                            37.7       0.10  
PYU1_G009249                                                          38.1       0.10  
SPRG_08346                                                            37.7       0.10  
PYU1_G003229                                                          37.7       0.11  
PYIW_21901                                                            37.7       0.11  
SDRG_06288                                                            37.4       0.12  
PYAR_19291                                                            37.4       0.13  
PYIW_19613                                                            37.7       0.13  
H310_06666                                                            37.4       0.13  
PYU1_G010818                                                          36.2       0.13  
H257_02642                                                            37.4       0.14  
PYAR_26065                                                            37.0       0.14  
PYU1_G012870                                                          37.0       0.14  
SPRG_02502                                                            35.0       0.15  
PYVX_23432                                                            37.4       0.16  
HYAP_06101                                                            37.4       0.17  
H310_06667                                                            36.6       0.22  
HYAP_04457                                                            36.6       0.25  
H257_03931                                                            36.6       0.25  
PHYRA_94409                                                           36.6       0.25  
CCA26890                                                              36.6       0.25  
CCI43793                                                              36.6       0.26  
HYAP_06403                                                            36.6       0.26  
CCI40991                                                              36.6       0.26  
H257_01308                                                            36.6       0.28  
PITG_02106                                                            36.6       0.29  
PHYKE_4911                                                            32.3       0.30  
PYAR_14615                                                            36.2       0.31  
PYAR_15792                                                            34.3       0.32  
PHYSO_248481                                                          36.2       0.32  
H310_01921                                                            35.8       0.38  
HYAP_09304                                                            36.2       0.39  
SPRG_01860                                                            35.8       0.39  
SDRG_08236                                                            35.8       0.41  
H310_07701                                                            35.8       0.41  
PHYKE_7856                                                            35.4       0.42  
PYU1_G012859                                                          35.8       0.42  
H257_07514                                                            35.8       0.43  
PYVX_19982                                                            35.8       0.45  
PHALS_06336                                                           35.8       0.45  
PPTG_11714                                                            35.8       0.46  
PYIW_15014                                                            35.4       0.49  
PYIR_21473                                                            35.4       0.49  
H257_08182                                                            35.8       0.50  
PYAR_16674                                                            35.4       0.51  
PITG_17594                                                            35.4       0.53  
PHALS_06568                                                           35.4       0.54  
H257_06469                                                            32.3       0.58  
SPRG_02752                                                            35.4       0.58  
SDRG_14487                                                            35.4       0.60  
PHYRA_72718                                                           35.4       0.61  
PHYSO_478611                                                          35.0       0.62  
PHYRA_83071                                                           35.4       0.64  
PYU1_G000724                                                          34.3       0.67  
H310_09363                                                            35.4       0.68  
H257_03363                                                            34.7       0.68  
PITG_03318                                                            35.4       0.70  
H310_14473                                                            35.0       0.72  
PPTG_16044                                                            35.0       0.73  
PYAP_23744                                                            33.1       0.76  
PPTG_18989                                                            35.0       0.77  
SDRG_02135                                                            34.7       0.80  
CCI42088                                                              35.0       0.81  
PHYKE_1044                                                            34.7       0.86  
PYVX_14527                                                            35.0       0.88  
PYU1_G007423                                                          35.0       0.88  
HYAP_13757                                                            34.3       0.93  
PHALS_09273                                                           34.7       0.94  
PHYCA_505441                                                          34.7       0.94  
PHALS_07930                                                           34.7       0.95  
SDRG_08383                                                            34.7       0.98  
PHYRA_81944                                                           34.7       0.99  
SDRG_02154                                                            34.7       1.0   
PPTG_16174                                                            34.7       1.0   
PHYRA_84567                                                           34.7       1.1   
PITG_21026                                                            34.7       1.1   
PITG_10462                                                            34.7       1.1   
PHYSO_304784                                                          34.3       1.1   
PHYSO_558498                                                          34.7       1.1   
PYIR_15118                                                            34.7       1.1   
H257_09270                                                            34.7       1.1   
PHALS_09729                                                           34.7       1.1   
PHYRA_73430                                                           34.3       1.1   
CCI47145                                                              34.3       1.2   
PYU1_G009508                                                          33.9       1.2   
PHYSO_506918                                                          34.3       1.2   
SPRG_02010                                                            34.7       1.2   
PPTG_08785                                                            34.3       1.2   
PHALS_05587                                                           34.7       1.2   
PYIR_13168                                                            34.3       1.2   
PYAR_23366                                                            34.3       1.2   
CCA24531                                                              33.9       1.2   
PYAP_22195                                                            34.3       1.3   
PHYRA_82040                                                           34.3       1.3   
PYIR_23372                                                            34.3       1.3   
PHALS_02739                                                           34.3       1.3   
PYIW_18911                                                            34.3       1.3   
PHYCA_564296                                                          34.3       1.3   
PYVX_14593                                                            34.3       1.3   
PYIR_13555                                                            33.9       1.4   
CCI43456                                                              32.3       1.4   
CCA15513                                                              34.3       1.4   
SDRG_14486                                                            33.9       1.4   
PYAR_16228                                                            34.3       1.4   
SPRG_02753                                                            33.9       1.4   
SDRG_06927                                                            34.3       1.4   
PHYSO_484541                                                          34.3       1.5   
PYVX_13084                                                            34.3       1.5   
SPRG_09805                                                            33.9       1.6   
PYIR_14494                                                            33.9       1.6   
H310_14019                                                            33.9       1.7   
PYU1_G006732                                                          33.9       1.7   
PHALS_01010                                                           33.9       1.7   
PYVX_16714                                                            33.9       1.7   
SPRG_14955                                                            33.9       1.7   
PYU1_G012274                                                          33.9       1.7   
H257_01309                                                            33.9       1.8   
CCI45857                                                              33.9       1.9   
PYVX_14287                                                            33.5       1.9   
CCA19118                                                              32.0       2.0   
PYIW_21944                                                            33.9       2.0   
SDRG_14070                                                            33.5       2.0   
H257_09028                                                            33.5       2.0   
CCI10928                                                              33.9       2.1   
PPTG_16659                                                            33.5       2.1   
PPTG_14626                                                            33.5       2.2   
SPRG_00889                                                            33.5       2.2   
HYAP_13267                                                            33.5       2.2   
SDRG_15262                                                            33.5       2.2   
CCA23572                                                              33.5       2.2   
PYAR_13491                                                            33.5       2.2   
PPTG_10755                                                            33.5       2.3   
PHYRA_78815                                                           33.5       2.5   
PHALS_06334                                                           33.5       2.5   
SPRG_08834                                                            33.5       2.5   
CCA25510                                                              33.5       2.5   
PITG_00416                                                            33.5       2.5   
PHALS_12503                                                           33.1       2.6   
PYAP_16734                                                            33.5       2.8   
H257_13346                                                            33.1       2.8   
PHYRA_83768                                                           33.1       2.8   
PHYKE_7347                                                            31.6       2.9   
PHYSO_349983                                                          33.1       2.9   
CCA27255                                                              33.1       2.9   
SDRG_01408                                                            33.1       2.9   
SPRG_04912                                                            32.7       2.9   
PHYRA_77033                                                           33.1       3.0   
PITG_13665                                                            31.6       3.0   
PITG_11578                                                            33.1       3.0   
PYIW_23677                                                            31.2       3.0   
CCA19033                                                              33.1       3.0   
PYAP_22685                                                            33.1       3.0   
PHALS_08097                                                           33.1       3.0   
PHALS_07062                                                           31.6       3.1   
PHYSO_289146                                                          31.6       3.1   
HYAP_11295                                                            33.1       3.1   
HYAP_07348                                                            33.1       3.1   
PHYCA_510506                                                          31.6       3.2   
CCI42349                                                              33.1       3.2   
HYAP_08248                                                            33.1       3.2   
H310_05692                                                            33.1       3.2   
PHYRA_73432                                                           33.1       3.4   
PPTG_19631                                                            31.2       3.4   
SDRG_17208                                                            33.1       3.5   
PHYSO_529931                                                          33.1       3.5   
H310_02133                                                            33.1       3.5   
H310_04842                                                            33.1       3.5   
PYAR_16120                                                            32.7       3.6   
HYAP_02360                                                            31.2       3.6   
PYVX_15906                                                            31.2       3.6   
PHYRA_85100                                                           31.2       3.7   
PHYRA_85097                                                           31.2       3.7   
PPTG_04299                                                            32.7       3.7   
PYU1_G008119                                                          31.2       3.8   
CCA19097                                                              32.7       3.8   
CCA22367                                                              32.7       3.9   
PITG_07134                                                            32.7       3.9   
PHALS_02608                                                           32.7       3.9   
PYIW_26522                                                            31.2       4.0   
PYIR_15407                                                            31.2       4.1   
PHALS_03335                                                           32.7       4.2   
PHYSO_478442                                                          32.7       4.2   
SPRG_06629                                                            32.7       4.2   
SPRG_15871                                                            30.8       4.3   
PYIR_23012                                                            32.7       4.6   
PYIW_17818                                                            32.7       4.8   
PHYCA_556081                                                          32.7       4.8   
SPRG_11537                                                            32.3       4.8   
SPRG_21393                                                            32.3       5.0   
PYIW_18491                                                            32.3       5.0   
H257_00729                                                            30.8       5.1   
SDRG_12776                                                            32.3       5.3   
PYIW_14463                                                            32.0       5.3   
PYAP_24144                                                            32.3       5.4   
PHYSO_350197                                                          32.3       5.5   
SDRG_15601                                                            32.0       5.5   
PYU1_G012858                                                          32.0       5.5   
SPRG_20275                                                            32.0       5.7   
H257_11786                                                            32.0       5.8   
PPTG_09889                                                            31.2       5.8   
H310_01094                                                            30.8       5.8   
PYAR_24323                                                            32.3       5.9   
PITG_16799                                                            32.3       6.1   
SPRG_02939                                                            32.3       6.2   
H257_09262                                                            32.0       6.3   
PYU1_G007013                                                          32.0       6.7   
PITG_20103                                                            32.0       6.9   
PYAR_25500                                                            32.0       6.9   
SDRG_05128                                                            32.0       6.9   
PYIW_21526                                                            32.0       7.2   
SDRG_07086                                                            32.0       7.4   
HYAP_13688                                                            32.0       7.5   
H310_01510                                                            32.0       7.8   
SPRG_08326                                                            31.6       7.9   
PHYKE_4241                                                            31.6       8.0   
PPTG_19471                                                            31.6       8.4   
HYAP_09545                                                            30.8       8.4   
PYIR_16539                                                            31.6       8.5   
PYAR_14218                                                            31.6       8.9   
PYAP_15374                                                            31.6       9.0   
H257_05679                                                            31.2       9.1   
PYIR_22667                                                            31.6       9.1   
PITG_03652                                                            31.6       9.1   
H257_03095                                                            31.6       9.1   
PPTG_13492                                                            31.6       9.2   
PYAP_18434                                                            31.6       9.3   
H257_09269                                                            31.6       9.4   
PHYCA_121918                                                          31.6       9.5   
PYAR_18690                                                            31.6       9.6   
PHYCA_539981                                                          31.6       9.6   
PHYRA_84786                                                           31.6       9.7   
PPTG_07800                                                            30.4       9.7   
PYAP_17800                                                            31.6       9.8   

>PPTG_17127
Length=351

 Score = 663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/351 (100%), Positives = 351/351 (100%), Gaps = 0/351 (0%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PITG_18456
Length=351

 Score = 619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/351 (93%), Positives = 336/351 (96%), Gaps = 0/351 (0%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPEHG TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP G+PSAPKG FYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVARNAL  KRQLTRQAIDQSVSP KK LFGFSV+LSPQPAMSPQKQ+QTL+KS
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDELLS+ALRELEAAKLVGREACNEIV+QGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLHLFSDDSRPKSTG SKGSSPQR HQSGGSSP+RLPPA + SSDAG SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAE+LNGEA  SSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYSO_471523
Length=348

 Score = 576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/351 (85%), Positives = 315/351 (90%), Gaps = 3/351 (1%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNL VSYYESRAAC
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAA+KPFGFKMVGHAP+KGYVELDVFV+TL 
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVARNALS KRQLTRQAIDQSVSPN+K LFGF+++LSPQP MSPQKQMQTL KS
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +DELLS+ALR++EAAK VGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLHLFSDD        SK SSPQR  QSG   P RLPPA D+ +DAG SDLERLAQALGE
Sbjct  241  TLHLFSDD-SRPKASASKASSPQRSQQSG--RPPRLPPAMDSINDAGVSDLERLAQALGE  297

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAE+LNGEA   +QQIERIEH L+NVT RVEKQTKQASA L +GPRLF
Sbjct  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PHYRA_81100
Length=349

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/351 (85%), Positives = 316/351 (90%), Gaps = 2/351 (1%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVARNALS KRQLTRQAIDQSVS NKK LFGF V+LSPQP M+PQKQMQTL ++
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDELLS ALR++EAAKLVGREACNEIVIQGEKLD IEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLHLFSDD     +  SKG SPQR  QSGG SPSRLPPA +T +DAG SDLERLAQALGE
Sbjct  241  TLHLFSDD-SRPKSTASKGHSPQRSQQSGG-SPSRLPPAMETINDAGVSDLERLAQALGE  298

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAE+LNGEA  S+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PHYCA_556162
Length=351

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/351 (84%), Positives = 319/351 (91%), Gaps = 0/351 (0%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE G   SGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HP TGE S PKGSFYLSSIEPHEYVVGVMGAA KPFGFKMVGHAPKKGYVELDVFV+T+ 
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVARNALS KRQLTRQAIDQSVSPNKK LFGFSV+LSPQPA+SPQKQMQTL K+
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KD+LLS+ALR++EAAK +GREACNEIVIQGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLH+FS+DSRPKST  SK +SPQR  QSGGSSP+RL  A ++  D G SDLERLAQALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LE+QAE+LN EA HS+QQI+ IEHHL+ VT RVEKQTKQASATL AGPRLF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHALS_06478
Length=345

 Score = 548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/351 (81%), Positives = 306/351 (87%), Gaps = 6/351 (2%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILR+PE G TASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP GE + PKGSFYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVA NAL  KRQLTRQAIDQSVSPNKK LFGFSV  S QP MSPQKQMQTLA S
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            K+ LL EALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLH FSDD+RPK   G         H SG +SPSRL PA + + DAG SDL+RLAQALGE
Sbjct  241  TLHFFSDDTRPKVPLGDHP------HHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAE+LN E+ HSSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PHYKE_8393
Length=326

 Score = 474 bits (1221),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/351 (73%), Positives = 284/351 (81%), Gaps = 25/351 (7%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE G TASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP GE  A KGSFYLS+I PHEYVVGVMGAADKPFGFKMVGHAP+KGYVELDVFV+TL+
Sbjct  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95

Query  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
            DRNKWLEVARNAL  KRQ+ RQAIDQSVSP KK +FGF ++LSPQP + PQKQ+Q L  +
Sbjct  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  155

Query  181  KDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240
            K+ELL+EALRELEAAK+VGREACNEIV+QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  156  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215

Query  241  TLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300
            TLHLFSDD+RPKS   S  SSPQR HQS GS+P  LP +  +++DA  SDLERLA ALGE
Sbjct  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  275

Query  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LE+QAE+LNGEA  S+QQI RIE  L+NVT RVEKQTKQASATLSAGPRLF
Sbjct  276  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYU1_G001735
Length=342

 Score = 340 bits (873),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 247/352 (70%), Gaps = 18/352 (5%)

Query  1    MNILRVPEHGTTASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQVSY+ESR A
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  60   CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119
             H P    + PKGSFY+SS+E HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FV++L
Sbjct  61   AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  120  ADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAK  179
             D NKWLEV +NAL   ++LTR+ +  S     K++FGF  ++SPQ       Q++ LA 
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVKKLAA  167

Query  180  SKDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKS  239
            +K+ELL EALRE+E AKL+GREA NEIV QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  240  PTLHLFSDDsrpkstggskgsspQRFHQSGGSSP-SRLPPAFDTSSDAGG---SDLERLA  295
            P LH+FS+D+R K    +  ++      S  +SP S            GG   +DLE LA
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  296  QALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAG  347
             AL ELE QA ++N EA+ S++QI RIE  LT+V  RV+ QTK+A+AT+ AG
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYAP_17762
Length=348

 Score = 333 bits (855),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 245/357 (69%), Gaps = 23/357 (6%)

Query  1    MNILRVPEHGTT---------ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQV  51
            MNILR+P   T+         +     +PTSCEGYVTKRGHFRKSWRVRFLV++G++L V
Sbjct  1    MNILRLPLGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60

Query  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            SYY+S+          + PKGSFYLSS+E HEY VGV+GA +KPFGFKMVGHAP+KGYVE
Sbjct  61   SYYDSKEVARTAG---AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVE  117

Query  112  LDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQ  171
            LD+FV+TL D NKWLEV +NAL   ++LTR    ++++P  K+LFGFS      PA SPQ
Sbjct  118  LDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSPQ  169

Query  172  KQMQTLAKSKDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGD  231
            +QM+ +  +K+++L +A+ E+E+AKL+GR AC EI IQGE+LD I Q+L+ ++ DLD+ D
Sbjct  170  QQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYAD  229

Query  232  KLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGG---  288
            KLLR +K+P LH+FS D+R ++    +     R   S  S  +R     D+    GG   
Sbjct  230  KLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPL  289

Query  289  SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLS  345
            SD+ERLA  LGELE QA +LN EA   + Q+ER+   L +V  RV+ QT++A+A+++
Sbjct  290  SDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIA  346

>PYIR_13451
Length=359

 Score = 330 bits (845),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 243/363 (67%), Gaps = 23/363 (6%)

Query  1    MNILRVPEHGTTASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV+YY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  55   ESRAACHPPTGEPS----APKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYV  110
            ESR A    +         PKGSFY+SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  111  ELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSP  170
            ELD+FV++L D NKW+EV +NAL   ++ +R    Q  S   KT+FGFS + SPQ     
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT-KTMFGFSASASPQL----  175

Query  171  QKQMQTLAKSKDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFG  230
              Q++ LA +K++LL +ALRE+E AKL+GREA NEIV+QGEKLD +E DL  ++ DLD  
Sbjct  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  231  DKLLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGG--  288
            DKLLR +K P LHLFS D R K +  + G+S      S G +P              G  
Sbjct  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQR  293

Query  289  ----SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATL  344
                SDLE+LA ALGELE QA ++N EA  S++QI R+E  LT V  RV+ QTK+A+AT+
Sbjct  294  NDALSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATM  353

Query  345  SAG  347
             AG
Sbjct  354  KAG  356

>PYVX_18171
Length=294

 Score = 294 bits (752),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 216/340 (64%), Gaps = 62/340 (18%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            RPTSCEGYVTKRGHFRKSWRVR+LV+DG++L+V+Y+ES+ A        +A KG FYLSS
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  65

Query  79   IEPHEYVVGVMGAA---DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
            I+ H YV G MGA    +KPFGFKMVGHAPKKGY ELD+FV+TLAD  KWLEVA NAL  
Sbjct  66   IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125

Query  136  KRQLTRQAI-DQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealrelea  194
               ++R+A  D   S   K+LFGFS         SPQ+Q++ ++ SKDELL +ALRELE 
Sbjct  126  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  179

Query  195  aKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkst  254
            AKL+GREAC E+V+QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL + D      
Sbjct  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDL-----  234

Query  255  ggskgsspQRFHQSGGSSPSRLPPA-FDTSSDAGG--SDLERLAQALGELEVQAEMLNGE  311
                                R PP+   T S+AG   + LE+L                 
Sbjct  235  --------------------RRPPSPTKTLSNAGDGRAALEQL-----------------  257

Query  312  ASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
               S+QQI RIE  LT V  RV++QTKQA++ +  G  +F
Sbjct  258  ---STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYIW_19971
Length=348

 Score = 295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 237/364 (65%), Gaps = 36/364 (10%)

Query  1    MNILRVPE------HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            MNILRVP+      HG+   GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ +  
Sbjct  1    MNILRVPDMKLATSHGS--GGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGG  58

Query  55   ESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDV  114
               +         + PKGSF++SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+ELD+
Sbjct  59   GGASP--------ATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110

Query  115  FVDTLADRNKWLEVARNALSVKRQLTRQ--AIDQSVSPNKKTLFGFSVALSPQPAMSPQK  172
            FV+TL D NKW+EV +NAL   ++ TR   A D S + N   +FGFS  +SPQ       
Sbjct  111  FVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKN---MFGFSATVSPQL------  161

Query  173  QMQTLAKSKDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDK  232
            Q++ LA +K+ELL +ALRE+E AKL+GREA ++I  QG KL+ IE DL  ++ DLD G K
Sbjct  162  QVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGK  221

Query  233  LLRRLKSPTLHLFSDDsrpkstggskgsspQRFHQSGGSSPSRLPPAFDTSSDAGG----  288
            LL  +K P LHLFS+D+R K      GS         G+ PS    + +T++ A      
Sbjct  222  LLNHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQ  281

Query  289  -----SDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASAT  343
                 SDLERL  ALGELE QA  +N EA  S++QI R+E  LT V  RV+ QTK+A+AT
Sbjct  282  DTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATAT  341

Query  344  LSAG  347
            + AG
Sbjct  342  MKAG  345

>PYAR_13570
Length=322

 Score = 260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 217/326 (67%), Gaps = 29/326 (9%)

Query  36   SWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKP  95
            SWRVR+LV++G++L VSY++S+     P    ++PKGSFYLSS+E HEYVVGV+GA  KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPG---ASPKGSFYLSSVEKHEYVVGVLGAQKKP  64

Query  96   FGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTL  155
            FGFKMVGHAP+KGYVELD+FV++  D  KWLEV ++AL+  ++LTR  +  + S   K+L
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122

Query  156  FGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaKLVGREACNEIVIQG-----  210
            FGFS      PA SPQKQ+Q L+ SK+ELL +A+ E+E+AKL+GREAC EIV+QG     
Sbjct  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176

Query  211  ----------EKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgs  260
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++     S
Sbjct  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHS  236

Query  261  spQRFHQSGGSSPSRLPPAFDTSSDAGG--SDLERLAQALGELEVQAEMLNGEASHSSQQ  318
              +   QS  SS +R          A G  SD+ERLA  LGELE QA +LN EA   + Q
Sbjct  237  PVKS-KQSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQ  295

Query  319  IERIEHHLTNVTTRVEKQTKQASATL  344
            +ER+   L ++  RV+ QTK+A + +
Sbjct  296  VERVGDALAHINERVQNQTKKADSAV  321

>CCA18899
Length=343

 Score = 242 bits (617),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 148/339 (44%), Positives = 202/339 (60%), Gaps = 17/339 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QVSYYES+ +      + + PKGSF L S 
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDS---SKSKNATPKGSFILQSA  71

Query  80   EPHEYVVGVM---GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
            E HEY +  M      +KPFGFKMVGHAPK+GY+ELDVFVD+ +D ++WL+V  N L   
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  137  RQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaK  196
            + + R+A    +   K  L GFS         + ++Q+Q L   K + + EAL+++E AK
Sbjct  132  KCMAREAFMAEMDTTKSVL-GFSYI-----GTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185

Query  197  LVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstgg  256
              G  AC+EIV QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS          
Sbjct  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATI  245

Query  257  skgsspQRFHQSGG----SSPSRLPPAFDTSSDAGGSDLERLAQALGELEVQAEMLNGEA  312
            SK SS  R H   G    +   R             +D+E+LA AL +LEVQA+++N EA
Sbjct  246  SKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEA  305

Query  313  SHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
              S++QI RIE  L+ +  R++ QT Q   T S    LF
Sbjct  306  VKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQNLF  343

>CCI45123
Length=301

 Score = 193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 184/311 (59%), Gaps = 18/311 (6%)

Query  49   LQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVM---GAADKPFGFKMVGHAP  105
            +QVSYYES+ +        + PKGSF L ++E HEY +  M      ++PFGFKMVGHAP
Sbjct  1    MQVSYYESKDSY---KNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57

Query  106  KKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQ  165
            K+GYVELDVFVD+L++ ++WL+V  N L   +++ R+A    +   K  L GFS A    
Sbjct  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVL-GFSFA----  112

Query  166  PAMSPQKQMQTLAKSKDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDR  225
               + ++Q++ L   K + + EAL+++E AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171

Query  226  DLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQR--FHQSGGSSPSRLPPAFDTS  283
            DL+  +KL++ ++ P  + FS     +    SK ++  R   HQ+G     +     +  
Sbjct  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHV  231

Query  284  SD---AGGSDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQA  340
            ++      +DLE+LA AL ELEVQA+++N EA  S+ QI RIE  L+ +  R++ QT Q 
Sbjct  232  AEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQV  291

Query  341  SATLSAGPRLF  351
             A+ S    LF
Sbjct  292  VAS-SGKKNLF  301

>SPRG_06336
Length=335

 Score = 180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 188/336 (56%), Gaps = 28/336 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSYY+S+        +    KGSF L+ 
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAE  65

Query  79   IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NAL   + 
Sbjct  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KN  121

Query  139  LTRQA-IDQSVSPNKKTLFGF---SVALSPQPAMSPQKQMQTLAKSKDellsealrelea  194
            +T QA +DQ  S     L G    S  L+  P      Q++ + K+K+ELL +A+  LE 
Sbjct  122  VTPQASVDQRAS----ALLGHRAPSGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEH  172

Query  195  aKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkst  254
            A+ VG    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS     K  
Sbjct  173  ARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKG  232

Query  255  ggskgsspQRFH--QSGGSSPSR------LPPAFDTSSDAGGSDLERLAQALGELEVQAE  306
             GS  S   R H  Q+  +SP+          A   ++DAG  +L++L++ L  LEV A 
Sbjct  233  TGSPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHAN  292

Query  307  MLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASA  342
             ++ E   +++QI+RI+  +     R+ +Q+ +  A
Sbjct  293  TISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 186/335 (56%), Gaps = 26/335 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSY++S+        +    KGSF L+ 
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAE  65

Query  79   IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NAL  K  
Sbjct  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG-KNV  122

Query  139  LTRQAIDQSVSPNKKTLFGFSVA---LSPQPAMSPQKQMQTLAKSKDellsealreleaa  195
              + + DQ  +     L G   A   L+  P      Q++ + K+K+ELL +A+  LE A
Sbjct  123  APQASADQRAT----ALLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHA  173

Query  196  KLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstg  255
            + VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS     K   
Sbjct  174  RTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGA  233

Query  256  gskgsspQRFH--QSGGSSPSRLPPAFDTS------SDAGGSDLERLAQALGELEVQAEM  307
            GS  S   R H  Q+  +SP+   P+  TS      +DAG  +L++L++ L  LEV A  
Sbjct  234  GSPKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANT  293

Query  308  LNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASA  342
            ++ E   +++QI+RI+  +     RV +Q+ +  A
Sbjct  294  ISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H257_06294
Length=358

 Score = 152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 122/358 (34%), Positives = 185/358 (52%), Gaps = 37/358 (10%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
            K   TSCEGYVTKRGH  KSW+ R++V++G  L VSYY+S+   +   G    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-EIYTSKGH---PKGSFVL  62

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL---  133
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+V++  D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  134  SVKRQLTRQAIDQSVSPNKKTLFGFSVALS-PQPAM----------------SPQKQMQT  176
            S  ++   Q I++   P    L   SV L+ P+  M                S + QM+ 
Sbjct  121  SSPQKSMSQRIEEITGP---LLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKN  177

Query  177  LAKSKDellsealreleaaKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRR  236
            + K+  ELL +A+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L R 
Sbjct  178  VKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRS  237

Query  237  LKSPTL----HLFSDDsrpkstggskgsspQRFHQSGGSSPSRL---PPAFDTSSDAGGS  289
            LK P L    HLF+     K  G    +       S  S  SR+   PP    ++     
Sbjct  238  LKHPILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPED  297

Query  290  D-LERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346
            D L++L++ L +L   A+ ++   + +++Q++RI+  +T+V  RV+K+ K   A L A
Sbjct  298  DQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>H310_09223
Length=333

 Score = 144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/338 (31%), Positives = 171/338 (51%), Gaps = 22/338 (7%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
            K   TSCEGYVTKRGH  K+W+ R++V+ G  L V+YY+S+   +   G    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNG---PPKGSFVL  62

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
            S  E  +  +   G + KPFGFK +GH P +GY E  VFV+T  D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  137  RQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaK  196
              +   +++       K   G  ++L        + Q++ + K+  ELL +A+ + + A 
Sbjct  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172

Query  197  LVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstgg  256
             +G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+     K +  
Sbjct  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKR  232

Query  257  skgsspQRFHQSGGSS-PSRLPPAFDTS-------SDAGGSDLERLAQALGELEVQAEML  308
             K  +  +    G S+  SR+P                    L+ L++ L +L   A+ +
Sbjct  233  GKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTI  292

Query  309  NGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346
            +   + +++Q++RI+  +T+V  RV K+ K   + L A
Sbjct  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>CCI45127
Length=202

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 115/204 (56%), Gaps = 11/204 (5%)

Query  153  KTLFGFSVALSPQPAMSPQKQMQTLAKSKDellsealreleaaKLVGREACNEIVIQGEK  212
            K + GFS A       + ++Q++ L   K + + EAL+++E AK  G  AC+EIV QGE+
Sbjct  5    KGVLGFSFA-----GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQ  59

Query  213  LDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstggskgsspQR--FHQSGG  270
            L  +EQ+LS I+ DL+  +KL++ ++ P  + FS     +    SK ++  R   HQ+G 
Sbjct  60   LGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI  119

Query  271  SSPSRLPPAFDTSSD---AGGSDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLT  327
                +     +  ++      +DLE+LA AL ELEVQA+++N EA  S+ QI RIE  L+
Sbjct  120  LHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLS  179

Query  328  NVTTRVEKQTKQASATLSAGPRLF  351
             +  R++ QT Q  A+ S    LF
Sbjct  180  GINDRIQSQTTQVVAS-SGKKNLF  202

>PYAR_23286
Length=607

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 59/124 (48%), Gaps = 20/124 (16%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ V+ GS+  VSYY      + P G+P A   
Sbjct  379  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLA---  433

Query  73   SFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
                      E V+  +   D +PFGF  +       Y    V+ D   +R KW+   R 
Sbjct  434  ----------EVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALRK  479

Query  132  ALSV  135
              SV
Sbjct  480  LTSV  483

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W++R+ V+ G+ L+
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  221

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEGY+T+RGH   S R  + V++G++L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>PHYRA_84916
Length=1541

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  402  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLA----------  449

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                 V  V     +PFGF  + +     Y    V+ D   +RNKW+    NAL+
Sbjct  450  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  494

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  241

 Score = 39.3 bits (90),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>PYU1_G006347
Length=1095

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL +SYY      +   G+P A          
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKPLAEVA-------  442

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                 V  V     +PFGF  +       Y    V+ D   +RNKW+    NALS
Sbjct  443  -----VEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALS  484

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W+ R+ V+ G  L+
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE  227

 Score = 38.1 bits (87),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+T+RGH   S R+ + V++G++L+
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLR  322

>PYIW_17381
Length=952

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 60/132 (45%), Gaps = 21/132 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL ++Y+      +   G+P A          
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKPLA----------  450

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQL  139
                 V  V     +PFGF  +        V   V+ D   +RNKW+   R   +V  + 
Sbjct  451  --EVTVEDVQKWDGEPFGFMFMTSE----QVPYYVYADNDRERNKWMNALRKLTTVAEEP  504

Query  140  TRQAIDQSVSPN  151
            T   +++   PN
Sbjct  505  T---VEKKRCPN  513

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 23/104 (22%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            CEG++TKRGH   +W+ R+ V+ G+ L+    E +   +          GS  ++ + P 
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFSGEDKGKRY----------GSVTVAKVAPW  260

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                   G A   F F      P        V+  + A+R+KWL
Sbjct  261  S------GEAHG-FMFYTTKQVP------YYVYASSEAERSKWL  291

 Score = 38.1 bits (87),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 5/42 (12%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            CEGY+T+RGH   S R+ + V++G++L     Q +Y E+++A
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  347

>HYAP_08645
Length=1514

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 24/116 (21%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL +SYY      +   G P A          
Sbjct  305  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLA----------  352

Query  80   EPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
               E +V  + + D +PFGF  + +     Y    V+ D   +RNKW+    NAL+
Sbjct  353  ---EVLVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  397

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 51/116 (44%), Gaps = 29/116 (25%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAACHPPTGEPSAPKGSFYL  76
            SCEGY+TKRGH   S R+ + V++G++L     Q +Y E+++A                +
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSAM-----------AEVEI  255

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
             S+ P E      G  +      + G+          V  DT+ ++ KWL   + +
Sbjct  256  RSVAPWE------GETNGLMFMTVTGNV-------FYVIADTVGEQQKWLATVKKS  298

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            CEGY+TKRGH   +W+ R+  + G+ L+  YY
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  142

>PHYSO_361747
Length=1523

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  411  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLA----------  458

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                 V  V     +PFGF  +       Y    V+ D   +RNKW+    NAL+
Sbjct  459  --EVLVEDVQKWDGEPFGFMFMTTEQVPYY----VYADNDRERNKWM----NALN  503

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  250

 Score = 38.9 bits (89),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>CCI44752
Length=1526

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (45%), Gaps = 18/125 (14%)

Query  6    VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            V  H  T + +   P +C GY+TK+GH RKSW+ R+ ++ G+   +SYY+     +   G
Sbjct  401  VSNHSNTTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNAKG  458

Query  66   EPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
            +         L+ ++    V  V     + FGF  +       Y    V+ D   +R KW
Sbjct  459  KA--------LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW  502

Query  126  LEVAR  130
            +   R
Sbjct  503  MSALR  507

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 46/107 (43%), Gaps = 23/107 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGY+TKRGH   +W+ RF V+ G+ L+  YY S         E +   GS  ++ + P  
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPWS  272

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                  G A   F F      P        V+  + A++ KWL   R
Sbjct  273  ------GEAHG-FMFYTTKQIPYY------VYAASEAEKTKWLRALR  306

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEGY+T+RGH   S RV + V+ G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

>PYIR_21589
Length=1568

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 59/132 (45%), Gaps = 20/132 (15%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL ++YY      +   G   A          
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRALA----------  450

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQL  139
                 V  V     +PFGF  +       Y    V+ D   +RNKW+   R   +V  + 
Sbjct  451  --EVTVEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEP  504

Query  140  TRQAIDQSVSPN  151
            T  ++++   PN
Sbjct  505  T--SLEKKRCPN  514

 Score = 39.7 bits (91),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W+ R+ V+ G+ L+
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE  238

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            SCEGY+T+RGH   S R+ + V++G++L     Q +Y ++++A
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRDNQSA  347

>PPTG_18898
Length=1559

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 52/114 (46%), Gaps = 22/114 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  405  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  452

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                 V  V     +PFGF  + +     Y    V+ D   +R KW+    NAL
Sbjct  453  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM----NAL  496

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S         E S   G+  +  + P 
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  262

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                   G A   F F      P        V+  + A+R++WL   ++ +
Sbjct  263  S------GEAHG-FMFYTTKQIP------YYVYASSEAERSRWLRALKDFM  300

 Score = 39.3 bits (90),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

>PITG_20562
Length=1559

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 52/114 (46%), Gaps = 22/114 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  406  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  453

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                 V  V     +PFGF  + +     Y    V+ D   +R KW+    NAL
Sbjct  454  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM----NAL  497

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 23/111 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S         E S   G+  +  + P 
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  263

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                   G A   F F      P        V+  + A+R++WL   ++ +
Sbjct  264  S------GEAHG-FMFYTTKQIP------YYVYASSEAERSRWLRALKDFM  301

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

>PHYKE_1990
Length=1499

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 52/115 (45%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ ++ GS   +SYY      +   G+  A          
Sbjct  403  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALA----------  450

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
                 V  V     +PFGF  +       Y    V+ D   +RNKW+    NAL+
Sbjct  451  --EVLVEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  495

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  242

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

>PYVX_20438
Length=1346

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 53/119 (45%), Gaps = 18/119 (15%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ ++ G++  +SY+      +   G+  A          
Sbjct  316  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKALA----------  363

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138
                 V  V     +PFGF  +       Y    V+ D   +RNKW+   R   +V  +
Sbjct  364  --EVTVEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLNAVDEE  416

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  Y+ S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

 Score = 38.1 bits (87),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            SCEGY+TKRGH   S R+ + V+ G+ L     Q +Y E+++A
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  260

>CCA18875
Length=1514

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (45%), Gaps = 18/125 (14%)

Query  6    VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            V  H  T + +   P +C GY+TK+GH RKSW+ R+ ++ G+   +SYY+     +   G
Sbjct  401  VFNHTNTLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANHVKG  458

Query  66   EPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
            +         L+ ++    V  V     + FGF  +       Y    V+ D   +R KW
Sbjct  459  KA--------LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW  502

Query  126  LEVAR  130
            +   R
Sbjct  503  MSALR  507

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            EGY+TKRGH   +W+ RF V+ G+ L+  YY S
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSS  253

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEGY+T+RGH   S RV + V+ G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

>H257_06722
Length=1482

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 20/119 (17%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
            A+    +P +C G++TK+GH RKSW+ R+ V+ G+ L  +YY    A +   G+P     
Sbjct  342  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLG---  396

Query  73   SFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                      E  V  + A D +P GF  + +     Y    VF D   D+ KWL   R
Sbjct  397  ----------EVTVREVSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALR  441

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            CEGY+TKRGH   S+R+R+ V+ GS ++  YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  285

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 26/44 (59%), Gaps = 3/44 (7%)

Query  13   ASGDKARPTS--CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            AS D + P+     GY+TKRGH   +W+ RF V+     ++SYY
Sbjct  143  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  185

>SDRG_12763
Length=1317

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  11   TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            TT      +P SC GY+TK+GH RKSW+ R+ V+ G+ L  SYY
Sbjct  212  TTNVASAIKPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY  253

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 54/136 (40%), Gaps = 29/136 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            C GY+TKRGH   +W+ RF V+    + + YY   +             G  +L  + P 
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADDSMV--------KKLGQVHLVKVAPW  60

Query  83   EYVVGVMGAA---------DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL-------  126
            EY     G +         +  FGF M     +  Y    V+ +  A+R +WL       
Sbjct  61   EYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLY  116

Query  127  EVARNALSVKRQLTRQ  142
             V  NA   +  LT++
Sbjct  117  VVTSNATDCEGYLTKR  132

>SPRG_06058
Length=1258

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 61/138 (44%), Gaps = 22/138 (16%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ V+ G+ L  SYY    A +   G+         L
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  192

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
            S +   +  VG        F F  + + P        VF D   D+ KW+   + A+   
Sbjct  193  SDVSLKD--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGAD  244

Query  137  RQLTRQAIDQSVSPNKKT  154
              L  + ID+   P KK 
Sbjct  245  -TLAIETIDE---PEKKC  258

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 2/42 (5%)

Query  18  ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           ARP  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  42  ARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  81

>PYAP_16997
Length=1018

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 20/119 (17%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ V+ G++  ++Y+      +   G+  A   
Sbjct  392  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKALA---  446

Query  73   SFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                      E +V  +   D +PFGF  +        V   V+ D   +R KW+   R
Sbjct  447  ----------EVIVEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  491

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 52/119 (44%), Gaps = 23/119 (19%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
            +CEG++TKRGH   +W++R+ V+ G+ L+  Y+           + S   GS  +  + P
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFSG--------DDKSKRYGSVIVEKVAP  255

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLT  140
                    G A   F F      P        V+  + A+R KWL   R+ +    ++T
Sbjct  256  WS------GEAHG-FMFYTTKQVPYY------VYASSEAERAKWLRALRDFMVEPEEVT  301

 Score = 35.0 bits (79),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEG++T+RGH   S R  + V++G++L+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>PHYKE_2479
Length=171

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 7/53 (13%)

Query  5    RVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            R P   +T+S  K      EGYVTKRGH  ++W++RF  ++G NL VSYYE++
Sbjct  62   RPPHSNSTSSRSK-----WEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>H310_00230
Length=1248

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 53/119 (45%), Gaps = 22/119 (18%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSF  74
            G   +P +C GY+TK+GH RKSW+ R+ V+ G+ L  SYY         T   SA K   
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY---------TDYESANKQCL  266

Query  75   YLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                IE  +   G M       GF          Y    V+ DT  +R KWL VA  AL
Sbjct  267  AEVGIEDVQVWDGEM------HGFMFTTTEQVMYY----VYADTERERQKWL-VALKAL  314

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
           C GY+TKRGH   +W++RF V+   +  +SYYE  +         S   G  +L+ + P 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESM--------SKKLGQVHLAKVAPW  62

Query  83  EY  84
           EY
Sbjct  63  EY  64

>PYU1_G001063
Length=783

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYES+ 
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKV  179

>PYAP_17290
Length=835

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
             EGYVTKRGH  ++W++RF  ++G+NL  SYYE++ 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  185

>PYIW_13172
Length=939

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYES+ 
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  182

>PYIR_15309
Length=937

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYES+ 
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

>SPRG_06059
Length=1312

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 2/44 (5%)

Query  11   TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            TT      +P SC GY+TK+GH RKSW+ R+ V+ G  L  +YY
Sbjct  214  TTNVASAIKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY  255

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 62/153 (41%), Gaps = 28/153 (18%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            C GY+TKRGH   +W+ RF V+    +   Y +   A            G  +L  + P 
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMA---------KKLGQVHLVKVAPW  62

Query  83   EYVVGVM---------GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            EYV             G+ +  FGF M     +  Y    V+ +  A+R KWL   ++  
Sbjct  63   EYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDLY  118

Query  134  SVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQP  166
             V    T  A D      K+T  GFS  LS +P
Sbjct  119  VV----TSNATDCEGYLTKRTP-GFSF-LSSRP  145

>H310_00231
Length=1495

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (46%), Gaps = 18/112 (16%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            +P +C G++TK+GH RKSW+ R+ V+ G+ L  +YY    A +      S P G   +  
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASN---MRHSRPLGEVTVRE  402

Query  79   IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
            +   +          +P GF  V +     Y    VF D   D+ KWL   R
Sbjct  403  VSTWD---------GEPGGFMFVTNDNVPYY----VFADNERDQAKWLTALR  441

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEGY+TKRGH   S+R+R+ V+ G++++
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (43%), Gaps = 22/103 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            GY+TKRGH   +W+ RF V+     ++SYY                 G  +L  + P   
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGM--------KKKLGEVHLEKVSPWS-  206

Query  85   VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLE  127
                 G A+   GF M   + +  Y    V+  T ++R +WLE
Sbjct  207  -----GEAN---GF-MFYTSKQIAYY---VYASTNSERRRWLE  237

>H257_06721
Length=1238

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            G   +P +C GY+TK+GH RKSW+ R+ V+ GS L  SYY
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 11/63 (17%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK-GSFYLSSIEP  81
           C GY+TKRGH   +W++R+ V+   +  +SYYE          E  A K G  +L+ + P
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYED---------ESMAKKLGQVHLAKVAP  63

Query  82  HEY  84
            EY
Sbjct  64  WEY  66

>PYAR_19914
Length=788

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYE++ 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKV  178

>PYVX_13574
Length=950

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G NL VSYYES+ 
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESKV  191

>CCI41225
Length=981

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G+ L  SYYES+ 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKV  172

>PHALS_06533
Length=930

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  143

>PITG_18067
Length=924

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   TTASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  90   SMSSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PPTG_13401
Length=927

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   TTASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  90   SMSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PYIR_17453
Length=2619

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (47%), Gaps = 7/113 (6%)

Query  23    CEGYVTKRGHFR-KSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
             CEGYV  R HF   +WR RF V++ + L +  Y   +A      E  A +    ++  + 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQKALEKHDLIAVKKW  2217

Query  82    HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS  134
             H      +G     FGF++   A   GY+E  V ++   ++ KWL    NA+S
Sbjct  2218  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIED--EQTKWLAAITNAVS  2266

 Score = 32.3 bits (72),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query  10    GTTASGDKA---RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGE  66
             G   SG +A   R    EGY+ KRGH   S R R+ V+  + L+  Y+    A H  +  
Sbjct  1205  GDDDSGSEAGSNRQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YF----ATHEDSRN  1258

Query  67    PSA-PKGSF  74
             P+  P GSF
Sbjct  1259  PAIRPHGSF  1267

>PHYRA_77834
Length=936

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  151

>CCI42457
Length=906

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYV KRGH  ++W++RF  ++G+  +VSYYES+ 
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKG  162

>CCA16487
Length=975

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G+ L  SYYE++ 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKV  170

>PHYCA_503112
Length=214

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EGYVTKRGH  ++W+ RF  ++G NL VSYYE++
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>PYU1_G008848
Length=765

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 57/129 (44%), Gaps = 20/129 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +S + P  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----RGRMIISKVRPEN  187

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS--VKRQLTR  141
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+   VK  +  
Sbjct  188  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNG  235

Query  142  QAIDQSVSP  150
             ++D  V P
Sbjct  236  NSMDSDVVP  244

>CCA17102
Length=884

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYV KRGH  ++W++RF  ++G+ L  SYYES+ 
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKG  142

>PPTG_19371
Length=1195

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (43%), Gaps = 26/147 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  124

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS--VKRQLTR  141
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+   V+   +R
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  142  ------QAIDQSVSPNKKTLFGFSVAL  162
                  +A+    SP +  L GF  A 
Sbjct  173  LSMEGMEALQMQTSPTQVDLRGFYFAF  199

>SDRG_12762
Length=1392

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            P  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  292

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 55/120 (46%), Gaps = 20/120 (17%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ V+ G+ L  SY+    A +   G+  +      +
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKALS---EVSV  408

Query  77   SSIEPHE-YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
              + P +  V G M        F  + + P        VF D   D+ KW+   + A+ +
Sbjct  409  KDVAPWDGEVCGFM--------FVTLENVPYY------VFADNERDQAKWMTALKKAVGL  454

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            GY+TKRGH   +W+ RF  +  S  ++SYY
Sbjct  164  GYLTKRGHVITNWKTRFFALR-SQGRLSYY  192

>PYIR_18382
Length=1154

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 56/129 (43%), Gaps = 20/129 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +S + P  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----RGRMIISKVRPEN  182

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS--VKRQLTR  141
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+   VK  L  
Sbjct  183  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNG  230

Query  142  QAIDQSVSP  150
             ++D    P
Sbjct  231  SSVDPETLP  239

>PYIW_21108
Length=2593

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 8/130 (6%)

Query  6     VPEHGTTASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVVDGSNLQVSYYESRAACHPPT  64
             + +   ++ G  A+    EGYV  R HF  + WR RF V++G+ L +  Y   +A     
Sbjct  2139  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL--YTDSSAAMDED  2196

Query  65    GEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNK  124
              E +A +    ++  + H      +G+  + FGF++   A   GY+E    V T  ++ K
Sbjct  2197  RERTALEKHDLIAVEKWHPTYSANLGSGSR-FGFRVENEA--GGYLECT--VTTEDEQTK  2251

Query  125   WLEVARNALS  134
             WL V  +A+S
Sbjct  2252  WLAVVSDAVS  2261

 Score = 33.5 bits (75),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 31/66 (47%), Gaps = 6/66 (9%)

Query  10    GTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSA  69
             G +  G   R    EGY+ KRGH   S R R+ V+   N  + Y+    A H  +  P+ 
Sbjct  1220  GDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVL-LKNASLEYF----ATHEDSRNPAI  1274

Query  70    -PKGSF  74
              P GSF
Sbjct  1275  RPHGSF  1280

>PHYRA_82543
Length=1199

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 63/147 (43%), Gaps = 26/147 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  114

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTR--  141
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+    + T+  
Sbjct  115  Y--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAIEEGVRHTQSS  162

Query  142  ------QAIDQSVSPNKKTLFGFSVAL  162
                  +A+    SP +  L GF +A 
Sbjct  163  MSMEGMEALQMQSSPTQVDLRGFYLAF  189

>PITG_19213
Length=1201

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 63/147 (43%), Gaps = 26/147 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   ++ + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIINKVRPEN  124

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS--VKRQLTR  141
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+   V+   +R
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  142  ------QAIDQSVSPNKKTLFGFSVAL  162
                  +A+    SP +  L GF  A 
Sbjct  173  LSMEGMEALQLQTSPTQVDLRGFYFAF  199

>PYAP_18636
Length=1009

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 61/140 (44%), Gaps = 26/140 (19%)

Query  13   ASGDKARPTSC------EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGE  66
            ASG    PT        EGYV K+G +   W  R+LV+DG+ L  +YY ++      +G 
Sbjct  86   ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR--SGR  141

Query  67   PSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                +G   +S + P  Y         K  GF +       G+    +   T  +++ W+
Sbjct  142  --NLRGRMIISKVRPENY--------GKAHGFLL----ETMGHKHFHLCCSTELEKDMWV  187

Query  127  EVARNAL--SVKRQLTRQAI  144
            E+ + A+   VK +L R  I
Sbjct  188  EMMQAAIDEGVKHKLERSLI  207

>CCI10489
Length=777

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ KRGH  +SWR RF V+ G+ L  SYY S+
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PHALS_06699
Length=884

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 55/133 (41%), Gaps = 14/133 (11%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK  71
            T++ D A   S  G++ KRGH  K+W+ R+ V+  S L+   Y S A C    GE     
Sbjct  325  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEV----  377

Query  72   GSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
               +      H   V V G  D  F  + VG         L +  + L+DR  W+    +
Sbjct  378  -LLFHPQTCVHYVDVHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIED  430

Query  132  ALSVKRQLTRQAI  144
            AL  +     Q +
Sbjct  431  ALLCRDSYQNQQV  443

>PHYSO_556164
Length=765

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 55/135 (41%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  214  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCSKLKGEV-----LLF  265

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                  H   V V G  D  F  ++    P      L +    L DR  W+    +AL  
Sbjct  266  HPQTRVHYVDVHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDALLC  319

Query  136  KRQLTRQAIDQSVSP  150
            +     Q + +   P
Sbjct  320  RDSYHPQGMTEGPEP  334

>PHYSO_544598
Length=1163

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/148 (24%), Positives = 60/148 (41%), Gaps = 27/148 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  72

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL---------S  134
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+         S
Sbjct  73   Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  120

Query  135  VKRQLTRQAIDQSVSPNKKTLFGFSVAL  162
                   +A+    SP +  L GF  A 
Sbjct  121  RVSMEGMEALQMQASPTQVDLRGFYFAF  148

>PITG_11303
Length=293

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

>PHALS_03540
Length=904

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 8/79 (10%)

Query  4   LRVPEHGTTASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH  61
           L+       A+G  AR + C+  G+  K+G   KSW+ RF V+ G  L   Y+E R+   
Sbjct  23  LKATSRNVIAAGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERS---  77

Query  62  PPTGEPSAPKGSFYLSSIE  80
            P+G+    KG   +S +E
Sbjct  78  -PSGKGIDEKGRLRISGVE  95

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++ KRG     W+ R+ ++ G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>PITG_17893
Length=747

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 51/118 (43%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  212  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEV-----LLF  263

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                  H   V V G  D  F  + VG      Y  L +    L DR  W+    +AL
Sbjct  264  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  315

>PYIW_16987
Length=821

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 26/114 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY----ESRAACHPPTGEPSAPKGSFYLSSI  79
            EGYV K+G +   W  R+LV+DG+ L  +YY    E+R+A +         +G   +S +
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  169

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  170  RPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>SDRG_00080
Length=298

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 24/109 (22%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P +  GYV K+G F K+W+ R++V+    L   YY S  A        + P+G F     
Sbjct  70   PPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT-------TKPRGFF-----  115

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYV------ELDVFVDTLADR  122
                 V G+  A D P G    G   ++         E D + DTL++R
Sbjct  116  ----RVTGIAYAPDLPHGLIADGTGTRRLKFTLADNDECDAWYDTLSER  160

>PYAR_15463
Length=1091

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG+ L  +YY S+      +G     +G   +S + P  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEAR--SGR--NLRGRMIISKVRPEN  131

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  132  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>PHYRA_73535
Length=875

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 54/135 (40%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y +  +C    GE        +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEV-----LLF  384

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                  H   V V G  D  F  ++    P+     L +    L DR  W+    +AL  
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDALLC  438

Query  136  KRQLTRQAIDQSVSP  150
            +     Q +     P
Sbjct  439  RDSYHPQGMTSGPGP  453

>PPTG_04553
Length=904

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 51/118 (43%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    GE        +
Sbjct  355  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGE-----VLLF  406

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                  H   V V G  D  F  + VG      Y  L +    L DR  W+    +AL
Sbjct  407  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  458

>SDRG_05567
Length=980

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 56/132 (42%), Gaps = 22/132 (17%)

Query  13   ASGDKARPTS-------CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            AS   A+PT+         GY++KRG +RK+W+ R+ ++   +  + Y +S         
Sbjct  118  ASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQ  177

Query  66   EPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
             P  P      +SI          G    PF F++  H P++    L +   T+ +  KW
Sbjct  178  VPITPNTRVIDNSI----------GCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRKW  222

Query  126  LEVARNALSVKR  137
            +   R  + + R
Sbjct  223  IRSIRETVELVR  234

>H257_09823
Length=654

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (43%), Gaps = 8/110 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RK+W+ RF V+DGS LQ  Y+        P  +    KG   L   +   +
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLLFHKDTTVH  322

Query  85   VVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             V + +   D  F  +  G     G   L +   +L +R  W+     A+
Sbjct  323  YVDIHLTGRDYTFAVETSG-----GDYSLVLQAASLDEREDWIFAIEEAI  367

>CCI39367
Length=2046

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 49/163 (30%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++ K+GH  KSWRVRF V+  DG+   ++YY  R       G+    KG      I+ +
Sbjct  86   GWLRKQGHLWKSWRVRFFVLYTDGT---LAYYRKR-------GDVKM-KG-----YIKLN  129

Query  83   EYVVGVM----GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138
            E ++G+        ++ + F++     +KG+  L     T  +   W+ V R+       
Sbjct  130  EGIIGIQYIDAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSVLRS-------  177

Query  139  LTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSK  181
             TRQ     ++P  KT F  +         +P+++M ++A ++
Sbjct  178  -TRQ-----LAPPDKTEFDLT---------APEERMASIAVAR  205

>CCA18023
Length=1138

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +  + P  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  178

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  179  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  216

>H257_03361
Length=699

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (62%), Gaps = 7/60 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
           +G++ K+G    SW+ R+LV+ G N  +SY++ +   +P   E    KGSF L+ ++P++
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKE----KGSFVLAGVQPNK  63

>PYVX_13312
Length=1016

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+      +G     +G   LS + P  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEAR--SGRNL--RGRMQLSRVRPEN  129

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+
Sbjct  130  Y--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>CCI46235
Length=1155

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG+ L  +YY ++             +G   +  + P  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  173

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  174  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>SPRG_06021
Length=983

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 49/113 (43%), Gaps = 15/113 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            GY++KRG +RK+W+ R+ ++   +  + Y +S          P  P      +SI     
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPITPNTRVIDNSI-----  193

Query  85   VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
                 G    PF F++  H P++    L +   T+ +  KW+   R  + + R
Sbjct  194  -----GCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVR  236

>H257_03093
Length=975

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG++L  +YY S+      T      +G   ++ + P  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNL----RGRMIITKVLPEN  157

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  158  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  195

>PYVX_18338
Length=746

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query  9    HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            HG   S + A  T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  70   HG---SIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>PHYSO_343629
Length=977

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
            EGYVTKRGH  ++W++RF  ++G+ +  ++
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>SPRG_16312
Length=261

 Score = 39.3 bits (90),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 24/109 (22%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P    GYV K+G F K+W+ RF+V+    L   YY S  A        + P+G F ++S 
Sbjct  38   PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTS-  87

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYV------ELDVFVDTLADR  122
                    V  A D P G    G   ++         E D + DTL++R
Sbjct  88   --------VAYAPDLPHGLIADGTGTRRLRFTLADSDECDAWYDTLSER  128

>PHYRA_73534
Length=1210

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 54/135 (40%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y +  +C    GE        +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGE-----VLLF  384

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
                  H   V V G  D  F  ++    P+     L +    L DR  W+    +AL  
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDALLC  438

Query  136  KRQLTRQAIDQSVSP  150
            +     Q +     P
Sbjct  439  RDSYHPQGMTSGPGP  453

>H310_06378
Length=837

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V K+GH  ++W+VR+  ++G+ L  SYYE++
Sbjct  58  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>PHYCA_506137
Length=810

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYSO_344112
Length=813

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PPTG_05519
Length=810

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PYIW_18480
Length=755

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EGYV K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>H257_13567
Length=836

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V K+GH  ++W+VR+  ++G+ L  SYYE++
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>PITG_02762
Length=810

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYRA_79281
Length=809

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>HYAP_08026
Length=798

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>SPRG_09128
Length=620

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            G++ K GH RKSW+ RF V+DGS LQ  YY
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  295

>SDRG_01407
Length=815

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (44%), Gaps = 18/119 (15%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSF  74
            G  A     EGYV K+G +   W  R+LV+DG++L  +YY ++             +G  
Sbjct  76   GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNL----RGRM  129

Query  75   YLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             ++ + P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  130  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  176

>PYAP_22646
Length=815

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>SPRG_14312
Length=661

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 58/133 (44%), Gaps = 19/133 (14%)

Query  3    ILRVPEHGTTASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH  61
            I   P+H   A   D   P S  G + K+ +  K+W+ RF+V+ G +L   YY S AA  
Sbjct  90   ITSFPDHNPEAECPDFYAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYYVSGAA--  145

Query  62   PPTGEPSAPKGSFYLSSIEPHEYVVGVMGAA--DKPFGFKMVGHAPKKGYVELDVFVDTL  119
                E S PKG   L  +E     V ++  A   K F F++        Y  L +     
Sbjct  146  ---SEDSYPKGLISLVGVE-----VQLVDVARFKKQFCFEL----SHPYYRPLYLMAKNE  193

Query  120  ADRNKWLEVARNA  132
            AD  +W+   ++A
Sbjct  194  ADLTQWMSCIKSA  206

>PYIW_19873
Length=185

 Score = 38.1 bits (87),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (48%), Gaps = 9/123 (7%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH--PPTGEPSAPKGSFYLSSIEP  81
            EG++ K+GH  ++ + R+ V+    L  SY+ ++       P   PS+ KG   L+  + 
Sbjct  56   EGFLVKKGHVLRTQKERYFVLRAHTL--SYFRAKWGEKKGKPAMLPSSLKGVLELAPSD-  112

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTR  141
               +V     +D+ F  + +  A  K Y +LD+ V    +R +W++  R A      L +
Sbjct  113  ---IVTPAPHSDQWFRIQKLPDAGGKSY-KLDLKVANAEERQEWIDAIRGACRNTLLLKQ  168

Query  142  QAI  144
            QA+
Sbjct  169  QAM  171

>CCA21715
Length=782

 Score = 39.3 bits (90),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 39.3 bits (90),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>H310_04843
Length=968

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG++L  +YY S+      TG+    +G   ++ + P  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEAR--TGK--NLRGRMIITRVLPEN  156

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  157  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  194

>SDRG_08800
Length=881

 Score = 39.3 bits (90),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V+K+GH  ++W++R+  ++ SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>H310_00912
Length=2182

 Score = 39.7 bits (91),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 22/126 (17%)

Query  24    EGYV-TKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
             EG+V  +R HF  +W+  + V+ G  L  + Y++R       G+P++ +   ++      
Sbjct  1797  EGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKREVVFVG-----  1849

Query  83    EYVVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS-------  134
             ++  GV  G A   F  + +    + G+VE   +VD  AD+ +W++  + A+S       
Sbjct  1850  DWYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLKADQL  1903

Query  135   VKRQLT  140
             V R LT
Sbjct  1904  VTRDLT  1909

>H257_05175
Length=678

 Score = 39.3 bits (90),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 64/121 (53%), Gaps = 27/121 (22%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            EG++TKR  H    W  R+ +++GSNL+  YY+ R       G+P+ P+G++ L+    +
Sbjct  2    EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83   EYVVGVMGAA-------DKPFGFKM---VGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            E VVG +  +       D+ + F++   VG A +K Y + D F+D  A   K  E  + A
Sbjct  48   ECVVGKVFNSEEKHKHHDQVWMFRITFSVG-AGEKSY-KKDRFIDLGAKDEKMAEAWKKA  105

Query  133  L  133
            L
Sbjct  106  L  106

>PHALS_04098
Length=1183

 Score = 39.3 bits (90),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 33/145 (23%), Positives = 63/145 (43%), Gaps = 24/145 (17%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +  + P  
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNM----RGRMTVYKVRPEN  128

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALS--VKRQLTR  141
            Y         K  GF +   + K    +  +   T  +++ W+E+   A+    +++ +R
Sbjct  129  Y--------GKAHGFLLETQSHK----QFHLCCATELEKDMWVEMMHAAVEEGARQRNSR  176

Query  142  QAID----QSVSPNKKTLFGFSVAL  162
             +++      +SP +  L GF  A 
Sbjct  177  LSVEGMEILQISPTQVDLRGFYFAF  201

>PYVX_23349
Length=924

 Score = 39.3 bits (90),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (44%), Gaps = 18/114 (16%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL--SSI  79
            S  G++ K GH RK+W+ R+ V++ S L+    ESR+            KG   L   + 
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL----------KGEVLLFHPAT  493

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
              H   + + G  D  F  + VG      Y  L +  + L+DR  W+    +AL
Sbjct  494  RVHYVDIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>PPTG_14630
Length=398

 Score = 38.9 bits (89),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+V+ G   Q++YY++      PT +   PKGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDTSKLV--PTVK---PKGSFQVITVE  60

>PHYKE_5678
Length=809

 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPT  64
            T  EGY+ K+GH  +SWR R+ V+ G  +  SYY S+      T
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSKEVAKTDT  141

>H310_04667
Length=680

 Score = 38.9 bits (89),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 75/153 (49%), Gaps = 31/153 (20%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            EG++TKR  H    W  R+ +++GSNL+  YY+ R       G+P+ P+G++ L+    +
Sbjct  2    EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83   EYVVGVMGAA-------DKPFGFKM---VGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            E +VG +  +       D+ + F++   VG A +K Y + D F+D  A   K  E  + A
Sbjct  48   ECIVGKVFNSEEKHKHHDQVWMFRITFSVG-AGEKSY-KKDRFIDLGAKDEKMAEAWKKA  105

Query  133  LSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQ  165
            L    + T  AI +     +  L G  V   P+
Sbjct  106  L----EQTISAIKEVAGVKEDFLKGADVGKVPE  134

>SPRG_11900
Length=605

 Score = 38.9 bits (89),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 3/47 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            +P  C GY+ K+G   K+WR R+  +DG + Q+SY ++  A  PP G
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDADGA--PPKG  277

 Score = 35.0 bits (79),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 7/55 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
           G+V K+G   KSW+ RFLVV G +  V+YY+   + H P       KGS  L  +
Sbjct  7   GFVFKQGALIKSWKKRFLVVQGRH--VTYYDR--SVHEPNPR---EKGSLVLVDV  54

>PYIW_20891
Length=291

 Score = 38.5 bits (88),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RFLV+ G   Q++YY++ A+  P T E    KGSF + ++E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPKTKE----KGSFQVITVE  57

>SPRG_05449
Length=723

 Score = 38.9 bits (89),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V+K+GH  ++W++R+  ++ SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PYU1_G004386
Length=837

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            D    T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>SDRG_04871
Length=687

 Score = 38.5 bits (88),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+NL+  YY+ R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLT  46

>SPRG_08217
Length=687

 Score = 38.5 bits (88),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (62%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+NL+  YY+ R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLT  46

>PHALS_03645
Length=830

 Score = 38.9 bits (89),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            D    T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  96   DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  135

>H310_13627
Length=678

 Score = 38.5 bits (88),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (42%), Gaps = 8/110 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K+GH  K+W+ RF V+DGS L+  Y+        P       KG   L   +   +
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLKGEVLLFHKDTTVH  327

Query  85   VVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             V + +   D  F     G     G   L +   +L +R  W+    +A+
Sbjct  328  YVDIHLSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAI  372

>SPRG_00890
Length=883

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG++L  +YY ++             +G   ++ + P  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNL----RGRMIITRVLPEN  84

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  85   Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  122

>SPRG_17022
Length=107

 Score = 36.2 bits (82),  Expect = 0.060, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PITG_02109
Length=522

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+V+ G   Q++YY++ +  +P       PKGSF + ++E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNPTV----KPKGSFQVITVE  186

>PHYCA_504801
Length=398

 Score = 38.1 bits (87),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+V+ G   Q++YY++ A  +P T      KGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNPTT----KAKGSFQVITVE  60

>SDRG_05608
Length=121

 Score = 36.2 bits (82),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 50/127 (39%), Gaps = 33/127 (26%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG-------  65
            A  D A+P   EG +TKR  + K WR R+ V+ G+ L    Y  RA    P G       
Sbjct  3    AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  57

Query  66   ----------------EPSAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKK  107
                            E + P+ ++Y+   S E  +  +G +G A   F     G     
Sbjct  58   LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---D  114

Query  108  GYVELDV  114
            GY E DV
Sbjct  115  GYDEEDV  121

>SDRG_14286
Length=670

 Score = 38.5 bits (88),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            G++ K GH RK+W+ RF V+DGS LQ  YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>PYAP_16161
Length=889

 Score = 38.5 bits (88),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
           EGY+ K+G   K W+ R+ V DG  L  SYY SR    P
Sbjct  30  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  66

>PYAR_19883
Length=833

 Score = 38.5 bits (88),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  ++WR R+ ++ G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  134

>PYIR_13120
Length=814

 Score = 38.5 bits (88),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>PYAP_13695
Length=348

 Score = 37.7 bits (86),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 61/133 (46%), Gaps = 21/133 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K+G   K+W+ RF+V+ G   Q++YY++     P   E    KGSF + ++E    
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSFQVITVEL---  61

Query  85   VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQAI  144
                  ++D   G  + G    +G   L ++ D+  + N W     +A +        A+
Sbjct  62   ------SSDIQNGLIVHG----RGGRVLKLYTDSTDNTNGWYHAIMDATNNTGGGGGSAV  111

Query  145  DQSVSPNKKTLFG  157
            D+ +S    TL G
Sbjct  112  DR-LSDRYSTLSG  123

>H310_07070
Length=680

 Score = 38.1 bits (87),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 14/117 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D   PTS  G + K+ +  K+W+ RF+V+ G ++   YY S       T E + P+G   
Sbjct  114  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGT-----TSEETYPRGVIS  166

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            LS ++ H   V       K F F+ + H     Y  L +     AD  +W+   ++A
Sbjct  167  LSGVDVHPLDVSKF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>PHYKE_6662
Length=765

 Score = 38.1 bits (87),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (42%), Gaps = 32/146 (22%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+L++DG+ L  +YY S+             +G   +  + P  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIIVKVRPEN  125

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQA  143
            Y         K  GF +      +G+    +   T  +++ W+E           + + A
Sbjct  126  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVE-----------MMQAA  162

Query  144  IDQSV--SPNKKTLFGF-SVALSPQP  166
            I++ V   PN  +L G  ++AL   P
Sbjct  163  IEEGVRHGPNSMSLEGMDALALQASP  188

>PHYKE_4910
Length=375

 Score = 37.7 bits (86),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query  11   TTASGDKAR--PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            TT SG   R  P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  114  TTVSGAMGRTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  159

>SDRG_05150
Length=787

 Score = 37.7 bits (86),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYAP_23478
Length=897

 Score = 37.7 bits (86),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 71/167 (43%), Gaps = 27/167 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RK+W++R+ V+D S L+  YY             +  KG   L       +
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGM--------TRLKGEVLLFHPATQVH  429

Query  85   VVGVMGAADKPFGFKM-VGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTR--  141
             V +  +  K   F + VG  P+     L +  + LADR  W+    +AL  +    +  
Sbjct  430  YVDIHESRGKDHTFAIQVG--PE---YTLLLQAERLADRENWMYCIEDALLCRDSYLQDP  484

Query  142  ---QAIDQSVS-----PNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180
               Q + +SV+      ++  LF  S   SP   ++P   +   +KS
Sbjct  485  KRAQDVRESVARRRNFSSESILFSLSTG-SPHDGINPMNMVMLHSKS  530

>PYIR_24588
Length=909

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 48/111 (43%), Gaps = 18/111 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL--SSIEPH  82
            G++ K GH RK+W+ R+ V++ S L+    ES A            KG   L   +   H
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARL----------KGEVLLFHPATRVH  461

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
               + + G  D  F    VG    K Y  L +  D L+DR  W+    +AL
Sbjct  462  YVDIHLSGGKDCTFAIH-VG----KDYALL-LQADQLSDRENWMYCIEDAL  506

>PYU1_G009249
Length=2580

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query  19    RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPS-APKGSFYLS  77
             R    EGY+ KRGH   S R R+ V+      + YY    A H  +  PS AP GSF + 
Sbjct  1174  RQILLEGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVD  1229

Query  78    SI  79
             ++
Sbjct  1230  TV  1231

>SPRG_08346
Length=797

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYU1_G003229
Length=810

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 5/45 (11%)

Query  11   TTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            T+ S    R T   G++ K+GH  KSW+ RF VV+GS   ++Y+E
Sbjct  391  TSGSDSGTRKT---GWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 42/84 (50%), Gaps = 9/84 (11%)

Query  9   HGTTASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGE  66
           +   A G  A+ T C+  G+ +K+G   KSW+ R+ V+ G  L   Y+  R+    P+G+
Sbjct  13  NNVIAVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERS----PSGK  66

Query  67  PSAPKGSFYLSSIE-PHEYVVGVM  89
               KG   +  +E   E+  G++
Sbjct  67  GINEKGRLKIVGVEFTPEFTNGLL  90

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 32/129 (25%), Positives = 59/129 (46%), Gaps = 25/129 (19%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKG  72
            AS D + P  C G++ K G   K+W++R+  + G+ L  +Y++S              KG
Sbjct  693  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS-------------DKG  736

Query  73   SFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
               L +++    V  V+    K F  ++     +K    L +  DT A+ ++WL     A
Sbjct  737  PL-LKALK----VCYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQA  787

Query  133  LSVKRQLTR  141
            +S +++  R
Sbjct  788  VSAEKEKDR  796

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++ KRG    +W+ RF  ++G  LQ
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

>PYIW_21901
Length=913

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 50/117 (43%), Gaps = 18/117 (15%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL--SSI  79
            S  G++ K GH RK+W+ R+ V+D S L+    ES A            KG   L   + 
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL----------KGEVLLFHPAT  472

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
              H   + + G  D  F    VG    K Y  L +  + L+DR  W+    +AL  +
Sbjct  473  RVHYVDIHLSGGKDGTFAIH-VG----KDYALL-LQAEQLSDRENWMYCIEDALLCR  523

>SDRG_06288
Length=641

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 7/55 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
           G+V K+G   KSW+ RFLVV G +  VSYY+   + H P  +P   KGS  L  +
Sbjct  7   GFVFKQGSLIKSWKKRFLVVQGRH--VSYYDR--SVHEP--DPR-EKGSLVLGDV  54

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            +P  C G + K+G   K+WR R+  +DG + Q+SY  S A   PP G
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPPKG  301

>PYAR_19291
Length=711

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 18/128 (14%)

Query  8    EHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEP  67
            +H T +  D     S  G++ K GH RK+W++R+ V++ S L+  YY   A         
Sbjct  195  DHPTASPFDDTFLDSMCGWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEAM--------  244

Query  68   SAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
            +  KG   L   + + H   + +    D  F  + VG      Y  L +  D ++DR  W
Sbjct  245  TRLKGEVLLFHPAAQVHYVDIHLSNGRDNTFAIQ-VG----PDYTLL-LEADRVSDRENW  298

Query  126  LEVARNAL  133
            +    +AL
Sbjct  299  MYCIEDAL  306

>PYIW_19613
Length=1314

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 7/71 (10%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVEL  112
            ++E    CH    E  AP GS  LS+  P E     + AA   FG+K V  AP K  VE 
Sbjct  608  FFEHLGICHTVMPE-KAPDGSLRLSASSPDE---QALVAAAACFGYKFVARAPGKAMVE-  662

Query  113  DVFVDTLADRN  123
              +   L D++
Sbjct  663  --YFSCLGDQD  671

>H310_06666
Length=887

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  SYY S+
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>PYU1_G010818
Length=169

 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 61/126 (48%), Gaps = 10/126 (8%)

Query  10   GTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG--EP  67
             TTA+ D +     EG++TK+GH  ++ + R+ V+    L  SY+  + +        +P
Sbjct  49   ATTATTDGSSIVR-EGFLTKKGHVLRTQKERYFVLRQHTL--SYFRVKQSEKKAKSVIQP  105

Query  68   SAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLE  127
            S  KG   L++ +    +V     +D+ F  + +  A  K Y +LD+   +  +R +W++
Sbjct  106  STLKGVLELTASD----IVTPAPHSDQWFRIQKLPDAEGKIY-KLDLKASSQTERQEWID  160

Query  128  VARNAL  133
              R  +
Sbjct  161  ALRATI  166

>H257_02642
Length=975

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (53%), Gaps = 5/51 (10%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAP  70
           P   EGY+ KRG +   W    +V+DG  L+VSYY+       P  +P AP
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLDG---PPAKPHAP  72

>PYAR_26065
Length=314

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            S++E  + CH    E  AP GS  LS+  P E     + AA   FG+K    AP K +VE
Sbjct  91   SFFEHLSVCHTVMPE-RAPDGSVRLSASSPDEQA---LVAAAACFGYKFSARAPGKAFVE  146

>PYU1_G012870
Length=352

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+V+ G   Q++YY++ A+  P T E    KGSF + + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-ASISPKTKE----KGSFQVITAE  55

 Score = 31.6 bits (70),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 64/154 (42%), Gaps = 23/154 (15%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFY  75
            D A      G++ K G   K+W+ R+  + G+ L  SYY+S       TG  SA KG  +
Sbjct  145  DDAGSIHHSGWLKKEGSRIKNWKKRYFTLHGNTL--SYYDS-----ADTG--SAAKGYGH  195

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
            + S+E       V G  +            ++G + L V      D  +WL +   A+  
Sbjct  196  VKSVE-------VNGERENSLDITF-----ERGRL-LRVSAKNQDDMEQWLCILSEAIE-  241

Query  136  KRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMS  169
            ++      I QS++         SVA++  P +S
Sbjct  242  QKNAEDNNIRQSIASRGSFRMSMSVAVAKPPRVS  275

>SPRG_02502
Length=121

 Score = 35.0 bits (79),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 49/125 (39%), Gaps = 33/125 (26%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG---------  65
             D A+P   EG +TKR  + K WR R+ V+ G+ L    Y  RA    P G         
Sbjct  5    ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGVIDLSECLT  59

Query  66   --------------EPSAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGY  109
                          E + P+ ++Y+   S E  +  +G +G A   F     G     GY
Sbjct  60   VKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---DGY  116

Query  110  VELDV  114
             E DV
Sbjct  117  DEEDV  121

>PYVX_23432
Length=1510

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 4/60 (7%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVEL  112
            ++E  A CH    E +A  GS  LS+  P E     + AA   FGFK V  AP K  VE 
Sbjct  578  FFEHLAVCHTVMPERAA-DGSLRLSASSPDE---QALVAAAACFGFKFVARAPGKAMVEF  633

>HYAP_06101
Length=984

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 57/119 (48%), Gaps = 30/119 (25%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L     +
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNKGR--------KKIKGCMQL-----N  186

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
            + VV V    +  A+K + F++     +KG+ +L  +  +  +   W+   R   SV+R
Sbjct  187  DGVVSVQHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALR---SVRR  237

>H310_06667
Length=896

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 3/52 (6%)

Query  8   EHGTTASGDKARPTSC-EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
           EH   +S     PT   EGY+ K+G   K W+ R+ V DG +L  SY+ ++A
Sbjct  20  EHAGLSSRPGFDPTFMKEGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKA  69

>HYAP_04457
Length=1203

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGYV K+G +   W  R+L++DG  L  +YY S+
Sbjct  62  EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  93

>H257_03931
Length=695

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 53/124 (43%), Gaps = 14/124 (11%)

Query  9    HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPS  68
            H      D   PTS  G + K+ +  K+W+ RF+V+ G ++   YY S       + E +
Sbjct  97   HDGHHESDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGT-----SSEET  149

Query  69   APKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEV  128
             P+G   LS ++ H           K F F+ + H     Y  L +     AD  +WL  
Sbjct  150  FPRGVISLSGVDVHPLDTAKF---KKQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSS  202

Query  129  ARNA  132
             ++A
Sbjct  203  IKSA  206

>PHYRA_94409
Length=1270

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 30/119 (25%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L     +
Sbjct  113  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR--------KKIKGCMQL-----N  156

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
            + VV V    +  ADK + F++     +KG+ +L  +  +  +   W+   R   SV+R
Sbjct  157  DGVVSVQHVDVRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALR---SVRR  207

>CCA26890
Length=1530

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL---SSIEP  81
            GY+ KRG   KS+R R++ ++G+ L  SYY+ + +        + P+GS  L   +S++P
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTSLQP  354

Query  82   HE  83
             E
Sbjct  355  LE  356

>CCI43793
Length=1117

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 66/162 (41%), Gaps = 28/162 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            GY+ K+G F KSWR RF ++      ++YY S+       GE S    S  L +  P   
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHL-TKLGEISVDDQSVLLKT--PRNG  231

Query  85   VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLAD-RNKWLEVARNALSVKRQLTRQA  143
            +         P  F  V HA +     L +F +   D  N W++  R +  ++ ++ R A
Sbjct  232  I---------PHCFT-VKHAART----LIMFTEDGEDIMNTWMD--RISRCIRLRIDRNA  275

Query  144  IDQ--------SVSPNKKTLFGFSVALSPQPAMSPQKQMQTL  177
            I          SV+  +  L   + A+   P   P  + Q +
Sbjct  276  ITNTIMDREQSSVNSTESALILDTAAIRAHPKTHPSHKHQNV  317

>HYAP_06403
Length=1037

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 4/60 (7%)

Query  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            +++E  A CH    E  AP  S  LS+  P E     + AA   FG+K V  AP K  VE
Sbjct  101  AFFEHLAVCHTVMPE-KAPDNSLRLSASSPDEQA---LVAAAACFGYKFVARAPGKAMVE  156

>CCI40991
Length=801

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 2/73 (3%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGS--FYLSS  78
            T  EGY+ K+GH  +SWR R+ V+ G+    +    ++     TG+      S    ++ 
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQSVITQLTGDCCVDYSSKEIAMAD  165

Query  79   IEPHEYVVGVMGA  91
             E +   V V GA
Sbjct  166  TERYRGRVTVTGA  178

>H257_01308
Length=897

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  SYY ++
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>PITG_02106
Length=1015

 Score = 36.6 bits (83),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 64/143 (45%), Gaps = 33/143 (23%)

Query  7    PEHGTTAS-----GDK--ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            PE+   +S     GD+  A    C G++ K G   KSW+ R+  + GS L  SYY+S   
Sbjct  653  PEYDAISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS---  707

Query  60   CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119
                  E  +   S  + SIEPH  V           G  +  H+ +K    L +  D+ 
Sbjct  708  ------EKGSLLRSVSVVSIEPHPTV---------SLGLVVSTHSGRK----LIMQADSN  748

Query  120  ADRNKWLEVARNALS--VKRQLT  140
             + ++WL   + A++   +R+LT
Sbjct  749  EEFDRWLSAIQGAVAGENERKLT  771

>PHYKE_4911
Length=46

 Score = 32.3 bits (72),  Expect = 0.30, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           G+V K+G   K+W+ RF+V+ G   Q++YY++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT  38

>PYAR_14615
Length=517

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   KSW+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  69

>PYAR_15792
Length=121

 Score = 34.3 bits (77),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
           EG +TKR  + K WR RF V+ G+ L    Y  RAA  P  G
Sbjct  16  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  53

>PHYSO_248481
Length=1283

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 57/119 (48%), Gaps = 30/119 (25%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L+     
Sbjct  92   GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKG--------RKKIKGCMQLN-----  135

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKR  137
            + VV V    +  ADK + F++     +KG+ +L  +  +  +   W+   R   SV+R
Sbjct  136  DGVVSVQHVDIRLADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALR---SVRR  186

>H310_01921
Length=341

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE-PHE  83
           G+V K+G   KSW+ R++V+   N Q++Y+ES           S  KGSF + ++E  H+
Sbjct  24  GWVYKQGSMIKSWKKRYMVL--KNKQLTYFESE-----KVEGNSKAKGSFQVITVEIAHD  76

Query  84  YVVGVM  89
              G++
Sbjct  77  IKNGLL  82

>HYAP_09304
Length=1144

 Score = 36.2 bits (82),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      +SYY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>SPRG_01860
Length=674

 Score = 35.8 bits (81),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  53

>SDRG_08236
Length=864

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  53

>H310_07701
Length=811

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EGYV K+GH  ++WR R+ ++ G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PHYKE_7856
Length=346

 Score = 35.4 bits (80),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYY  54
           G++TK+GH  KSW+ RF V+  DG+  +   +
Sbjct  63  GWLTKQGHMWKSWKTRFFVLFSDGTQFEAELW  94

>PYU1_G012859
Length=1183

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 36/65 (55%), Gaps = 7/65 (11%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            M++++ P    + S    +P    G++ K+GH  +SW+ R+ V+ G +LQ  Y+E+    
Sbjct  476  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN--ID  528

Query  61   HPPTG  65
             PP G
Sbjct  529  KPPRG  533

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (5%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            +G++ K G   K+W+ RF+V+ G+ L  SYY       PP G
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADETPSSPPLG  236

 Score = 32.3 bits (72),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            A   +CEG++ K+GH  K W+ R+  ++   L+
Sbjct  354  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

>H257_07514
Length=810

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EGYV K+GH  ++WR R+ ++ G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PYVX_19982
Length=700

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QLRYYRKR-------GDP-APRGTYVLT  46

>PHALS_06336
Length=511

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 8/56 (14%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            ++I+++ E G      +  P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  118  LSIIQIREMG------REDPATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  165

>PPTG_11714
Length=2444

 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 53/128 (41%), Gaps = 26/128 (20%)

Query  11    TTASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVVDGSNLQVSYYESRAACH-PPTGEPS  68
             T A  D    T  +GY+  R H   S WR RF+V++GS L V + E+   C     G+P 
Sbjct  2011  TEAGNDNTDTTQTKGYLRVRHHNLGSIWRERFVVLEGSTLTV-FSEN---CQLDEEGKPR  2066

Query  69    APKGSFYLSSIEPHEYV-----------VGVMGAADKPFGFKMVGHAPKKGYVELDVFVD  117
              P       ++E HE V           +G  G+  K  GF+    A     V L+    
Sbjct  2067  FPD-----LAVEKHELVGVEKWHPVFTSLGRSGSGLKGTGFR----AETSSGVYLEFIAT  2117

Query  118   TLADRNKW  125
             T  D  KW
Sbjct  2118  TAEDAFKW  2125

 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR-AACHPPTGEPSAPKGSF  74
             EGY+ KRGH   S R R+ V+ G+ L  +YY +   + +P  G  + P G+F
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNF  1192

>PYIW_15014
Length=702

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QMRYYRKR-------GDP-APRGTYVLT  46

>PYIR_21473
Length=667

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QMRYYRKR-------GDP-APRGTYVLT  46

>H257_08182
Length=859

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 9/53 (17%)

Query  10   GTTASGDKA---RPTSC----EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            GTT S   A   R TSC    EG++ K+G   KSW+ R+ VV G++L  +YY+
Sbjct  643  GTTTSLTSAAFSRRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYK  693

>PYAR_16674
Length=651

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QLRYYRKR-------GDP-APRGTYVLT  46

>PITG_17594
Length=694

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ LS
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYILS  46

>PHALS_06568
Length=388

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   KSW+ R++V+ G   Q++YY++         +   PKGS  + ++E
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYYDT-----AKVDQKVKPKGSCQVITVE  60

 Score = 35.0 bits (79),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (46%), Gaps = 17/135 (13%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGS  73
            S D +   +  G++ K G   KSWR RF V+ G++L  SY+ S       TG  +  KGS
Sbjct  142  SEDGSEQVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNSE-----DTG--AIAKGS  192

Query  74   FYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLAD----RNKWLEVA  129
              + ++E    V  +    D  F    V     K   E+++++  L+D     N+ +   
Sbjct  193  GDVRAVE----VNTINNGLDISFDTGRVLRVTAKNSKEMELWLCKLSDAIEAANREINDV  248

Query  130  RNALSVKRQLTRQAI  144
            R +L+V+  L  Q +
Sbjct  249  RQSLAVRNSLPIQRL  263

>H257_06469
Length=76

 Score = 32.3 bits (72),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
           EGYV K+GH  KSW+ R+  +D S   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>SPRG_02752
Length=831

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 35/57 (61%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           EG++ K+G    +W+ R++V+ G +  ++YY+ +   +P   E    KG+F L+++E
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVTNPRAKE----KGTFTLAAVE  56

 Score = 32.7 bits (73),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            G++ K G   KSW+ RF V+ G++L  +YY+
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>SDRG_14487
Length=964

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 36/59 (61%), Gaps = 7/59 (12%)

Query  22  SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           + EG++ K+G    +W+ R++V+ G +  ++YY+ +   +P   E    KG+F L+++E
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD-KEVSNPRAKE----KGTFTLAAVE  56

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            G++ K G   KSW+ RF V+ G++L  +YY+
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>PHYRA_72718
Length=732

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 49/124 (40%), Gaps = 21/124 (17%)

Query  18   ARPTSCEGYVTKRG-HFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
             R     G + KRG  +RK W++RF+ +DG   Q++YYE   A    T   +  K     
Sbjct  87   VRAPVVSGSLEKRGFRWRKKWKLRFVELDGR--QLAYYEDTGAFCATTASCNGTK-----  139

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
             S +P   V+    A  +    K V   P               D   W+  AR+A + +
Sbjct  140  RSCKPKRKVMLTADATLEDVDDKTVSVTPA-------------LDEKPWMLRARDAATKQ  186

Query  137  RQLT  140
            R L 
Sbjct  187  RWLV  190

>PHYSO_478611
Length=522

 Score = 35.0 bits (79),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+V+ G   Q++YY++ A   P        KGSF + ++E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  189

>PHYRA_83071
Length=2300

 Score = 35.4 bits (80),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 60/130 (46%), Gaps = 28/130 (22%)

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQ--VSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
             EGY+ KRGH   S R R+ V+ G+ L   V++ +S+   +P  G  +AP G F ++    
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSK---NPGGGATTAPLGKFRVA----  1184

Query  82    HEYVVGVMGAADKPFGFKMVGHAPKKGYVELD--------VFVDTLADRNKWLEVARNAL  133
                VVG        +  K   H+ + G +EL+            T  ++  W++  R  +
Sbjct  1185  ---VVG-------DWHGKTATHSYEHG-MELETSDGKTFFCAASTAKEKQLWVDAIRRGI  1233

Query  134   SVKRQLTRQA  143
             ++ R   R+A
Sbjct  1234  ALARNQQRRA  1243

>PYU1_G000724
Length=189

 Score = 34.3 bits (77),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 25/36 (69%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRA  58
            G++TK+GH  KSW+ RF V+  DG+    +YY+++ 
Sbjct  111  GWLTKQGHMWKSWKTRFFVLFADGT---FAYYKNKG  143

>H310_09363
Length=1954

 Score = 35.4 bits (80),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (52%), Gaps = 4/79 (5%)

Query  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            M++L +    T++  +K   TSC GY+ KRG    + + R++++  + L   YY++    
Sbjct  826  MDVLVLDTTNTSSQNNKR--TSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPEL  881

Query  61   HPPTGEPSAPKGSFYLSSI  79
            +        P+GS +L ++
Sbjct  882  NKGWFGKEKPRGSLHLGNV  900

>H257_03363
Length=316

 Score = 34.7 bits (78),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE-PHE  83
           G+V K+G   KSW+ R++V+   N Q++Y+E     +      S  KGSF + +IE  H+
Sbjct  8   GWVYKQGSMVKSWKKRYMVL--KNKQLTYFE-----NEKIEGNSKAKGSFQVITIEIAHD  60

Query  84  YVVGVM  89
              G++
Sbjct  61  IKNGLL  66

>PITG_03318
Length=1343

 Score = 35.4 bits (80),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
            G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  170

>H310_14473
Length=613

 Score = 35.0 bits (79),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 6/59 (10%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR----AACHPPTGEPSAPKGSFYLSSI  79
           G + KRGH RK+W  RF V+    L+  YY       A C   + +P   +G   L+ I
Sbjct  27  GILLKRGHLRKNWLTRFFVLTSGALR--YYRKPPGGGAKCTTWSVDPRYLRGELPLADI  83

>PPTG_16044
Length=1378

 Score = 35.0 bits (79),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
            G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  170

>PYAP_23744
Length=123

 Score = 33.1 bits (74),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 29/57 (51%), Gaps = 5/57 (9%)

Query  9   HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
            G  ++ D + P   EG +TKR  + K WR R+ V+ G+ L    Y  RAA  P  G
Sbjct  2   EGDFSNCDLSNPDY-EGELTKRSVWLKEWRRRYFVLKGNKL----YFCRAANEPAHG  53

>PPTG_18989
Length=1213

 Score = 35.0 bits (79),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>SDRG_02135
Length=306

 Score = 34.7 bits (78),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 4/34 (12%)

Query  24  EGYVTKRGHFRKSWRVRFL-VVDGSNLQVSYYES  56
           EGY+ K+GH  K+WR R+  +VD S   ++YY+S
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDAS---LAYYDS  32

>CCI42088
Length=1007

 Score = 35.0 bits (79),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +G++ KRGH +K+W+ RF  V+   LQ
Sbjct  666  DGFLWKRGHLKKNWKKRFFRVENGQLQ  692

>PHYKE_1044
Length=521

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
           EG++ K+G   K W+ R+ V DG  L  SYY SR    P
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKP  74

>PYVX_14527
Length=1269

 Score = 35.0 bits (79),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G+V K+G   ++W+ RF+V+ G   Q++YY++ A   P        KGSF L ++E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT-ARLTPSV----KAKGSFTLITVE  951

 Score = 32.7 bits (73),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            G+V K G   +SW+ RFLV  G++L  +YY++
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKN  618

>PYU1_G007423
Length=928

 Score = 35.0 bits (79),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 55/130 (42%), Gaps = 18/130 (14%)

Query  6    VPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTG  65
             PE     + D +   S  G++ K GH RK+W+ R+ V++ S L+  YY   +       
Sbjct  417  TPEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YYSDDSM------  468

Query  66   EPSAPKGSFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRN  123
              +  KG   L   +   H   + + G  D  F  + VG    K Y  L +  D L+ R 
Sbjct  469  --TRLKGEVLLFHPATRVHYVDIHLSGGRDCTFAIQ-VG----KDYTLL-LQADQLSVRE  520

Query  124  KWLEVARNAL  133
             W+    +AL
Sbjct  521  NWMYCIEDAL  530

>HYAP_13757
Length=262

 Score = 34.3 bits (77),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
           G++ KRGH  K+W+ RF +++G+ L  +YY+
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  43

>PHALS_09273
Length=663

 Score = 34.7 bits (78),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 58/155 (37%), Gaps = 46/155 (30%)

Query  20   PTS---CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPT---------GEP  67
            PTS    EG + KRGH  K+W+ RF  +    L+  Y E++  C             G  
Sbjct  326  PTSYIHMEGRLLKRGHLNKNWKTRFFRIQQGELRY-YTENQNKCKGSVPLKDTIVSPGMA  384

Query  68   SAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLE  127
              P G  Y            V+ + D  F   +  H  K  ++ ++            L+
Sbjct  385  QCPDGRKYYF----------VLTSKDSKFEMHLNAHNEKSMHLWIEA-----------LQ  423

Query  128  VARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVAL  162
             A+ ALS             V+ NK+T+ G S+ +
Sbjct  424  EAQTALS------------KVAGNKETVAGLSLVI  446

>PHYCA_505441
Length=694

 Score = 34.7 bits (78),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFLLDGN--QLRYYRKR-------GDP-APRGTYILT  46

>PHALS_07930
Length=1200

 Score = 34.7 bits (78),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>SDRG_08383
Length=1321

 Score = 34.7 bits (78),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 4/59 (7%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            ++E  A CH    E SA  GS  LS+  P E     + AA   FGFK    AP +  +E
Sbjct  507  FFEHLAVCHTVMPETSA-DGSLRLSASSPDE---QALVAAAACFGFKFFARAPGEAVIE  561

>PHYRA_81944
Length=1149

 Score = 34.7 bits (78),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>SDRG_02154
Length=822

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G++ K+G   K+W+ RF+V+   +L   Y+E+      PT +   PKGSF + +IE
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---PKGSFQVLAIE  176

>PPTG_16174
Length=693

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYILT  46

>PHYRA_84567
Length=696

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYILT  46

>PITG_21026
Length=694

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYILT  46

>PITG_10462
Length=1028

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  118  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  149

>PHYSO_304784
Length=694

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYILT  46

>PHYSO_558498
Length=967

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PYIR_15118
Length=1222

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F K+WR R+ ++      +SYY+S
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>H257_09270
Length=884

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 32/136 (24%), Positives = 52/136 (38%), Gaps = 9/136 (7%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGY+ KR  + K W   + V+ G  L     +  A  HP   +     G F  S     +
Sbjct  86   EGYLMKRSDWLKHWETYYFVLHGRVLYCYLSDEEAKLHPENSK--IKHGKFTFSDNLILD  143

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQLTRQA  143
             V+ V       F F+       KG  ++ +   T A +  W+ +A + +     L  Q 
Sbjct  144  EVITVQSRLTYEFVFES-----DKGK-QIHLRAKTEASKQMWMHMACHGIVDTEMLRNQV  197

Query  144  IDQSVSPNKK-TLFGF  158
            +    +P +  TL  F
Sbjct  198  LHMRRTPQRHATLVDF  213

>PHALS_09729
Length=949

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PHYRA_73430
Length=395

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+V+ G   Q++YY++ A   P        KGSF + ++E
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT-AKVDPTV----KAKGSFQVITVE  60

>CCI47145
Length=390

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 6/56 (11%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G++ K+G   +SW+ R++V+ G   Q+SYY++         E    KGSF + ++E
Sbjct  39  GWIFKQGSLVRSWKKRYMVLKGR--QLSYYDTDNILSLKVKE----KGSFQVITVE  88

>PYU1_G009508
Length=328

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G + K+WR R+ ++      +SYY+S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>PHYSO_506918
Length=758

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query  25   GYVTKRG-HFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPK  71
            G + KRG  +R+ W++RF+ +DG   Q++YYE   A    T   S  K
Sbjct  121  GSLEKRGFRWRRKWKLRFVELDGR--QLAYYEDSGAFSATTASASGVK  166

>SPRG_02010
Length=1326

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 4/59 (7%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            ++E  A CH    E SA  GS  LS+  P E     + AA   FGFK    AP +  +E
Sbjct  508  FFEHLAVCHTVMPETSA-DGSLRLSASSPDE---QALVAAAACFGFKFFARAPGEAVIE  562

>PPTG_08785
Length=944

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PHALS_05587
Length=1361

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 27/117 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++ K+GH  KSW+ RF V+  DG+   V YY++++            KG  +L+     
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYKNKS--------RKKIKGYMHLN-----  182

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135
            + VV V    +  A K + F++     +KG+  L     +  D   W+   R+   V
Sbjct  183  DGVVSVQHVDIRVAGKAYVFQI-----EKGFYRLLCHCSSQIDAELWVTALRSVRKV  234

>PYIR_13168
Length=1353

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 56/112 (50%), Gaps = 23/112 (21%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS-IEP  81
            G++TK+GH  K+W+ RF V+  DG+    +YY+++             +G   L+  I  
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGT---FAYYKNKG--------KKKMQGCLMLNDGIVT  164

Query  82   HEYV-VGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
             ++V V  +G   KP+ F++     +KG+ +L  +  +  +   W+   R+A
Sbjct  165  VKHVDVRKIG---KPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>PYAR_23366
Length=828

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 30/72 (42%), Gaps = 17/72 (24%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES---------------RAACH  61
            K  P   EGYV +RG +   W   +L +DG  L+  +YES               RA   
Sbjct  69   KMLPILWEGYVRRRGDWLPRWEEMYLTMDGRWLR--FYESKTKYIEAQAADEKSIRAGMR  126

Query  62   PPTGEPSAPKGS  73
             P G P  P+ S
Sbjct  127  LPQGSPPQPQRS  138

>CCA24531
Length=374

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 6/56 (11%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G++ K+G   +SW+ R++V+ G   Q+SYY++         E    KGSF + ++E
Sbjct  27  GWIFKQGSLVRSWKKRYMVLKGR--QLSYYDTDNILSLKVKE----KGSFQVITVE  76

>PYAP_22195
Length=901

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V +G  L  SYY SR
Sbjct  38  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISR  69

>PHYRA_82040
Length=1054

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  143  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  174

>PYIR_23372
Length=1415

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            S EGY+ K+    +SW+  + V++G  +  +YYESR
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  355

>PHALS_02739
Length=648

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYVLT  46

>PYIW_18911
Length=1196

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F K+WR R+ ++      +SYY+S
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>PHYCA_564296
Length=957

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PYVX_14593
Length=964

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query  7    PEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            P+   T S D  +   C G++ K+G    SW+ R+  + GS L+  YY+S
Sbjct  592  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

>PYIR_13555
Length=355

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ R++V+ G   Q++YY++ A+    T E    KGSF + ++E
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGK--QLTYYDT-ASLTAKTKE----KGSFQVITVE  58

>CCI43456
Length=126

 Score = 32.3 bits (72),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  14  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
           S D+ +  + EG +TKR  + K WR R+ ++ G+ L  S
Sbjct  11  SIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  49

>CCA15513
Length=1341

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 28/114 (25%), Positives = 51/114 (45%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G+++K+GH  K WR RF V+  DG+   ++YY  R             KG      I+ +
Sbjct  86   GWLSKQGHLWKGWRSRFFVLYADGT---LAYYRRRGNV--------KMKG-----YIKLN  129

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            E ++G+    +    + + F++     +KG+  L     T  +   W+   R+A
Sbjct  130  EGIIGIQYIDVWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVNHLRSA  178

>SDRG_14486
Length=308

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 33/57 (58%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           +G+V K+G   +SW+ R++V+   N Q+SY+++           +  KGSF + +IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVL--KNKQLSYFDTENVT-----ASTKAKGSFAVITIE  56

>PYAR_16228
Length=862

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (54%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
           EG + K+G   K W+ R+ V DG  L  SYY +R    P
Sbjct  30  EGPLQKKGQMLKGWKQRWFVCDGRTL--SYYSNRRESRP  66

>SPRG_02753
Length=309

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 33/57 (58%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           +G+V K+G   +SW+ R++V+   N Q+SY+++           +  KGSF + +IE
Sbjct  7   QGWVFKQGSLVRSWKKRYMVL--KNKQLSYFDTENVT-----ASTKAKGSFAVITIE  56

>SDRG_06927
Length=847

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 43/93 (46%), Gaps = 3/93 (3%)

Query  25   GYVTKRGHFRKSWRVRFLV-VDGSNL-QVSYYESRAACHPPTGEPSA-PKGSFYLSSIEP  81
            G++ K G F K W+ R+ V V G++  ++ YY+S  A HP      A   G  YL +++ 
Sbjct  20   GWLRKLGRFSKRWQRRYFVFVKGTDAKELRYYDSSTATHPEGVMSLADATGVCYLDAVQA  79

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDV  114
                 G   ++D  F      +    G+ + DV
Sbjct  80   RSSSPGEASSSDHKFAILTAENVWLLGFNDHDV  112

>PHYSO_484541
Length=911

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (47%), Gaps = 8/79 (10%)

Query  4   LRVPEHGTTASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH  61
           L+       A G   R + C+  G+  K+G   KSW+ R+ V+ G  L   Y+  R+   
Sbjct  23  LQAATKNVIAVGRVVRSSYCDHSGWGLKQGSIIKSWKRRYFVLKGREL--IYFAERS---  77

Query  62  PPTGEPSAPKGSFYLSSIE  80
            P+G+    KG   +S +E
Sbjct  78  -PSGKGIDEKGRLRVSGVE  95

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  10   GTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            G    GD A   + +G++ K G   K+W+ R++ + G  +Q
Sbjct  146  GDNQQGDAANSVAMKGWLMKEGQNFKTWKRRYMTLTGRTIQ  186

>PYVX_13084
Length=1267

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 34/71 (48%), Gaps = 16/71 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR---------AACHPPTGEPSAPKGSFY  75
            GY+ K+G F K+WR R+ V+      +SY+ S+         A     T EP APK  F 
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKDDLMKLGEIAIDESTTVEP-APKDGF-  299

Query  76   LSSIEPHEYVV  86
                 P+ ++V
Sbjct  300  -----PNRFIV  305

>SPRG_09805
Length=838

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 37/77 (48%), Gaps = 3/77 (4%)

Query  25  GYVTKRGHFRKSWRVRFLV-VDGSNL-QVSYYESRAACHPPTGEPSA-PKGSFYLSSIEP  81
           G++ K G F K W+ R+ V V G++  ++ YY+S  A HP      A   G  YL +++ 
Sbjct  19  GWLRKLGRFSKRWQRRYFVFVKGTDAKELRYYDSTTATHPEGVMSLADATGVCYLDTVQA  78

Query  82  HEYVVGVMGAADKPFGF  98
                G   ++D  F  
Sbjct  79  RSPSPGEAASSDHKFAI  95

>PYIR_14494
Length=819

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            A    CEG++ KRG    +W+ RF  ++G  LQ
Sbjct  260  AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

 Score = 32.7 bits (73),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 31/52 (60%), Gaps = 4/52 (8%)

Query  6    VPEHGT-TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            VP  G    S D++ P  C G++ K G   K+W++R+  ++G+ L  SY++S
Sbjct  699  VPYVGMGCVSLDESFP-GCSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 32.0 bits (71),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            G++ K+G   KSW+ RF V++  +  ++YYE             APKG+ +++ +
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYEQLN---------EAPKGNGFINQV  465

 Score = 31.6 bits (70),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (54%), Gaps = 6/56 (11%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+ +K+G   KSW+ R+ V+ G  L   Y+  R+    P+G+    KG   + ++E
Sbjct  32  GWASKQGSIIKSWKRRYFVLKGREL--IYFAERS----PSGKGIDEKGRLKIVAVE  81

>H310_14019
Length=683

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 61/161 (38%), Gaps = 35/161 (22%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYL  76
            +A   S EG++ KRG   K+W+ R+  ++G  L+  Y E         G  + PKG    
Sbjct  166  RASMRSFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG----  210

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVK  136
                 +  VVGV    + P+    +   P +    LDV  ++  ++  W+          
Sbjct  211  -----YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWM----------  251

Query  137  RQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTL  177
             Q    A     +          V LS  PA  PQ+   +L
Sbjct  252  -QRILDACGHVAATTPPPPPVLHVTLSSAPATPPQQLAASL  291

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  8    EHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            ++G  +S D A  T+CEG++ K+G   K+W+ R+  + G  L     +S  A
Sbjct  331  DYGIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  380

Lambda      K        H        a         alpha
   0.315    0.130    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22974963336

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40