Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_17126147551361366488e-88
PITG_18455147551321325741e-76
PHYSO_321155147551361365663e-75
PHYCA_11834147551341335481e-72
PHALS_06479147551361365472e-72
PHYRA_95903147551341335462e-72
PHYKE_8392147551381385369e-71
HYAP_07103147551641644512e-57
PYVX_18180147551351303901e-48
PYAP_17747147551341343442e-41
PYIW_19970147551301223015e-35
PYU1_G001736147551231252998e-35
CCA17542147551201232666e-30
PYIR_13454147551291272607e-29
CCI44820147551231242599e-29
H257_06293147551231232423e-26
H310_09224147551231232329e-25
SDRG_01782147551231222223e-23
SPRG_06335147551231222172e-22
HYAP_0849911147108721056e-06
HYAP_0850065260172721061e-05
PITG_137391114710566994e-05
PHALS_115641114710766986e-05
PHYKE_58411114712164996e-05
PHYSO_3150171114710950986e-05
PPTG_092521114710566978e-05
PYU1_G0059631114710375952e-04
PYIW_147431114710575917e-04
PYVX_208541114710464890.001
CCA175211114710454860.003
PHYRA_816751114710650860.003
PHYCA_5353801114710850860.003
PYIR_151861114710975860.003
PYAR_232071114711259840.006
CCI442321114710554830.008
PHYRA_751931416310461790.034
PYIW_142931416310466760.082
H310_07567111479854750.12
PHYKE_5532815812242750.13
SDRG_149121114710561730.19
SPRG_128831114710561730.21
CCI487201340311489710.49
SPRG_1173112822943181730.61
H257_07358111479866690.66
PHYCA_5404611416310461681.1
PYVX_151505606474645701.4
PYVX_18358141636254642.2
PYIW_19705254234075673.2
PHYCA_507051226447769633.4
PHYSO_5143231416310460644.4
PITG_177011416310460644.5
PYIR_182231416310557635.0
PPTG_156551416311261635.2
PYAP_248671340314770638.4
CCA240562362427054649.0
PYAR_160001136148856649.3
H257_0254312365132636639.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17126

Length=136
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17126                                                            254        8e-88
PITG_18455                                                            225        1e-76
PHYSO_321155                                                          222        3e-75
PHYCA_11834                                                           215        1e-72
PHALS_06479                                                           215        2e-72
PHYRA_95903                                                           214        2e-72
PHYKE_8392                                                            211        9e-71
HYAP_07103                                                            178        2e-57
PYVX_18180                                                            154        1e-48
PYAP_17747                                                            137        2e-41
PYIW_19970                                                            120        5e-35
PYU1_G001736                                                          119        8e-35
CCA17542                                                              107        6e-30
PYIR_13454                                                            104        7e-29
CCI44820                                                              104        9e-29
H257_06293                                                            97.8       3e-26
H310_09224                                                            94.0       9e-25
SDRG_01782                                                            90.1       3e-23
SPRG_06335                                                            88.2       2e-22
HYAP_08499                                                            45.1       6e-06
HYAP_08500                                                            45.4       1e-05
PITG_13739                                                            42.7       4e-05
PHALS_11564                                                           42.4       6e-05
PHYKE_5841                                                            42.7       6e-05
PHYSO_315017                                                          42.4       6e-05
PPTG_09252                                                            42.0       8e-05
PYU1_G005963                                                          41.2       2e-04
PYIW_14743                                                            39.7       7e-04
PYVX_20854                                                            38.9       0.001
CCA17521                                                              37.7       0.003
PHYRA_81675                                                           37.7       0.003
PHYCA_535380                                                          37.7       0.003
PYIR_15186                                                            37.7       0.003
PYAR_23207                                                            37.0       0.006
CCI44232                                                              36.6       0.008
PHYRA_75193                                                           35.0       0.034
PYIW_14293                                                            33.9       0.082
H310_07567                                                            33.5       0.12 
PHYKE_5532                                                            33.5       0.13 
SDRG_14912                                                            32.7       0.19 
SPRG_12883                                                            32.7       0.21 
CCI48720                                                              32.0       0.49 
SPRG_11731                                                            32.7       0.61 
H257_07358                                                            31.2       0.66 
PHYCA_540461                                                          30.8       1.1  
PYVX_15150                                                            31.6       1.4  
PYVX_18358                                                            29.3       2.2  
PYIW_19705                                                            30.4       3.2  
PHYCA_507051                                                          28.9       3.4  
PHYSO_514323                                                          29.3       4.4  
PITG_17701                                                            29.3       4.5  
PYIR_18223                                                            28.9       5.0  
PPTG_15655                                                            28.9       5.2  
PYAP_24867                                                            28.9       8.4  
CCA24056                                                              29.3       9.0  
PYAR_16000                                                            29.3       9.3  
H257_02543                                                            28.9       9.9  

>PPTG_17126
Length=136

 Score = 254 bits (648),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
            MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS
Sbjct  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  61   LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllr  120
            LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLR
Sbjct  61   LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLR  120

Query  121  rqYFLDRKSGPPRPIF  136
            RQYFLDRKSGPPRPIF
Sbjct  121  RQYFLDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 225 bits (574),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)

Query  5    MRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
            M ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFR+HGD TDP+EVSALIQRAQSSLSYL
Sbjct  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

Query  65   KIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYF  124
            KIVTPRAESN GVQRYIYRNGQRVNA EFEEKG ENARWK QDMEGGL+RHHQLL+RQYF
Sbjct  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  125  LDRKSGPPRPIF  136
            ++RKSGPPRPIF
Sbjct  121  MNRKSGPPRPIF  132

>PHYSO_321155
Length=136

 Score = 222 bits (566),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 128/136 (94%), Gaps = 0/136 (0%)

Query  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
            MAEA RELRPLYKKLLRLAQSLPEPKR+ S+DQIRR+FR+HGDLTDP+ VSALIQRAQSS
Sbjct  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60

Query  61   LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllr  120
            LSYLKIVTPR ESN GVQR+IYRNGQRVNA EFE KGEENAR+KTQD+E GL+RHHQLLR
Sbjct  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120

Query  121  rqYFLDRKSGPPRPIF  136
            RQYF+DRKSGPPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PHYCA_11834
Length=134

 Score = 215 bits (548),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)

Query  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
            A RELRPLYKKLLRLAQSLPEPKRQ+SIDQIRR+FR+H DLTDP+EVS L+QRAQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61

Query  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqY  123
            LKIVTPRAESN GVQR+IYR+G+RVNA+E E KGEENARWKTQDME GL+RHHQLLRRQY
Sbjct  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121

Query  124  FLDRKSGPPRPIF  136
            F+DRKSGPPRPIF
Sbjct  122  FMDRKSGPPRPIF  134

>PHALS_06479
Length=136

 Score = 215 bits (547),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)

Query  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
            M+ A RELRPLYKKLLRLAQ+LP+ KRQSSIDQIRR+FR H DLTDP+EVS  IQRAQSS
Sbjct  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60

Query  61   LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllr  120
            LSYLKI+TPR ESN GVQR+IYRNGQRVNA +FE+KG ENARWKTQDME G +RHHQLLR
Sbjct  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR  120

Query  121  rqYFLDRKSGPPRPIF  136
            RQYF+DRKSGPPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PHYRA_95903
Length=134

 Score = 214 bits (546),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)

Query  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
            A RELRPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR+H +LTDP+EVSALIQRAQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61

Query  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqY  123
            LKIVTPRAESN G+QRYIYRNGQRVNADE E  GEENAR+KTQD+EGGL+RHHQLLRRQ+
Sbjct  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121

Query  124  FLDRKSGPPRPIF  136
            F+DRKSGPPRPIF
Sbjct  122  FMDRKSGPPRPIF  134

>PHYKE_8392
Length=138

 Score = 211 bits (536),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 2/138 (1%)

Query  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
            MAEA RELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FRNHGDL+DP+EVS L+Q AQSS
Sbjct  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS  60

Query  61   LSYLKIVTPR--AESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhql  118
            LSYLKIVTPR   ESN GVQRYIYRNGQRVNA E EEKGEENAR+KTQDME GL+RHHQL
Sbjct  61   LSYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120

Query  119  lrrqYFLDRKSGPPRPIF  136
            +RRQ+F+DRKSGPPRP+F
Sbjct  121  MRRQHFMDRKSGPPRPMF  138

>HYAP_07103
Length=164

 Score = 178 bits (451),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 122/164 (74%), Gaps = 35/164 (21%)

Query  8    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIV  67
            +RPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGDLTDP+EVS+L+QRAQSS+ +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  68   TPRAE-----------------------------------SNMGVQRYIYRNGQRVNADE  92
            TPRAE                                   S+ G+QR++YR+G+R++A E
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  93   FEEKGEENARWKTQDMEGGlrrhhqllrrqYFLDRKSGPPRPIF  136
             ++KGEENAR+KTQD+E G++RHHQLLRRQ+F+DRKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 154 bits (390),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 0/130 (0%)

Query  7    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKI  66
            ELRPLYKKLLRLAQSLPEPKR S++ QIR +FR+H ++TD  EV+ L+QRAQS L YLKI
Sbjct  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65

Query  67   VTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLD  126
            VTPR  S  GV+RYIYRNGQRV+AD  E  GE+ AR+KT DMEG L+RHHQLLRRQ+F+D
Sbjct  66   VTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMD  125

Query  127  RKSGPPRPIF  136
            R   PPRPIF
Sbjct  126  RGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 137 bits (344),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 107/134 (80%), Gaps = 2/134 (1%)

Query  4    AMRELRPLYKKLLRLAQSLP-EPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS  62
            A  ELRPLYK+LLRLA+SLP E KR++++ QIR +FR+  D  DP+EV+AL+QRAQ+ + 
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  63   YLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrq  122
            YLKIVTPR+ ++ GV+ ++Y NG+RV++ + + + EE AR+KT D EG +RRH+QLLRRQ
Sbjct  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQ  120

Query  123  YFLDRKSGPPRPIF  136
            +F+DR   PP+PIF
Sbjct  121  HFMDRGVAPPKPIF  134

>PYIW_19970
Length=130

 Score = 120 bits (301),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 95/122 (78%), Gaps = 3/122 (2%)

Query  7    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKI  66
            +LRP+YKKLL+LA++LPE KR+++  QIR +FR+  +L+DP+E++AL+ RAQSS+SYLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  67   VTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLD  126
            VTPR  S+ GV+ YIY+NGQRV A    E G   A+++  D  G + RH +LLRRQ+F+D
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  127  RK  128
            RK
Sbjct  129  RK  130

>PYU1_G001736
Length=123

 Score = 119 bits (299),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 3/125 (2%)

Query  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
            A  +LRP+YKKLL+LAQ+LP  KRQ++++QIRR+FR H    DP+E++AL+ RAQSS+ Y
Sbjct  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61

Query  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqY  123
            LKIVTPRA S+ GV+ Y+Y  G+RV A       E+ AR+KT D    ++RH QLLRRQ+
Sbjct  62   LKIVTPRATSDAGVKNYVYIKGKRVEA---AGAAEDGARYKTADYNAQMQRHVQLLRRQH  118

Query  124  FLDRK  128
            F+DRK
Sbjct  119  FMDRK  123

>CCA17542
Length=120

 Score = 107 bits (266),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 93/123 (76%), Gaps = 3/123 (2%)

Query  5    MRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
            M + R +YK+L+RLA+SLP  K+ +++  IR +FR H D++DP ++S L++RAQS++ YL
Sbjct  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60

Query  65   KIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYF  124
            KIVTP   S+ GV+R+++++G+R+   E   K  E AR+K QD+  GL+RHHQLLRRQ+F
Sbjct  61   KIVTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHF  117

Query  125  LDR  127
            +DR
Sbjct  118  MDR  120

>PYIR_13454
Length=129

 Score = 104 bits (260),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 95/127 (75%), Gaps = 3/127 (2%)

Query  2    AEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSL  61
            A A+ +LRP+YKKLL+LA++LPE KR +++ QIR +FR   D++DP+E++AL+ RAQSS+
Sbjct  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65

Query  62   SYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrr  121
             YLKIVTPR  S+ GV+ YIY+NGQRV A    E G   A++   D    ++RH +LLRR
Sbjct  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRR  122

Query  122  qYFLDRK  128
            Q+F+DRK
Sbjct  123  QHFMDRK  129

>CCI44820
Length=123

 Score = 104 bits (259),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 92/124 (74%), Gaps = 3/124 (2%)

Query  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
            A+ E R ++KK+++LA+SLP  K+  ++  IR +FR H D+ DP +++ L++RAQS++ Y
Sbjct  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62

Query  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqY  123
            LKIVTP   S+ GV+ ++Y++G+R+   E   +  E A++K QDME GL+RH+QL+RRQY
Sbjct  63   LKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQY  119

Query  124  FLDR  127
            F+DR
Sbjct  120  FMDR  123

>H257_06293
Length=123

 Score = 97.8 bits (242),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 87/123 (71%), Gaps = 2/123 (2%)

Query  6    RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLK  65
            + +R  YKKL++LAQSLP  ++ +++D+IR DFR+ G ++  +E+  L+ +AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62

Query  66   IVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFL  125
            IVTP+     G QR+IY++G+R+++   ++ G  N   KT D+   + RH +L+RRQ+F+
Sbjct  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  126  DRK  128
            DRK
Sbjct  121  DRK  123

>H310_09224
Length=123

 Score = 94.0 bits (232),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 83/123 (67%), Gaps = 2/123 (2%)

Query  6    RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLK  65
            + +R  YKKL++LAQSLP  ++  ++D++R +FR+HG +T   ++  ++ +AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62

Query  66   IVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFL  125
            IVTP+       QRYIY++G+R++    ++    NA  KT D    + RH +L+RRQ+F+
Sbjct  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  126  DRK  128
            DRK
Sbjct  121  DRK  123

>SDRG_01782
Length=123

 Score = 90.1 bits (222),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query  8    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIV  67
            +R  YKKLL+LA+S+P+ +R  +++++R +FR H     P+E+  L+++AQS +SYLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TP-RAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLD  126
            TP ++ S+     ++Y+NGQR++  E      ++A  KT D    + +H QL+RRQ+F+D
Sbjct  65   TPKKSSSSTQGSHFVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMD  121

Query  127  RK  128
            RK
Sbjct  122  RK  123

>SPRG_06335
Length=123

 Score = 88.2 bits (217),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query  8    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIV  67
            +R  YKKLL+LA+S+P+ +R  +++++R +FR H     P+E+  L+++AQS +SYLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TPRAESNMGV-QRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGlrrhhqllrrqYFLD  126
            TP+   + G    ++Y+NGQR++  E      ++A  KT D    + +H QL+RRQ+F+D
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHFMD  121

Query  127  RK  128
            RK
Sbjct  122  RK  123

>HYAP_08499
Length=108

 Score = 45.1 bits (105),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 4/72 (6%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVS---ALIQRA  57
           MAEA   LR +Y+++L+LAQ  P  KRQS I  I+ +FR + +L+D Q+V    A++Q  
Sbjct  1   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  59

Query  58  QSSLSYLKIVTP  69
              LS    + P
Sbjct  60  IKELSMYASLHP  71

>HYAP_08500
Length=172

 Score = 45.4 bits (106),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 4/72 (6%)

Query  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVS---ALIQRA  57
            MAEA   LR +Y+++L+LAQ  P  KRQS I  I+ +FR + +L+D Q+V    A++Q  
Sbjct  65   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  123

Query  58   QSSLSYLKIVTP  69
               LS    + P
Sbjct  124  IKELSMYASLHP  135

>PITG_13739
Length=105

 Score = 42.7 bits (99),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 41/66 (62%), Gaps = 1/66 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MAE  RE+  +Y+++L+LAQ  P  KR+S I  I+ +F  + DLTD Q++   +   ++ 
Sbjct  1   MAET-REVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAG  59

Query  61  LSYLKI  66
           ++ L +
Sbjct  60  ITELSM  65

>PHALS_11564
Length=107

 Score = 42.4 bits (98),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 1/66 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MAE  + LR +Y++LL+LAQ  P  KR++ I  I+ +F  +  +TD Q++   +  A + 
Sbjct  1   MAETKQVLR-VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAG  59

Query  61  LSYLKI  66
           +  L +
Sbjct  60  IKELSM  65

>PHYKE_5841
Length=121

 Score = 42.7 bits (99),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 39/64 (61%), Gaps = 1/64 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MAE ++E+  +Y+++L+LAQ  P  KR S I  I+ +F  H  LTD Q++   +  A++ 
Sbjct  1   MAE-VKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAG  59

Query  61  LSYL  64
           +  L
Sbjct  60  IKEL  63

>PHYSO_315017
Length=109

 Score = 42.4 bits (98),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
           MAE    LR +Y+++L+LAQ  P  KR+S I  I+ +F  + DLTD Q++
Sbjct  1   MAETKEVLR-MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKI  49

>PPTG_09252
Length=105

 Score = 42.0 bits (97),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 40/66 (61%), Gaps = 1/66 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MAE    LR LY+++L+LAQ  P  KR+S I  I+ +F  + +LTD Q++   +   ++ 
Sbjct  1   MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAG  59

Query  61  LSYLKI  66
           ++ L +
Sbjct  60  ITELSM  65

>PYU1_G005963
Length=103

 Score = 41.2 bits (95),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 1/75 (1%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           M EA +E+  +Y+++L+LA   P  KR + I  I+ +FR +  LTD   + A +Q A+  
Sbjct  1   MTEA-KEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQG  59

Query  61  LSYLKIVTPRAESNM  75
           +  L   T    S+M
Sbjct  60  IVELSQYTNLNPSSM  74

>PYIW_14743
Length=105

 Score = 39.7 bits (91),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MAEA +E+  LY+++L+LA   P  KR + I +I+ +F  +  LTD  ++   +Q A+  
Sbjct  1   MAEA-KEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQG  59

Query  61  LSYLKIVTPRAESNM  75
           +  L   T    S+M
Sbjct  60  IVELSQYTNLNPSSM  74

>PYVX_20854
Length=104

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MA+ +  +R LY+++L+LAQ  P  KR S +  I+ +F  +  L+D Q+V   I  A++ 
Sbjct  1   MADRLEVVR-LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAG  59

Query  61  LSYL  64
           +  L
Sbjct  60  IQEL  63

>CCA17521
Length=104

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
           LY+++LRLA+  P  KR + I+ IR +FR   D+T    +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PHYRA_81675
Length=106

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
           MAE  +E+  +Y+++L+LAQ  P  KR S I  I+ +F  +  LTD Q++
Sbjct  1   MAET-KEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKI  49

>PHYCA_535380
Length=108

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEV  50
           MAE    LR +Y+++L+LA   P  KR+S I  I+ +F  +  LTD Q +
Sbjct  1   MAETKEVLR-MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRI  49

>PYIR_15186
Length=109

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60
           MAEA +E+  +Y+++L+LA   P  KR + I +I+ +F  +  LTD  ++   +Q A+  
Sbjct  1   MAEA-KEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQG  59

Query  61  LSYLKIVTPRAESNM  75
           +  L   T    S+M
Sbjct  60  IVELSQYTNLNPSSM  74

>PYAR_23207
Length=112

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (56%), Gaps = 0/59 (0%)

Query  6   RELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
           RE+  LY+++L+LA+  P  KR + ++ I+ +F     LTD   +   I  AQ+ +  L
Sbjct  8   REVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>CCI44232
Length=105

 Score = 36.6 bits (83),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
           LY+++LRLA+  P  KR + ++ IR +FR   ++  P  +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>PHYRA_75193
Length=104

 Score = 35.0 bits (79),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS-YLKIV  67
           LY+  +RLAQ +     K Q+  D +RR+F    D TDP++V AL   A   LS YL + 
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANAIRGLSNYLMLA  73

Query  68  T  68
            
Sbjct  74  N  74

>PYIW_14293
Length=104

 Score = 33.9 bits (76),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 3/66 (5%)

Query  2   AEAMRELRPLYKKLLRLAQSLP-EPKRQSSI-DQIRRDFRNHGDLTDPQEVSALIQRAQS  59
           A+  R    LY+  +RLA+ +    K+ S+I D IRR+F    D TDP+++ AL   A  
Sbjct  4   AQVSRTSIQLYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEALKTNAIR  63

Query  60  SLS-YL  64
            LS YL
Sbjct  64  GLSNYL  69

>H310_07567
Length=98

 Score = 33.5 bits (75),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64
           +Y+++L+LA+  P  KR   ++ I+ +F ++  LTDP ++   +  A   +  L
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQL  63

>PHYKE_5532
Length=122

 Score = 33.5 bits (75),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query  31  IDQIRRDFRNHGD---LTDPQEVSALIQRAQSSLSYLKIVTP  69
           ID +  DF  HGD   L D   VS +  R QS++ +L ++  
Sbjct  45  IDLVNTDFEGHGDIKKLVDGYAVSGVAVRIQSAILFLSLIVA  86

>SDRG_14912
Length=105

 Score = 32.7 bits (73),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 0/61 (0%)

Query  4   AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
           A R +  +Y+++L+LAQ  P  K+   +  I+ +F  +  LTD  ++   I  A   +  
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQ  61

Query  64  L  64
           L
Sbjct  62  L  62

>SPRG_12883
Length=105

 Score = 32.7 bits (73),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 0/61 (0%)

Query  4   AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
           A R +  +Y+++L+LAQ  P  K+   +  I+ +F  +  LTD  ++   I  A   +  
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQ  61

Query  64  L  64
           L
Sbjct  62  L  62

>CCI48720
Length=114

 Score = 32.0 bits (71),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 22/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query  2   AEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSL  61
           A A+R+    Y++  R+   LP   R     QIR +F N   + + +++  L++  +  L
Sbjct  15  AAALRQ----YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQL  70

Query  62  SYLKIVTPRAESNMGVQRYIYRNGQRVNA  90
            Y+  +   A S    +R + RN +  N 
Sbjct  71  KYVSSLVDTAVSKQHQKRKVNRNPEHTNG  99

>SPRG_11731
Length=431

 Score = 32.7 bits (73),  Expect = 0.61, Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 5/81 (6%)

Query  2    AEAMRELRPLYKKLLRLAQSLPE--PKRQSSIDQIRRD--FRNHGDLTDPQEVSALIQRA  57
            ++A +  RPL K  L L   L +  PK++ + +Q  +   FR+H  L DP  VS  I   
Sbjct  294  SKAEKRKRPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPHLQDPATVSTWIPTI  353

Query  58   QSSLSYLKIVTPRAESNMGVQ  78
             S+ S  ++ T +A+   G Q
Sbjct  354  TSA-SCHEMATRKAKKESGAQ  373

>H257_07358
Length=98

 Score = 31.2 bits (69),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (52%), Gaps = 3/66 (5%)

Query  11  LYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLK---IV  67
           +Y+++L+LA   P  K++  +  I+ +F  +  LTDP ++   I  A   +  L     +
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGIQQLNQYVAL  69

Query  68  TPRAES  73
            P A+S
Sbjct  70  DPNAQS  75

>PHYCA_540461
Length=104

 Score = 30.8 bits (68),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS-YLKIV  67
           LY+  LRLA+ +     K Q+  D +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  68  T  68
            
Sbjct  74  N  74

>PYVX_15150
Length=746

 Score = 31.6 bits (70),  Expect = 1.4, Method: Composition-based stats.
 Identities = 13/45 (29%), Positives = 26/45 (58%), Gaps = 2/45 (4%)

Query  38   FRNHGDLTDPQEVSALIQ--RAQSSLSYLKIVTPRAESNMGVQRY  80
            FR+  D ++   V  +++  R+  SL YL +V PR + +  ++R+
Sbjct  614  FRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQHDASLERF  658

>PYVX_18358
Length=62

 Score = 29.3 bits (64),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  11  LYKKLLRLAQSLP-EPKRQSSI-DQIRRDFRNHGDLTDPQEVSALIQRAQSSLS  62
           LY+  LRLA+ +  + K+  +I + +RR+F      TDP+++ AL   A   LS
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEALKANAIRGLS  54

>PYIW_19705
Length=340

 Score = 30.4 bits (67),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 9/75 (12%)

Query  23   PEPKRQSSIDQI-----RRDFRNHGDLTDPQ--EVSALIQRAQSSLSYLKIVTP--RAES  73
            PEPKR+S +D       RRD        D +  + +ALI R++S+++ L+ +T   RA +
Sbjct  231  PEPKRESDVDLTALLRQRRDILMKLSKLDQEKAKTNALISRSKSTIANLRRITSNGRAST  290

Query  74   NMGVQRYIYRNGQRV  88
            + G   Y    G  V
Sbjct  291  SSGPHSYSLSRGSSV  305

>PHYCA_507051
Length=77

 Score = 28.9 bits (63),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 37/69 (54%), Gaps = 4/69 (6%)

Query  1   MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRD---FRNHGDLTDPQEVSALIQRA  57
           +A+A R  R LY++LLR ++ L EP  +    +  R    F +H +  DP+ V + I+R 
Sbjct  5   LAQAQRNSRSLYRRLLRESRQL-EPNTREFYRRFARSVQGFPSHANDKDPEAVQSHIRRV  63

Query  58  QSSLSYLKI  66
           +  +  + +
Sbjct  64  EQDIHCVLL  72

>PHYSO_514323
Length=104

 Score = 29.3 bits (64),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query  11  LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS-YLKIV  67
           LY+  +RLA+ +     K Q+  + +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  14  LYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGLSNYLMLA  73

>PITG_17701
Length=104

 Score = 29.3 bits (64),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query  11  LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS-YLKIV  67
           LY+  LRLA+ +     K Q+  + +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIRELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

>PYIR_18223
Length=105

 Score = 28.9 bits (63),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 3/57 (5%)

Query  11  LYKKLLRLAQSLP-EPKRQSSIDQ-IRRDFRNHGDLTDPQEVSALIQRAQSSLS-YL  64
           LY+  +RLA+ +  + K+  +I   +RR+F    D TDP+++ AL   A   LS YL
Sbjct  14  LYRDCMRLAKHIGGKSKKGIAIKSLVRREFEKARDETDPEKIEALKTNAIRGLSNYL  70

>PPTG_15655
Length=112

 Score = 28.9 bits (63),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSL--PEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLS-YLKIV  67
           LY+  LRLA+ +     K Q+  + +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  22  LYRDCLRLAKHIGGNSKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  81

Query  68  T  68
            
Sbjct  82  N  82

>PYAP_24867
Length=147

 Score = 28.9 bits (63),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 34/70 (49%), Gaps = 3/70 (4%)

Query  12  YKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIVTPRA  71
           Y + LR+ Q L E  R+    QIR  F  +  + D ++V   I++ +  L +   V+   
Sbjct  26  YHEFLRITQPLAEDTRRDVRQQIRAAFDMYRHVEDEKQVMQFIRQGREQLKH---VSDLV  82

Query  72  ESNMGVQRYI  81
           +S +  QR +
Sbjct  83  DSAVARQRVV  92

>CCA24056
Length=4270

 Score = 29.3 bits (64),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query  60    SLSYLKIVTPRAESNMGVQRYI----YRNGQRVNADEFEEKGEENARWKTQDME  109
             S+  L +V P+ ES   V   +    YR G R++A +     ++N R K+ D E
Sbjct  2039  SMEQLSMVVPKQESKDSVDEILGPVRYREGSRLDATQVPNDAKQNWRSKSTDAE  2092

>PYAR_16000
Length=488

 Score = 29.3 bits (64),  Expect = 9.3, Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 0/56 (0%)

Query  8    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63
            L PL +  L    +LP   +Q S+D I + FR    ++ P +  A + RA     Y
Sbjct  179  LPPLKRACLSPTTTLPPLAQQLSLDDIGKPFRYQRSMSCPSDAMARVARALQEQVY  234

>H257_02543
Length=326

 Score = 28.9 bits (63),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  36   RDFRNHGDLTDPQEVSALIQRAQSSLSYLKIVTPRA  71
            R F    D+T PQ +   + +AQ+S+  + I+ P A
Sbjct  93   RIFTQTADVTSPQAIKCAVGQAQASVGPIDILFPNA  128

Lambda      K        H        a         alpha
   0.316    0.133    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3387843954

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40