Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_171251475428328314310.0
PHYCA_1294851475425123411497e-160
PITG_184531475425225211359e-158
PHYRA_811021475425125210603e-146
PHYRA_725046951625125210603e-146
PHYRA_7182580282542318172e-109
PPTG_0889380282512347626e-101
PHYRA_81103712622522347565e-100
PITG_0971680282502347522e-99
PHYCA_12149480282482327349e-97
PPTG_16851236932492347312e-96
PHYSO_26126580282472537286e-96
PHYCA_10034368662742327291e-95
PHYKE_6286599492502357156e-94
PHYSO_254108170262462306852e-89
PHYCA_118548170262462306826e-89
PITG_19936157132492326681e-86
PPTG_07664170262452306671e-86
PPTG_17049237772552346672e-86
PHYCA_9298368522482536653e-86
PHYRA_74356698952442306592e-85
PITG_22053170262452306565e-85
PITG_04208205112452306566e-85
PHYCA_118674205112812816526e-84
PHYRA_74306205112452306453e-83
PHYCA_132252157132492336435e-83
PITG_19938353892452286392e-82
PHYRA_52440170262432286358e-82
PHYSO_526623599492492336298e-81
PHYSO_526774157132492386281e-80
PITG_0424836902452346271e-80
PPTG_0767136902462346202e-79
PHYCA_11855136902452346182e-79
PHYRA_74343698872492336142e-78
PHYSO_526832353892492336123e-78
PHYSO_52607137012492336114e-78
PHYRA_74307422182492336036e-77
PITG_0420036612472316029e-77
PITG_0426737012792336022e-76
PHYRA_74310599492492325983e-76
PHYCA_122048693172362345922e-75
PPTG_19331246513682306032e-75
PHYCA_107869246513422385987e-75
PHYRA_72386459152452315837e-74
PHYRA_72344817002452315837e-74
PPTG_17245238632572395838e-74
PHYSO_329843510942392345801e-73
PHYRA_76249246513262345853e-73
PHYCA_123779173642772325804e-73
PHYCA_129784817002462315774e-73
PHYSO_249692459152482315775e-73
PHYSO_507736135312362325731e-72
PHYKE_2376459153222355802e-72
PPTG_15224963762462305742e-72
PPTG_06973368661651665653e-72
PHYRA_71477693172382305705e-72
PHYRA_71404563202452315697e-72
PHYRA_5242336901932015647e-72
PHYRA_72433694822452315681e-71
PPTG_0766037012162205632e-71
PHYKE_4438758943392345733e-71
PHYRA_72438135312362315601e-70
PPTG_15233231122352325582e-70
PHYCA_108039563202152345562e-70
PPTG_17409743732352305583e-70
PPTG_15230817002522315584e-70
PHYRA_71308231122362315565e-70
PHYCA_9358368552522405561e-69
PHYRA_4287689222132325521e-69
PHYKE_5753763302382345541e-69
PHYSO_527352600202452355542e-69
PPTG_08017207076162345812e-69
PYVX_22467135312362305513e-69
PHYCA_11835636612522345523e-69
PHYSO_406265173642322365495e-69
PHYCA_11951135312342275496e-69
PPTG_19330563203162355513e-68
PHYSO_25411236902242285433e-68
PPTG_18464243182472335444e-68
PPTG_07661600202232255417e-68
PITG_22668173645192365631e-67
PHYKE_7564459204732345591e-67
PHALS_06162173644882365592e-67
PHYCA_18373353892462115392e-67
PPTG_08005173647592365733e-67
PHYSO_259736247322312305383e-67
PPTG_19506247322232255364e-67
PHYRA_72345517562402345375e-67
PHYKE_494670892632325386e-67
PHYRA_71931510942392315367e-67
PHYSO_414520550602132285321e-66
PHYSO_468315563202552315351e-66
PPTG_12847511263312325384e-66
PPTG_1285370893422325395e-66
PPTG_07089202542552325315e-66
PHYCA_10840970892822345328e-66
PYU1_G011231459142382285271e-65
PHYSO_51088870892552325281e-65
PHYRA_71588693332422555272e-65
PYU1_G011237817002352335262e-65
PHYRA_71618578972432355262e-65
PHYCA_119748423082612365282e-65
PHYRA_74617699543372305342e-65
PHYSO_334487517562582345264e-65
PHYCA_69480391942132285216e-65
PPTG_13769592663492345301e-64
PHYSO_334498517572292205192e-64
PPTG_12852223223312365282e-64
PHYKE_4541759501471475093e-64
PYU1_G011233694602392325174e-64
PHYRA_74630202543432305256e-64
PPTG_2217436987712315499e-64
PHYRA_72165599392402565141e-63
PHYSO_249751459202382335123e-63
PHYRA_72475695022432355123e-63
PHYCA_69477391922132285093e-63
PITG_0852270893822325224e-63
HYAP_0924370892662295125e-63
PHYSO_397673703072242305086e-63
PITG_22734422181681535037e-63
PITG_22916720282482325081e-62
PHYSO_330015511262412355072e-62
PHYRA_5432770892192325052e-62
PPTG_13736226162362315062e-62
PYU1_G011236135312372325043e-62
PHYRA_86968733682392375044e-62
PYIR_13251817002362325034e-62
PYU1_G011235963762382295035e-62
PHYKE_5655578972432395045e-62
PPTG_07277203402982365061e-61
PHYKE_7566459142602325012e-61
PHYRA_49009690712162334963e-61
PHYCA_69479391932132284937e-61
PHYRA_46230550602122274938e-61
PPTG_15231135312582324952e-60
PHYRA_52960691982232284903e-60
PHYRA_52955691972232284903e-60
PYU1_G011230817012382284904e-60
PHYCA_12462369161771634854e-60
PHYRA_39489686262372354905e-60
PHYRA_72477695042382364905e-60
PYIR_13252817012362324906e-60
PHYRA_83592763302372314898e-60
PYIR_13275135312372364889e-60
PHYSO_336498177692382324881e-59
PYIW_25259817002462414891e-59
PHYCA_123205425681771634802e-59
PHYRA_45457517571991974823e-59
PHYSO_496064578972542234863e-59
PHYKE_7568608783722324937e-59
PHYRA_72390592662372314811e-58
PHYCA_683589222102164772e-58
PHYSO_490000575402412544792e-58
PHYSO_329114510052362244774e-58
HYAP_06628642572452314785e-58
PHYSO_526541599392392414775e-58
PHYRA_43347688002202054755e-58
PHALS_0608470892602344787e-58
PHYSO_255972205112152334702e-57
PHYCA_132529435382322364722e-57
PHYCA_69457511262132284703e-57
PHALS_13513157132402324713e-57
PPTG_04799194622452404724e-57
PPTG_004608462592274724e-57
PPTG_15234608782352324697e-57
PHYRA_52426600201521604618e-57
HYAP_08306563202862324729e-57
PHYRA_84277720282402374671e-56
PITG_16866135312382314672e-56
PHYRA_71307608782372324662e-56
PHYRA_44405688542322344653e-56
PHYRA_76657703212392374654e-56
PHYRA_75425176762372324627e-56
PHYRA_84273720242372334629e-56
PPTG_17295238912382324611e-55
PPTG_11469451342532484621e-55
PHYRA_72385694602372324601e-55
PHYRA_41766511262092274572e-55
PPTG_17453177692542484603e-55
HYAP_07436646842672304613e-55
PPTG_13026694282382314575e-55
HYAP_07925649412672304595e-55
PHYCA_576423176762342294558e-55
PHYSO_52785036611951744519e-55
PHYSO_560790608782372344559e-55
PHALS_14425357673022314609e-55
PHYSO_254099368522352334541e-54
PHYCA_129892608782342294522e-54
PHYRA_71310459142372324532e-54
PPTG_07991207012762344552e-54
PPTG_08703209012542484533e-54
PHYSO_423056554102332224513e-54
PPTG_14652229162572324533e-54
PHYCA_553546452582802724553e-54
PHYCA_123797207012412344514e-54
PYVX_22469517584742344684e-54
PITG_23228177692542474525e-54
PHYSO_365942537682332234505e-54
PHYRA_72531695292362384505e-54
PHYRA_72403694692392374481e-53
PHYSO_521124595742542484472e-53
PHYRA_83851719182392384453e-53
PHYRA_5242737011241324353e-53
PHYKE_208743731871514404e-53
PHYCA_109174413332772764474e-53
PHYSO_504553689972572454455e-53
PHYSO_365377537622202274425e-53
PPTG_00471720282392274402e-52
PHYRA_52260691692342344402e-52
PHYRA_76603703072392374392e-52
PHYCA_124462426702802764432e-52
PHYCA_544885451342562504403e-52
PITG_23211177602452294393e-52
PHYSO_334500517582352324374e-52
PHYSO_254223422182272344364e-52
PITG_009578462982314417e-52
PITG_22981175962592284361e-51
PHALS_1442380283792364442e-51
PHYRA_72541695342392374332e-51
PHALS_12600147542672324352e-51
PPTG_18463452582542504333e-51
PHYRA_47241690031761604263e-51
PHYKE_8391147537781414603e-51
PHYSO_482931571392542474315e-51
PITG_23051176512802434329e-51
PHYCA_69122177692492484281e-50
PHYCA_114913419272242274261e-50
PHYRA_72430461762382314262e-50
PHYRA_72306694282382314262e-50
PITG_23076176682762744292e-50
PHYCA_109089173962772744292e-50
PHYCA_10570176672782774292e-50
PHYCA_109095413122772734293e-50
HYAP_14846685472212384243e-50
PHALS_13512353892432284254e-50
PHYCA_109192413382782824275e-50
PHYSO_480321570042542474238e-50
PHYSO_253029461762522334239e-50
PHYSO_246397456772642454231e-49
PHYSO_514298591312642454222e-49
PHYCA_124383426672802714232e-49
PHYRA_47103689972262254182e-49
PPTG_13004176512552534212e-49
PHYSO_328418509152192334172e-49
PHYRA_52296691712372364183e-49
PPTG_03796191822552504194e-49
PHYCA_109162413302572524194e-49
PPTG_16647236412542474186e-49
PHYSO_516261592662272314156e-49
HYAP_04977634662622264187e-49
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17125

Length=283
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17125                                                            555        0.0   
PHYCA_129485                                                          447        7e-160
PITG_18453                                                            441        9e-158
PHYRA_81102                                                           412        3e-146
PHYRA_72504                                                           412        3e-146
PHYRA_71825                                                           319        2e-109
PPTG_08893                                                            298        6e-101
PHYRA_81103                                                           295        5e-100
PITG_09716                                                            294        2e-99 
PHYCA_121494                                                          287        9e-97 
PPTG_16851                                                            286        2e-96 
PHYSO_261265                                                          285        6e-96 
PHYCA_10034                                                           285        1e-95 
PHYKE_6286                                                            280        6e-94 
PHYSO_254108                                                          268        2e-89 
PHYCA_118548                                                          267        6e-89 
PITG_19936                                                            261        1e-86 
PPTG_07664                                                            261        1e-86 
PPTG_17049                                                            261        2e-86 
PHYCA_9298                                                            260        3e-86 
PHYRA_74356                                                           258        2e-85 
PITG_22053                                                            257        5e-85 
PITG_04208                                                            257        6e-85 
PHYCA_118674                                                          255        6e-84 
PHYRA_74306                                                           253        3e-83 
PHYCA_132252                                                          252        5e-83 
PITG_19938                                                            250        2e-82 
PHYRA_52440                                                           249        8e-82 
PHYSO_526623                                                          246        8e-81 
PHYSO_526774                                                          246        1e-80 
PITG_04248                                                            246        1e-80 
PPTG_07671                                                            243        2e-79 
PHYCA_118551                                                          242        2e-79 
PHYRA_74343                                                           241        2e-78 
PHYSO_526832                                                          240        3e-78 
PHYSO_526071                                                          239        4e-78 
PHYRA_74307                                                           236        6e-77 
PITG_04200                                                            236        9e-77 
PITG_04267                                                            236        2e-76 
PHYRA_74310                                                           234        3e-76 
PHYCA_122048                                                          232        2e-75 
PPTG_19331                                                            236        2e-75 
PHYCA_107869                                                          234        7e-75 
PHYRA_72386                                                           229        7e-74 
PHYRA_72344                                                           229        7e-74 
PPTG_17245                                                            229        8e-74 
PHYSO_329843                                                          228        1e-73 
PHYRA_76249                                                           229        3e-73 
PHYCA_123779                                                          228        4e-73 
PHYCA_129784                                                          226        4e-73 
PHYSO_249692                                                          226        5e-73 
PHYSO_507736                                                          225        1e-72 
PHYKE_2376                                                            228        2e-72 
PPTG_15224                                                            225        2e-72 
PPTG_06973                                                            222        3e-72 
PHYRA_71477                                                           224        5e-72 
PHYRA_71404                                                           223        7e-72 
PHYRA_52423                                                           221        7e-72 
PHYRA_72433                                                           223        1e-71 
PPTG_07660                                                            221        2e-71 
PHYKE_4438                                                            225        3e-71 
PHYRA_72438                                                           220        1e-70 
PPTG_15233                                                            219        2e-70 
PHYCA_108039                                                          218        2e-70 
PPTG_17409                                                            219        3e-70 
PPTG_15230                                                            219        4e-70 
PHYRA_71308                                                           218        5e-70 
PHYCA_9358                                                            218        1e-69 
PHYRA_42876                                                           217        1e-69 
PHYKE_5753                                                            218        1e-69 
PHYSO_527352                                                          218        2e-69 
PPTG_08017                                                            228        2e-69 
PYVX_22467                                                            216        3e-69 
PHYCA_118356                                                          217        3e-69 
PHYSO_406265                                                          216        5e-69 
PHYCA_11951                                                           216        6e-69 
PPTG_19330                                                            216        3e-68 
PHYSO_254112                                                          213        3e-68 
PPTG_18464                                                            214        4e-68 
PPTG_07661                                                            213        7e-68 
PITG_22668                                                            221        1e-67 
PHYKE_7564                                                            219        1e-67 
PHALS_06162                                                           219        2e-67 
PHYCA_18373                                                           212        2e-67 
PPTG_08005                                                            225        3e-67 
PHYSO_259736                                                          211        3e-67 
PPTG_19506                                                            211        4e-67 
PHYRA_72345                                                           211        5e-67 
PHYKE_4946                                                            211        6e-67 
PHYRA_71931                                                           211        7e-67 
PHYSO_414520                                                          209        1e-66 
PHYSO_468315                                                          210        1e-66 
PPTG_12847                                                            211        4e-66 
PPTG_12853                                                            212        5e-66 
PPTG_07089                                                            209        5e-66 
PHYCA_108409                                                          209        8e-66 
PYU1_G011231                                                          207        1e-65 
PHYSO_510888                                                          207        1e-65 
PHYRA_71588                                                           207        2e-65 
PYU1_G011237                                                          207        2e-65 
PHYRA_71618                                                           207        2e-65 
PHYCA_119748                                                          207        2e-65 
PHYRA_74617                                                           210        2e-65 
PHYSO_334487                                                          207        4e-65 
PHYCA_69480                                                           205        6e-65 
PPTG_13769                                                            208        1e-64 
PHYSO_334498                                                          204        2e-64 
PPTG_12852                                                            207        2e-64 
PHYKE_4541                                                            200        3e-64 
PYU1_G011233                                                          203        4e-64 
PHYRA_74630                                                           206        6e-64 
PPTG_22174                                                            216        9e-64 
PHYRA_72165                                                           202        1e-63 
PHYSO_249751                                                          201        3e-63 
PHYRA_72475                                                           201        3e-63 
PHYCA_69477                                                           200        3e-63 
PITG_08522                                                            205        4e-63 
HYAP_09243                                                            201        5e-63 
PHYSO_397673                                                          200        6e-63 
PITG_22734                                                            198        7e-63 
PITG_22916                                                            200        1e-62 
PHYSO_330015                                                          199        2e-62 
PHYRA_54327                                                           199        2e-62 
PPTG_13736                                                            199        2e-62 
PYU1_G011236                                                          198        3e-62 
PHYRA_86968                                                           198        4e-62 
PYIR_13251                                                            198        4e-62 
PYU1_G011235                                                          198        5e-62 
PHYKE_5655                                                            198        5e-62 
PPTG_07277                                                            199        1e-61 
PHYKE_7566                                                            197        2e-61 
PHYRA_49009                                                           195        3e-61 
PHYCA_69479                                                           194        7e-61 
PHYRA_46230                                                           194        8e-61 
PPTG_15231                                                            195        2e-60 
PHYRA_52960                                                           193        3e-60 
PHYRA_52955                                                           193        3e-60 
PYU1_G011230                                                          193        4e-60 
PHYCA_12462                                                           191        4e-60 
PHYRA_39489                                                           193        5e-60 
PHYRA_72477                                                           193        5e-60 
PYIR_13252                                                            193        6e-60 
PHYRA_83592                                                           192        8e-60 
PYIR_13275                                                            192        9e-60 
PHYSO_336498                                                          192        1e-59 
PYIW_25259                                                            192        1e-59 
PHYCA_123205                                                          189        2e-59 
PHYRA_45457                                                           190        3e-59 
PHYSO_496064                                                          191        3e-59 
PHYKE_7568                                                            194        7e-59 
PHYRA_72390                                                           189        1e-58 
PHYCA_6835                                                            188        2e-58 
PHYSO_490000                                                          189        2e-58 
PHYSO_329114                                                          188        4e-58 
HYAP_06628                                                            188        5e-58 
PHYSO_526541                                                          188        5e-58 
PHYRA_43347                                                           187        5e-58 
PHALS_06084                                                           188        7e-58 
PHYSO_255972                                                          185        2e-57 
PHYCA_132529                                                          186        2e-57 
PHYCA_69457                                                           185        3e-57 
PHALS_13513                                                           186        3e-57 
PPTG_04799                                                            186        4e-57 
PPTG_00460                                                            186        4e-57 
PPTG_15234                                                            185        7e-57 
PHYRA_52426                                                           182        8e-57 
HYAP_08306                                                            186        9e-57 
PHYRA_84277                                                           184        1e-56 
PITG_16866                                                            184        2e-56 
PHYRA_71307                                                           184        2e-56 
PHYRA_44405                                                           183        3e-56 
PHYRA_76657                                                           183        4e-56 
PHYRA_75425                                                           182        7e-56 
PHYRA_84273                                                           182        9e-56 
PPTG_17295                                                            182        1e-55 
PPTG_11469                                                            182        1e-55 
PHYRA_72385                                                           181        1e-55 
PHYRA_41766                                                           180        2e-55 
PPTG_17453                                                            181        3e-55 
HYAP_07436                                                            182        3e-55 
PPTG_13026                                                            180        5e-55 
HYAP_07925                                                            181        5e-55 
PHYCA_576423                                                          179        8e-55 
PHYSO_527850                                                          178        9e-55 
PHYSO_560790                                                          179        9e-55 
PHALS_14425                                                           181        9e-55 
PHYSO_254099                                                          179        1e-54 
PHYCA_129892                                                          178        2e-54 
PHYRA_71310                                                           179        2e-54 
PPTG_07991                                                            179        2e-54 
PPTG_08703                                                            179        3e-54 
PHYSO_423056                                                          178        3e-54 
PPTG_14652                                                            179        3e-54 
PHYCA_553546                                                          179        3e-54 
PHYCA_123797                                                          178        4e-54 
PYVX_22469                                                            184        4e-54 
PITG_23228                                                            178        5e-54 
PHYSO_365942                                                          177        5e-54 
PHYRA_72531                                                           177        5e-54 
PHYRA_72403                                                           177        1e-53 
PHYSO_521124                                                          176        2e-53 
PHYRA_83851                                                           176        3e-53 
PHYRA_52427                                                           172        3e-53 
PHYKE_208                                                             174        4e-53 
PHYCA_109174                                                          176        4e-53 
PHYSO_504553                                                          176        5e-53 
PHYSO_365377                                                          174        5e-53 
PPTG_00471                                                            174        2e-52 
PHYRA_52260                                                           174        2e-52 
PHYRA_76603                                                           173        2e-52 
PHYCA_124462                                                          175        2e-52 
PHYCA_544885                                                          174        3e-52 
PITG_23211                                                            173        3e-52 
PHYSO_334500                                                          172        4e-52 
PHYSO_254223                                                          172        4e-52 
PITG_00957                                                            174        7e-52 
PITG_22981                                                            172        1e-51 
PHALS_14423                                                           175        2e-51 
PHYRA_72541                                                           171        2e-51 
PHALS_12600                                                           172        2e-51 
PPTG_18463                                                            171        3e-51 
PHYRA_47241                                                           168        3e-51 
PHYKE_8391                                                            181        3e-51 
PHYSO_482931                                                          170        5e-51 
PITG_23051                                                            171        9e-51 
PHYCA_69122                                                           169        1e-50 
PHYCA_114913                                                          168        1e-50 
PHYRA_72430                                                           168        2e-50 
PHYRA_72306                                                           168        2e-50 
PITG_23076                                                            169        2e-50 
PHYCA_109089                                                          169        2e-50 
PHYCA_10570                                                           169        2e-50 
PHYCA_109095                                                          169        3e-50 
HYAP_14846                                                            167        3e-50 
PHALS_13512                                                           168        4e-50 
PHYCA_109192                                                          169        5e-50 
PHYSO_480321                                                          167        8e-50 
PHYSO_253029                                                          167        9e-50 
PHYSO_246397                                                          167        1e-49 
PHYSO_514298                                                          167        2e-49 
PHYCA_124383                                                          167        2e-49 
PHYRA_47103                                                           165        2e-49 
PPTG_13004                                                            166        2e-49 
PHYSO_328418                                                          165        2e-49 
PHYRA_52296                                                           165        3e-49 
PPTG_03796                                                            166        4e-49 
PHYCA_109162                                                          166        4e-49 
PPTG_16647                                                            165        6e-49 
PHYSO_516261                                                          164        6e-49 
HYAP_04977                                                            165        7e-49 
PHYCA_108964                                                          165        1e-48 
HYAP_05559                                                            165        1e-48 
PHYCA_109163                                                          164        2e-48 
PPTG_10591                                                            163        3e-48 
PHALS_03592                                                           163        3e-48 
PPTG_11475                                                            164        4e-48 
PPTG_15262                                                            162        5e-48 
PPTG_15220                                                            162        5e-48 
HYAP_05558                                                            163        5e-48 
PITG_22709                                                            163        6e-48 
PPTG_15218                                                            161        8e-48 
PITG_23094                                                            161        1e-47 
PHYCA_133546                                                          162        2e-47 
PPTG_05581                                                            162        2e-47 
PHYCA_123587                                                          159        1e-46 
PPTG_06202                                                            159        1e-46 
PPTG_00542                                                            158        2e-46 
PHYSO_249691                                                          157        3e-46 
HYAP_14784                                                            158        3e-46 
PHYCA_544875                                                          158        4e-46 
PPTG_04504                                                            157        7e-46 
PHYSO_480350                                                          156        1e-45 
PPTG_15219                                                            155        3e-45 
PHYRA_72357                                                           154        4e-45 
PHALS_02474                                                           155        4e-45 
PHALS_08480                                                           155        5e-45 
PHYSO_251206                                                          154        6e-45 
PHALS_08447                                                           153        1e-44 
PHYCA_10715                                                           151        3e-44 
PPTG_05868                                                            153        4e-44 
PHYRA_45462                                                           150        5e-44 
PHALS_08947                                                           152        7e-44 
PHYCA_132177                                                          150        2e-43 
PHALS_08945                                                           150        2e-43 
PHYSO_449487                                                          146        3e-43 
PYAP_24304                                                            149        5e-43 
PITG_23075                                                            150        8e-43 
PHYKE_5284                                                            146        6e-42 
PHYCA_133455                                                          144        9e-42 
PPTG_07667                                                            143        1e-41 
PHALS_08445                                                           145        2e-41 
PHYCA_118700                                                          144        4e-41 
PHYKE_7565                                                            143        5e-41 
PHYSO_263794                                                          142        1e-40 
PHYCA_59113                                                           140        2e-40 
PPTG_07668                                                            137        8e-40 
PHALS_05391                                                           141        9e-40 
PITG_23055                                                            140        1e-39 
PHYSO_481543                                                          140        2e-39 
PITG_23062                                                            140        4e-39 
PHYCA_5621                                                            138        6e-39 
HYAP_08846                                                            138        4e-38 
PYAP_24339                                                            134        2e-37 
PPTG_15860                                                            133        2e-37 
PYAP_24757                                                            134        6e-37 
PHYCA_109151                                                          130        1e-36 
PPTG_11648                                                            132        7e-36 
PHYSO_327908                                                          138        1e-35 
PYAR_24955                                                            130        1e-35 
PHALS_01213                                                           129        3e-35 
PHYSO_338051                                                          125        4e-34 
PHYSO_260049                                                          124        8e-34 
PHYSO_526791                                                          123        9e-34 
PHYSO_246660                                                          125        1e-33 
PHYSO_342831                                                          122        3e-33 
PHYSO_327912                                                          123        4e-33 
PHYCA_109441                                                          122        7e-33 
PITG_10839                                                            119        8e-33 
PPTG_11479                                                            123        8e-33 
PHYSO_508915                                                          120        2e-32 
PHYSO_245789                                                          119        3e-32 
HYAP_07033                                                            119        8e-32 
PHYSO_327911                                                          117        5e-31 
PHYCA_11676                                                           116        1e-30 
PHYSO_251461                                                          116        1e-30 
PHYSO_257244                                                          118        1e-30 
PHYSO_477165                                                          113        2e-30 
PHYSO_264058                                                          112        2e-29 
PHYKE_1224                                                            110        2e-29 
PHALS_05247                                                           114        2e-29 
PPTG_07690                                                            109        5e-29 
PHYSO_444351                                                          107        1e-28 
PHYRA_39486                                                           109        1e-28 
PYIW_24350                                                            110        2e-28 
PHYRA_39485                                                           108        4e-28 
HYAP_07922                                                            105        2e-27 
PHYCA_73404                                                           102        6e-27 
PHYRA_44618                                                           103        1e-26 
HYAP_05562                                                            105        2e-26 
PHYCA_507156                                                          102        4e-26 
PPTG_23721                                                            108        6e-26 
PHYCA_59410                                                           100        9e-26 
PHALS_13274                                                           104        1e-25 
PHYRA_52174                                                           103        2e-25 
PHYSO_333132                                                          99.4       1e-24 
PYAR_25201                                                            99.8       1e-24 
PHYSO_341539                                                          101        1e-24 
PPTG_11420                                                            98.6       5e-24 
PHYCA_73400                                                           93.2       3e-23 
PHYSO_335497                                                          97.4       5e-23 
PHYSO_509491                                                          92.4       6e-23 
PYAR_21977                                                            96.7       6e-23 
PHYCA_18619                                                           92.8       2e-22 
PHYSO_261711                                                          94.7       2e-22 
PHYCA_119285                                                          88.2       4e-21 
PHALS_14424                                                           87.4       2e-20 
PYAR_26314                                                            85.1       1e-19 
PHYSO_526695                                                          84.3       2e-19 
PHYCA_73406                                                           82.4       4e-19 
PHYCA_73407                                                           82.4       4e-19 
HYAP_07496                                                            83.2       4e-19 
PHYKE_7051                                                            84.0       5e-19 
PHYSO_264049                                                          82.8       7e-19 
PHYSO_245887                                                          83.6       7e-19 
PYU1_G011232                                                          80.1       3e-18 
PITG_22876                                                            80.5       8e-18 
PHYKE_4231                                                            77.8       6e-17 
PHYKE_6288                                                            76.6       1e-16 
HYAP_07372                                                            78.6       1e-16 
PHYSO_445618                                                          75.9       1e-16 
PHYSO_377094                                                          73.6       7e-16 
PITG_23039                                                            70.9       4e-14 
PPTG_05373                                                            71.2       5e-14 
HYAP_08078                                                            68.6       3e-13 
PPTG_08713                                                            68.2       3e-13 
PPTG_11472                                                            70.9       9e-13 
PHYCA_108999                                                          65.1       2e-12 
PYAR_26415                                                            64.3       2e-12 
HYAP_11184                                                            61.2       6e-11 
PHYSO_515401                                                          60.1       2e-10 
PPTG_19242                                                            58.2       9e-10 
PPTG_23679                                                            59.3       9e-10 
PHYSO_336673                                                          55.1       2e-08 
PHYSO_260072                                                          55.1       3e-08 
PYIW_25932                                                            50.8       2e-07 
PPTG_19622                                                            49.7       2e-07 
HYAP_08850                                                            50.8       1e-06 
PPTG_17455                                                            49.3       1e-06 
PPTG_04456                                                            47.8       1e-06 
PPTG_20067                                                            48.9       2e-06 
PYVX_16508                                                            50.1       4e-06 
PHYKE_6287                                                            45.1       1e-05 
PYIR_26577                                                            44.7       2e-05 
PPTG_20194                                                            46.2       2e-05 
PHYSO_335499                                                          48.1       2e-05 
PHYRA_85280                                                           47.8       3e-05 
HYAP_03446                                                            42.4       2e-04 
HYAP_12828                                                            41.2       2e-04 
PYVX_21088                                                            40.8       0.004 
PHYSO_333483                                                          33.5       0.67  
HYAP_08851                                                            32.0       0.91  
PHYCA_120366                                                          33.9       1.1   
CCA18792                                                              33.1       2.1   
PHYRA_74557                                                           32.7       2.6   
PYAP_24306                                                            30.4       3.6   
PHYCA_98739                                                           30.8       3.7   
CCI50913                                                              31.2       4.6   
PITG_09483                                                            31.6       5.1   
PITG_11087                                                            31.6       5.6   
H257_14098                                                            31.6       7.3   
PHYSO_554926                                                          31.6       8.1   
PPTG_07814                                                            31.2       8.8   

>PPTG_17125
Length=283

 Score = 555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/283 (100%), Positives = 283/283 (100%), Gaps = 0/283 (0%)

Query  1    MLAVRAELYFAIVTTESSPLDGGEHQKNEGKMNYRavliavvaslaavvEGQVIGHNQVR  60
            MLAVRAELYFAIVTTESSPLDGGEHQKNEGKMNYRAVLIAVVASLAAVVEGQVIGHNQVR
Sbjct  1    MLAVRAELYFAIVTTESSPLDGGEHQKNEGKMNYRAVLIAVVASLAAVVEGQVIGHNQVR  60

Query  61   PFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLG  120
            PFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLG
Sbjct  61   PFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLG  120

Query  121  SQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENST  180
            SQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENST
Sbjct  121  SQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENST  180

Query  181  ILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDE  240
            ILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDE
Sbjct  181  ILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDE  240

Query  241  LSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            LSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF
Sbjct  241  LSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283

>PHYCA_129485
Length=251

 Score = 447 bits (1149),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 209/234 (89%), Positives = 222/234 (95%), Gaps = 0/234 (0%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            + QVIGH+QVRPFP+P+PVT S KAAVK+KPQLKI DGCHPYPAVQKDGSI+GGLKWSGP
Sbjct  18   QAQVIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGP  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            QDGECTGSKLGSQIYARS WVNDVWAIMYAWYFPKGRGAVP+PLI RLFGHRHNWEY IV
Sbjct  78   QDGECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIV  137

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP+ +NSTILGVSMSA+VGYASQTPPE  YVDGDSVKL+YYYNHLLGSTSLQLTE T
Sbjct  138  WIDNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDT  197

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GEFQDLITWDELSKLARYSLNHTDWDETLF+LAGLKMPLKDGVF ELL+KAWPF
Sbjct  198  GEFQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251

>PITG_18453
Length=252

 Score = 441 bits (1135),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 228/252 (90%), Positives = 240/252 (95%), Gaps = 0/252 (0%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            M++RAVLIA  ASLAA V GQVIGHNQVRPF EPEPVTFSQKAAVKYKPQLKIEDGCHPY
Sbjct  1    MSFRAVLIAATASLAAGVLGQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPY  60

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVP 
Sbjct  61   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPA  120

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLK  211
            PLILRLFGHRHNWEYAIVWIDNPELENSTILGVS+SAS+ YAS+TPPE  +VDG+SVKL+
Sbjct  121  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLE  180

Query  212  YYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDG  271
            YYYNHL GSTSLQLTE TGEFQDL+TWD+L+KLARYSLN+TDWDETLFNLAGLKMPLKDG
Sbjct  181  YYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDG  240

Query  272  VFDELLNKAWPF  283
             FDELLNKAWPF
Sbjct  241  EFDELLNKAWPF  252

>PHYRA_81102
Length=251

 Score = 412 bits (1060),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 222/252 (88%), Gaps = 1/252 (0%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN+RAV +A +ASLA   + QVIGH+QVRPFP+P+PVT SQK AVK+KPQLKI+ GCHPY
Sbjct  1    MNFRAVFVAAMASLAVA-QAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPY  59

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAVQKDGS+SGGLKWSGPQDGECTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   
Sbjct  60   PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLK  211
            P  LR FGHRHNWEY +VWIDNP LEN+T+LGVSMSAS+GY+ Q P + +YVDG SVK+ 
Sbjct  120  PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179

Query  212  YYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDG  271
            YYYNHLLG+T+LQLTE TGEFQDLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDG
Sbjct  180  YYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDG  239

Query  272  VFDELLNKAWPF  283
            VF+ELL+K WPF
Sbjct  240  VFEELLDKTWPF  251

>PHYRA_72504
Length=251

 Score = 412 bits (1060),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 197/252 (78%), Positives = 222/252 (88%), Gaps = 1/252 (0%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN+RAV +A +ASLA   + QVIGH+QVRPFP+P+PVT SQK AVK+KPQLKI+ GCHPY
Sbjct  1    MNFRAVFVAAMASLAVA-QAQVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPY  59

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAVQKDGS+SGGLKWSGPQDGECTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   
Sbjct  60   PAVQKDGSMSGGLKWSGPQDGECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVP  119

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLK  211
            P  LR FGHRHNWEY +VWIDNP LEN+T+LGVSMSAS+GY+ Q P + +YVDG SVK+ 
Sbjct  120  PDFLRFFGHRHNWEYVVVWIDNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVA  179

Query  212  YYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDG  271
            YYYNHLLG+T+LQLTE TGEFQDLI WD+LS LARYSLNHTDWD+TLF LAGLKMPLKDG
Sbjct  180  YYYNHLLGNTALQLTEDTGEFQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDG  239

Query  272  VFDELLNKAWPF  283
            VF+ELL+K WPF
Sbjct  240  VFEELLDKTWPF  251

>PHYRA_71825
Length=254

 Score = 319 bits (817),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 182/231 (79%), Gaps = 0/231 (0%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            +I H+ V PF +P P T ++KAAVKYKP+L +EDGCHPY AVQ DG+ISGGL+WSGPQDG
Sbjct  24   IIPHDTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCHPYAAVQADGAISGGLEWSGPQDG  83

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
            EC GS LGSQ+YAR   V DVWAIMYAWYFPKGR  +PVPL LR FGHR+ WEYA+VW+D
Sbjct  84   ECRGSPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPLPVPLSLRFFGHRNGWEYAVVWLD  143

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            N   +NST+L  S+SA+VG++ + PP+ +Y DG S+ + YYYNH+ G+T+++ TE  GEF
Sbjct  144  NLNAKNSTVLATSLSAAVGWSKEAPPKEKYFDGTSLMVSYYYNHIFGNTAVKYTEDAGEF  203

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            Q LITWD+L  LAR +LN+TDWD T  N+A +KMP+KDGVF E L  A+PF
Sbjct  204  QPLITWDQLPDLARKALNNTDWDATPSNVARVKMPMKDGVFLEKLEGAYPF  254

>PPTG_08893
Length=251

 Score = 298 bits (762),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 181/234 (77%), Gaps = 3/234 (1%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            + +VI ++ V+PFP+P P T +QKA +KYKPQLK+E+GC PYPAVQ+DG+IS GL+WSGP
Sbjct  21   QSKVIPYDTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGP  80

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            +D  C GS  GSQIYARSK   D WA+MY WYFPKGR  +P P   R  GHRH WEYA+V
Sbjct  81   EDIGCKGSLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGP---RSSGHRHGWEYAVV  137

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D    +NSTILG S+SA+VG+A ++P    Y+DG+S+K+ YY+N    +T+++ T+A 
Sbjct  138  WLDKLTADNSTILGTSLSAAVGWAKESPTPKEYLDGNSLKVAYYFNDDFKNTAVKYTQAG  197

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G FQDLI WD+LS +AR SL++TDWDET FN+A +KMP+KDGVF+E L+ A+PF
Sbjct  198  GAFQDLIIWDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  251

>PHYRA_81103
Length=252

 Score = 295 bits (756),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 177/234 (76%), Gaps = 12/234 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP-QDG  112
            I H+QV+PF +P  +T SQKAAVK+KPQLK  DGC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR---GAVPVPLILRLFGHRHNWEYAIV  169
            +CT   LGSQIYARS W  DVWAIMY WYFPKG    G + +       GHRHNWE+ +V
Sbjct  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIGL-------GHRHNWEFVVV  139

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP L+NSTILGVSMSAS+GY+ + PP+++Y+DG SVK+ Y+Y+ + G+T+L+LTE  
Sbjct  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDA  199

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLI WD+L  +AR +LN TDWD TL+NL   +MPLKD VF + L K+WPF
Sbjct  200  GETQDLIMWDQLPDVARDALN-TDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252

>PITG_09716
Length=250

 Score = 294 bits (752),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 179/234 (76%), Gaps = 3/234 (1%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            + +VI ++ ++PFP+P P T +QKA +KYKPQLK+E+GCHPYPAVQ++G IS GL+WSGP
Sbjct  20   QSKVIPYDTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGP  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            +D  C GS LGSQIYARSK   D WA+MY WYFPKGR  +P    LR  GHRH WEYA+V
Sbjct  80   EDIGCKGSSLGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPG---LRSSGHRHGWEYAVV  136

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D  +  +STILG S+SA+VG+A ++P    Y+DG S+K+ YY+N    +T+++ T+  
Sbjct  137  WLDRLDANSSTILGTSLSAAVGWAKESPTPKEYLDGHSLKVAYYFNDDFSNTAVKYTQDG  196

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G FQDLI WD+LS  AR SL +TDWDETLFN+A +KMP+KDGVF+E L+ A+PF
Sbjct  197  GAFQDLIQWDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  250

>PHYCA_121494
Length=248

 Score = 287 bits (734),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 175/232 (75%), Gaps = 4/232 (2%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I ++ V P P     T +QKAAVKY PQL IEDGCHPY AVQ DG+IS GLKWSGPQD
Sbjct  21   KAIPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPQD  80

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS LGSQ+YARS WV   WAIMYAWYFP G+  VP P+ L   GHR+ WEYA++W+
Sbjct  81   GACKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVP-PVGL---GHRNGWEYAVIWL  136

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            D P  +NST+LGVS+SA+VG++ + P + +++DG+S+K+ YYYN++  +T+++ TE  GE
Sbjct  137  DRPTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFRNTAVKYTEEKGE  196

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQ LITWD+L   AR +L +TDWDET FN+A +KMP+KDGVF E L  A+PF
Sbjct  197  FQTLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  248

>PPTG_16851
Length=249

 Score = 286 bits (731),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 176/234 (75%), Gaps = 4/234 (2%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            + + I ++ V+PF +  P T +QKA +KYKPQLKIE+GCHPYPAVQKDGSIS GLKWSGP
Sbjct  20   QSKAIPYDSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGP  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             +  C GS LGSQ+YAR+ W+   WA+MYAWYFPKGR  +P P   R +GHRH WEYA+V
Sbjct  80   DNIGCKGSPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAP---RSYGHRHGWEYAVV  136

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D     NST+LG SMSA++G+A ++P    Y+DG+S+K+ YY+N    +T+++ T+  
Sbjct  137  WLDKAS-ANSTLLGTSMSAAIGWAKESPTPKEYLDGNSLKVAYYFNDDSINTAVKYTQDA  195

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GEFQDLI WD+L  +AR +L +TDWDET  N+A +KMP+KDGVF E LN A+PF
Sbjct  196  GEFQDLIIWDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  249

>PHYSO_261265
Length=247

 Score = 285 bits (728),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 188/253 (74%), Gaps = 7/253 (3%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN+RAVLIAVVAS AA   G VI +++V PF +P PVT   K  +KYKP LKI++GCHPY
Sbjct  1    MNFRAVLIAVVASFAAAQAGNVIPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPY  60

Query  92   PAVQKDGSISGGLKWSGPQD-GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVP  150
            PAVQK+G ISGGL+WS P D  EC GS LGSQ+YARS WV   +AIMYAWYFP GR    
Sbjct  61   PAVQKNGDISGGLEWSSPTDNAECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGRA---  117

Query  151  VPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKL  210
             PL+   FGHR+ WEYAIVW+D+    NSTILG S+SA+VG+A + P   +Y+DG+++K+
Sbjct  118  -PLLP--FGHRNGWEYAIVWLDSVSSTNSTILGTSLSAAVGWAKEVPRNRKYLDGNNLKV  174

Query  211  KYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKD  270
             YY+N  +  T+++ TE  GEFQD+ITWD+L    R SL++TDWD T FN+A LKMP+KD
Sbjct  175  AYYFNRDVRCTAVEYTEEIGEFQDVITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKD  234

Query  271  GVFDELLNKAWPF  283
            GVF E LN A+PF
Sbjct  235  GVFQEKLNSAYPF  247

>PHYCA_10034
Length=274

 Score = 285 bits (729),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 174/232 (75%), Gaps = 4/232 (2%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I ++ V P P     T +QKAAVKY PQL IEDGCHPY AVQ DG+IS GLKWSGP D
Sbjct  47   KAIPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPHD  106

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS LGSQ+YARS WV   WAIMYAWYFP G+  VP P+ L   GHR+ WEYA++W+
Sbjct  107  GACKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVP-PVGL---GHRNGWEYAVIWL  162

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            D P  +NST+LGVS+SA+VG++ + P + +++DG+S+K+ YYYN++  +T+++ TE  GE
Sbjct  163  DRPTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFHNTAVKYTEEKGE  222

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQ LITWD+L   AR +L +TDWDET FN+A +KMP+KDGVF E L  A+PF
Sbjct  223  FQTLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  274

>PHYKE_6286
Length=250

 Score = 280 bits (715),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 173/235 (74%), Gaps = 5/235 (2%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H+QV+PF +PEPV+ ++KAAVK+KPQL +  GC PYPAV  +GSIS GLKW+G 
Sbjct  20   EINTISHDQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKWAGK  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DG+CTGS LGSQ+Y+R+ W  D WAIMYAWYFPK R      L    +GHRH W++A+V
Sbjct  80   PDGDCTGSPLGSQVYSRADWYEDKWAIMYAWYFPKARQR----LSKYFYGHRHMWQWAVV  135

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLL-GSTSLQLTEA  228
            WID+P  +NST+ GVSMSASVGY  ++PP+++YVD  SVKL  Y +    G  SL+LTE 
Sbjct  136  WIDDPASDNSTVQGVSMSASVGYQKRSPPKSKYVDDSSVKLDSYVDFWWSGKASLRLTED  195

Query  229  TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            TGE QDLI WD+L+  AR SL+  D+DE+L+N   +KMPLKDGVF + L +++PF
Sbjct  196  TGETQDLIQWDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  250

>PHYSO_254108
Length=246

 Score = 268 bits (685),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 166/230 (72%), Gaps = 9/230 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+P  +P PVT +QK AVKYKPQL++  GCHPYPAVQ +GS+SGGL+WSGP DG+
Sbjct  26   INHDQVQPMAQPTPVTDAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPADGD  85

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+YARS W  D WA MY WYFPKGR  V        +GHRH WEYAI+W D+
Sbjct  86   CEGSSLGSQVYARSDWFKDKWATMYTWYFPKGRQDV--------WGHRHFWEYAIIWTDS  137

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P  +NST LG+SMSA VG+  QTP   +Y++G+SVKL+ +Y+ L    +LQLT+ +G+FQ
Sbjct  138  PSPDNSTFLGISMSAGVGHGKQTPVLLKYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQ  197

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITW +L   AR +LN   +D T F     +MPLKD VF  +LNKA+P+
Sbjct  198  DLITWGQLPVPARDALNGDAFDVTYF-FNKFEMPLKDRVFMSVLNKAYPW  246

>PHYCA_118548
Length=246

 Score = 267 bits (682),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 162/230 (70%), Gaps = 8/230 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H+QV+PF +PEP+T SQK+AVKYKPQL I  GCHPY AVQ DGS SGGL+WSG  DG+
Sbjct  25   VNHDQVQPFAQPEPITDSQKSAVKYKPQLHISYGCHPYAAVQADGSASGGLEWSGRVDGD  84

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS+LGSQ+Y+RS W +D WAIMYAWYFPKGR          L GHRH WEYAIVW D+
Sbjct  85   CTGSQLGSQVYSRSDWYHDKWAIMYAWYFPKGR--------YHLGGHRHYWEYAIVWTDS  136

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P   NS+I GVSMSA VGY   TPP  +Y+DG+S+K   +++ L    +LQLT+  GE Q
Sbjct  137  PTSSNSSIQGVSMSAGVGYGKATPPMLKYIDGNSIKFDSHFSLLGNKAALQLTKEAGERQ  196

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITWD+L+  AR +LN    D   +     ++P KD +F + L KA+PF
Sbjct  197  DLITWDQLTVAARDTLNGDALDGKAWFTDKDEVPFKDDIFVKRLQKAFPF  246

>PITG_19936
Length=249

 Score = 261 bits (668),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 165/232 (71%), Gaps = 6/232 (3%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            +I H+ V+PF +PEP   SQK+AVKYKPQL I  GCHPYPAVQ+DGSIS GLKW+G  +G
Sbjct  23   MIDHDAVQPFAQPEPTMESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKWAGWPNG  82

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
            +C GS LGSQ+Y+RS W    WAIMYAWYFPK R  V        FGHRH W YAIVW +
Sbjct  83   DCKGSALGSQVYSRSDWYKGKWAIMYAWYFPKSRQYVD----KYRFGHRHYWSYAIVWTN  138

Query  173  NPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            NP  +NSTILGVSMS+ VGY  ++PP+++Y VDG +VKL +Y++       LQLTE +GE
Sbjct  139  NPNPDNSTILGVSMSSGVGYMKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGE  198

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             QDLITW++LS+ AR +L+  D+D + +      MPLKD +F   L KA+PF
Sbjct  199  TQDLITWEQLSEEARNALSEADFDVS-WAFTKAVMPLKDDIFTSRLKKAYPF  249

>PPTG_07664
Length=245

 Score = 261 bits (667),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 161/230 (70%), Gaps = 8/230 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H++V+PF + +P+T SQK+AVKYKPQL I  GCHPYPAVQ +GS SGGL+WSGP DG+
Sbjct  24   VNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGLEWSGPVDGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR  +         GHRH WEYAIVW D+
Sbjct  84   CTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGRYGIT--------GHRHYWEYAIVWTDS  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
                NS+I GVSMSA VG+A  TPP  +YVDG S+KL  Y++ +    +LQLT+  GE Q
Sbjct  136  ATSTNSSIQGVSMSAGVGHAKATPPMLKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITWD+L+  AR +LN    D  ++     ++P KD +F + L  A+PF
Sbjct  196  DLITWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  245

>PPTG_17049
Length=255

 Score = 261 bits (667),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 166/234 (71%), Gaps = 9/234 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            +GH++V+PFP+PEP+T SQKAAVK+KPQL I  GCHPYPAVQ DG++SGGLK+SG  DG+
Sbjct  25   VGHDRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYSGKPDGD  84

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  DVWAI YAWY PKG        ++   GHRH W Y  VWI+N
Sbjct  85   CKGSALGSQVYSRSTWYRDVWAITYAWYLPKGYERFSGLSMVE--GHRHFWGYVTVWINN  142

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLL----GSTSLQLTEAT  229
            P +EN+ ILGVSMS  +G+ +Q P + + VDG ++KL+ +  H++    G   L+  EA 
Sbjct  143  PAVENAYILGVSMSGQLGHDTQAPVDKKCVDGSTLKLE-FDGHVMDGAKGKQGLRCVEAV  201

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G+FQDLITWD+L++ AR SLN  ++D    ++    +PLKDGVF  LLN  WPF
Sbjct  202  GKFQDLITWDQLTEAARDSLNTYNFDSIGRDMG--TVPLKDGVFTNLLNSTWPF  253

>PHYCA_9298
Length=248

 Score = 260 bits (665),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 176/253 (70%), Gaps = 6/253 (2%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN R   +A +ASLAAV   ++I H+QV+PF +PEP T S+K+AVKYKPQL I DGCHPY
Sbjct  1    MNLRVFFLAAIASLAAVNAVKMIDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPY  60

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAVQ DG++S GLKW+G   G+C GS LGSQ+Y+RS W  + WAIMYAWYFPKGR  +  
Sbjct  61   PAVQADGAVSAGLKWAGTASGQCKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYIS-  119

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKL  210
                  FGHRH W YAIVW+D+   +NSTILGVSMSA VGY+ +TPP+++Y VDG +VK 
Sbjct  120  ---KYRFGHRHFWSYAIVWMDSDVPDNSTILGVSMSAGVGYSKETPPKSKYVVDGTTVKF  176

Query  211  KYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKD  270
            K Y++      ++ LT   GE QDLI W++L+  AR  L   D+D   ++   + MP+ D
Sbjct  177  KSYHSFWGSKLAVGLTTKEGESQDLIAWEQLTDEARSGLTDADFD-VDWSFRKVVMPMTD  235

Query  271  GVFDELLNKAWPF  283
            GVF E L K +PF
Sbjct  236  GVFTEKLKKNYPF  248

>PHYRA_74356
Length=244

 Score = 258 bits (659),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 157/230 (68%), Gaps = 9/230 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GLK SGP DGE
Sbjct  24   IDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPADGE  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS LGSQ+Y+RS W  D WAIMYAWY PKG            +  RH WE A+VWID+
Sbjct  84   CTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKGN---------YKYQRRHYWETAVVWIDD  134

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P L NSTILGVSM+       +TP + R++DG SVKL  Y  +      LQ T+  GEFQ
Sbjct  135  PALSNSTILGVSMNYGRRSEFETPVQARFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQ  194

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITW++L++ AR +L+  D+D  LF     KMPLKDG+F+  L  AWPF
Sbjct  195  DLITWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  244

>PITG_22053
Length=245

 Score = 257 bits (656),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 158/230 (69%), Gaps = 8/230 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWTDT  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P   NS+I GVSMSA VG+A  TPP  +Y+ G S+KL  Y++ L    +LQLT+ TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITWD+++  ARY+LN    D  ++     ++P KD +F + L  A+PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  245

>PITG_04208
Length=245

 Score = 257 bits (656),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 158/230 (69%), Gaps = 8/230 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWTDT  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P   NS+I GVSMSA VG+A  TPP  +Y+ G S+KL  Y++ L    +LQLT+ TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITWD+++  ARY+LN    D  ++     ++P KD +F + L  A+PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  245

>PHYCA_118674
Length=281

 Score = 255 bits (652),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 145/281 (52%), Positives = 185/281 (66%), Gaps = 14/281 (5%)

Query  8    LYFAIVTTESSPLDGGEHQKNEGKMNYRavliavvas-laavvEGQVIGHNQVRPFPEPE  66
            LYF   T   S L     +     MN+RA  +AV+AS  A   +   I H+QV+PF +PE
Sbjct  10   LYFCPNTLRVSFLKIRRDRHLRSTMNFRAFFLAVIASLAAVNADVGKINHDQVQPFTQPE  69

Query  67   PVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYAR  126
            P T S+K+AVKYKPQL I DGCHPYPAVQ +GS+SGGLKW+G  DG+C  S LGSQIY+R
Sbjct  70   PTTDSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSDGDCKRSALGSQIYSR  129

Query  127  SKWVNDVWAIMYAWYFPKGRGAVPVPLILRLF--GHRHNWEYAIVWIDNPELENSTILGV  184
            S W ND WAIMYAWYFPKG            F  GHRH W YAIVW  +P  ENST+LGV
Sbjct  130  SDWHNDKWAIMYAWYFPKGNE------FQANFDSGHRHYWSYAIVWTGSPNPENSTVLGV  183

Query  185  SMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSK  243
            SMS+S GY  + PP+++YV DG +VK   Y +      +++LT+  GE QDLITW++L++
Sbjct  184  SMSSS-GYGKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEAQDLITWEQLTQ  242

Query  244  LARYSLNHTDWD-ETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             AR +L+  D+  E+ F  + + MPLKD VF  +L KA+PF
Sbjct  243  EARTALSEADFKAESTF--SKVVMPLKDDVFSSILKKAYPF  281

>PHYRA_74306
Length=245

 Score = 253 bits (645),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 155/230 (67%), Gaps = 8/230 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF EPEP+T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  24   IDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLRGSGPADGE  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR              RH WE A+VWID+
Sbjct  84   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRST--------RHQRRHFWETAVVWIDD  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P L NSTILGVSM+       QTP + +Y+DG SVKL+ Y  +      LQ T+  G+FQ
Sbjct  136  PALANSTILGVSMNYGWRSKEQTPVKVKYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITW++L++ AR +L+  D+D  L      +MPLKD +F+  L  AWPF
Sbjct  196  DLITWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  245

>PHYCA_132252
Length=249

 Score = 252 bits (643),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 161/233 (69%), Gaps = 6/233 (3%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+QV+PF +PEP T S+K+AVKYKPQL I DGCH YPAVQ DG++S GLKW+G   
Sbjct  22   KMIDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVS  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  82   GQCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYIS----KYRFGHRHFWSYAIVWM  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+   +NSTILGVSMSA VGY  +TPP+++Y VDG +VK   Y +   G  ++ LT   G
Sbjct  138  DSDVPDNSTILGVSMSAGVGYNKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEG  197

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E QDLITW++L+   R  L   D+D   +++  + MP+ D VF + L K +PF
Sbjct  198  ETQDLITWEQLTDEGRTGLTDADFD-VDWSIRKVVMPMADDVFVKKLKKNYPF  249

>PITG_19938
Length=245

 Score = 250 bits (639),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/228 (54%), Positives = 159/228 (70%), Gaps = 8/228 (4%)

Query  56   HNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  115
            H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+CT
Sbjct  26   HDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCT  85

Query  116  GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPE  175
            GS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D+  
Sbjct  86   GSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWADSST  137

Query  176  LENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDL  235
              +S+I GVSMSA VG+A  TPP  +Y+ G SVKL  Y++ L    +LQLT+ TGE QDL
Sbjct  138  STSSSIQGVSMSAGVGHAKATPPMLKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDL  197

Query  236  ITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            ITWD+++  AR +LN    D  ++     ++P KD +F + L  A+PF
Sbjct  198  ITWDQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  245

>PHYRA_52440
Length=243

 Score = 249 bits (635),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 159/228 (70%), Gaps = 8/228 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H+ V+PF +P PVT SQK+AVKYKPQL I  GCHPYPAV+ +G  SGGL+WSGP DG+
Sbjct  24   VNHDLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHPYPAVEANGYASGGLEWSGPNDGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W ++ WAIMYAWYFPKGR  V         GHR+ WEYAIVW D+
Sbjct  84   CKGSSLGSQVYSRSDWYHEKWAIMYAWYFPKGRYGVT--------GHRNYWEYAIVWTDS  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
               +NST+LGVSMSA VG+   TPP  +Y++G SVKL  +++ L    +L+LT+  GEFQ
Sbjct  136  TSPDNSTLLGVSMSAGVGHDKTTPPMLKYMNGSSVKLNSHFSLLGSKAALELTKKEGEFQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLITWD+L+  AR +LN    D  ++     ++P KD +F + L  A+
Sbjct  196  DLITWDQLTVAARETLNSDALDGNVWLSNKDEVPFKDDIFVDRLEDAY  243

>PHYSO_526623
Length=249

 Score = 246 bits (629),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 158/233 (68%), Gaps = 6/233 (3%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV+ +GS+S GLKW+G  D
Sbjct  22   KMINHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGLKWTGWAD  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W YAIVW 
Sbjct  82   GDCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYAS----QYRSGHRHFWSYAIVWT  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+ + +NSTI GVSMSA VGY   TPP+++Y VDG +VK   Y++       ++ T  TG
Sbjct  138  DSDKPDNSTIQGVSMSAGVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTTTKTG  197

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E QDLITW++L+  AR +L   D+D   ++   + MPL D VF E L KA+PF
Sbjct  198  ETQDLITWEQLTDEARTALTDADFD-VDWSYKKVVMPLLDDVFTEKLEKAYPF  249

>PHYSO_526774
Length=249

 Score = 246 bits (628),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 160/238 (67%), Gaps = 16/238 (7%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V+P  +PEP T S+K AVKYKPQL I  GCHPYPAVQ DGS+S GLKWSG  +
Sbjct  22   KMINHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWAN  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRL-----FGHRHNWEY  166
            G+C GS LGSQ+Y+RS W    WAIMYAWYFPKGR         R+      GH H W Y
Sbjct  82   GKCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGR---------RMGDGYNSGHHHYWSY  132

Query  167  AIVWIDNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQL  225
            AIVWIDNP  +NSTILGVSMSA VGY   +PP+++Y VDG +VK   Y +       ++L
Sbjct  133  AIVWIDNPNPDNSTILGVSMSAGVGYRKASPPKSKYVVDGVTVKFDSYRSFWGSKQGVRL  192

Query  226  TEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            T  +G+ QDLITW++L+  AR +L+  D+D   ++L  + MPLKD    E L KA+PF
Sbjct  193  TTKSGDQQDLITWEQLTDEARTALSDADFDVN-WSLKNVVMPLKDDALRERLEKAYPF  249

>PITG_04248
Length=245

 Score = 246 bits (627),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 157/234 (67%), Gaps = 8/234 (3%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H++V+PF +P+P T S+ AAVKYKPQL +  GC PYPAVQ DGS+S GLK SGP
Sbjct  20   EVTYINHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSGP  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DGEC GS LGSQ+Y+RS W  D WAIMYAWY PKGR           +  RH WE A+V
Sbjct  80   MDGECEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTK--------YQRRHFWEAAVV  131

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WID+P L NSTILGVS++    + S+ P E RY++G +VKL+ Y  +      L+ T+  
Sbjct  132  WIDDPALANSTILGVSLNYGRRHKSKAPLERRYLEGSNVKLESYKGYGKPRPRLRFTQLK  191

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE Q LITW++L+K AR +L++  ++  LF     +MPLKDGVF++ L  A+PF
Sbjct  192  GETQHLITWEQLTKEARDALSNAKFNTGLFKRTKREMPLKDGVFEKRLKDAYPF  245

>PPTG_07671
Length=246

 Score = 243 bits (620),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 154/234 (66%), Gaps = 8/234 (3%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H++V PF +P+P T S+KAAVKYKPQ  +  GCHPYPAVQ DGS+S GLK SGP
Sbjct  20   EVNYINHDEVEPFAQPKPTTDSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGP  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DGEC GS LGSQ+Y+RS W  D+WAIMYAWY PKGR           +  RH WE A+V
Sbjct  80   MDGECEGSPLGSQVYSRSGWYEDMWAIMYAWYLPKGRSTK--------YQRRHYWEVAVV  131

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WID+P L NSTILGVS++    + SQ P E +Y+ G  VKL+ +    +    L+ T+  
Sbjct  132  WIDDPALANSTILGVSLNYGRRHNSQVPVEEQYLHGSRVKLESFKGFGVPRPRLRFTDLE  191

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLITW++L++ AR +L++  +   L       MPLKDGVF++ L  A+PF
Sbjct  192  GETQDLITWEQLTEEARDALSNAKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  245

>PHYCA_118551
Length=245

 Score = 242 bits (618),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 154/234 (66%), Gaps = 8/234 (3%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H+ V+PFP+P+P T S+KAAVKYKPQL +  GCHPYPAVQ DGS+S GLK +GP
Sbjct  20   EVTYIDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGP  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
              GEC GS LGSQ+Y+RS W  D WAIMY+WY PKGR A         +  RH WE A+V
Sbjct  80   AAGECGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAK--------YQRRHLWETAVV  131

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WID+P L NSTILGVS++    + +  P E+ ++D   VKL+ Y         L+ T   
Sbjct  132  WIDDPSLANSTILGVSLNYGWRHKTMAPIESEFLDDSRVKLESYRGFSYPRPKLRFTTHV  191

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLITW++L+  AR +L++ ++D  L      +MPLKDGVF++ L  AWPF
Sbjct  192  GETQDLITWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  245

>PHYRA_74343
Length=249

 Score = 241 bits (614),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 156/233 (67%), Gaps = 6/233 (3%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV  +GS++ GLKW+G  D
Sbjct  22   EMIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWDD  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y IVW 
Sbjct  82   GDCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSAYRT----GHRHYWSYGIVWT  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+   +NSTILGVSMSA VG+   TPP+++Y VDG +VK   + +       ++LT   G
Sbjct  138  DSSSPDNSTILGVSMSAGVGFGKATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEG  197

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E QDLITW+++++ AR +L   D+D   +++  + MP+ D VF   L KA+PF
Sbjct  198  EMQDLITWEQMTEEARTALTDADFD-VDWSVRKVVMPMSDDVFMTKLKKAYPF  249

>PHYSO_526832
Length=249

 Score = 240 bits (612),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 154/233 (66%), Gaps = 10/233 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV PF + EPV  S KAA+K+KP+L+I  GCHPYPAVQ DG++S GLKW+G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKADGK  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG---RGAVPVPLILRLFGHRHNWEYAIVW  170
            C GS LGSQ+Y+RS W    +AIMYAWYFPKG   RG +        + HRH W Y ++W
Sbjct  84   CKGSGLGSQVYSRSAWFEGKFAIMYAWYFPKGFEQRGKIN-------YSHRHLWLYLVLW  136

Query  171  IDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            IDNPE EN  ILGV +  + G   +TPP+ +++DG S+K+ YY +   G T +QLTE  G
Sbjct  137  IDNPENENPAILGVWLRTAGGNERRTPPDAKFLDGSSLKVDYYKSSWHGKTGIQLTENPG  196

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            EFQDLITW+++++ AR +L   D+D        L +P  DG F   L KAW F
Sbjct  197  EFQDLITWEQMTEEARIALTEADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  249

>PHYSO_526071
Length=249

 Score = 239 bits (611),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 156/233 (67%), Gaps = 6/233 (3%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V+P  +PEP T S+K AVKYKPQL I  GCHPYPAVQ DGS+S GLKWSG  +
Sbjct  22   KMINHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWAN  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS LGSQ+Y+RS W    WAIMYAWYFPKGR  V         GHRH W YAIVW 
Sbjct  82   GKCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRQYVS----KYRKGHRHFWSYAIVWT  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+ + +NSTI GVSMSA VG+   TPP+++YV DG +VK   Y++       ++ T  TG
Sbjct  138  DSDKPDNSTIQGVSMSAGVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTTTKTG  197

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E QDLITW++L+  AR  L + D+D   ++   + MPL D  F + L KA+PF
Sbjct  198  ESQDLITWEQLTDEARTGLTNADFD-VDWSYRKVVMPLSDEDFTDKLKKAYPF  249

>PHYRA_74307
Length=249

 Score = 236 bits (603),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 159/233 (68%), Gaps = 6/233 (3%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV  +GS++ GLKW+G  D
Sbjct  22   EMIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWAD  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS LGSQ+Y+RS    D WAIMYAWYFPKGR  +         GHRH W Y IVW 
Sbjct  82   GDCKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGRQYIH----KYHSGHRHYWSYGIVWT  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+   +NSTILGVSMSA VGY   +PP++++V DG +VK   Y +       ++LT+ TG
Sbjct  138  DSSSPDNSTILGVSMSAGVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTG  197

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            + QDLITW+++++ AR +L  TD+D   ++L  + MPL D  F E L K++PF
Sbjct  198  DTQDLITWEQMTEEARTALVDTDFD-VEWSLKKVVMPLSDDAFTERLEKSYPF  249

>PITG_04200
Length=247

 Score = 236 bits (602),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 154/231 (67%), Gaps = 9/231 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +P P T S+KAAVKYKP+L +  GCHPYPAVQ +G +S GLK SGP DGE
Sbjct  24   INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPIDGE  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR +         +  RH WE A+VWID+
Sbjct  84   CEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSK--------YQRRHFWEAAVVWIDD  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P L NSTILGVS++      S+ P E +++DG +VKL+ Y         LQ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRQKSEVPLELQFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETL-FNLAGLKMPLKDGVFDELLNKAWPF  283
            DLITW++L+  AR  L+  +++  L F     +MPLKDGVF++ L  A+PF
Sbjct  196  DLITWEQLTDEARDGLSDAEFNTGLFFKRTRREMPLKDGVFEKRLIDAYPF  246

>PITG_04267
Length=279

 Score = 236 bits (602),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 158/233 (68%), Gaps = 8/233 (3%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PF + +P T S+K+A+KYKPQL I DGCHPYPAVQ +GSISGGLKWSG  +G
Sbjct  53   TINHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKANG  112

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRL-FGHRHNWEYAIVWI  171
            +C    LGSQ+Y+RS W    WAIMYAWYFPKG        +LR   GHRH W YAI+W 
Sbjct  113  DCKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKGPQ-----FVLRFDTGHRHFWSYAILWT  167

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+P  +NSTILGVSMS S GY  ++ P+ +Y V G +VKL  Y +  +G  +LQLT+  G
Sbjct  168  DDPNHDNSTILGVSMSGSRGYVKESSPKAKYIVKGTTVKLDSYASFWMGVQALQLTKKLG  227

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E QDLITW++L+  A  +L   D+ E+  + A + MPL D  F  +L  ++PF
Sbjct  228  ETQDLITWEQLTDEACDALTEFDF-ESDPSRAMVVMPLGDDNFTPILKDSYPF  279

>PHYRA_74310
Length=249

 Score = 234 bits (598),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 154/232 (66%), Gaps = 6/232 (3%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            +I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV  +GS++ GLKW+G  DG
Sbjct  23   MIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWADG  82

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
            +C GS +GSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y IVW D
Sbjct  83   DCKGSAMGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTS----KYRAGHRHYWSYGIVWTD  138

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            +   +NSTILGVSMSA VG+   TPP+++YV DG +VK   +++       ++LT   G 
Sbjct  139  SSSPDNSTILGVSMSAGVGFGKATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGA  198

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             Q LITW+++++ AR +L   D+D   ++   + MP+ D VF + L KA+PF
Sbjct  199  TQALITWEQMTEEARTALTDADFD-VDWSFRKVVMPMSDDVFTKKLKKAYPF  249

>PHYCA_122048
Length=236

 Score = 232 bits (592),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 148/234 (63%), Gaps = 15/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +   I HNQV PF +PE  T SQKAA+K+KPQ+ I +GCHPYPAV + G  SGGLK SG 
Sbjct  18   QAGTIDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLKTSGA  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y RS W N  WAIMY+WYFPK   +  +       GHRH+WE+ +V
Sbjct  78   PSSSCKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP++ N TIL  S SA  GY+   PP +  VDG SVK+ Y  N  + + +L +T  +
Sbjct  131  WIDNPDVANPTILATSPSAHSGYSFYAPPSSDSVDGTSVKVNYESNWPI-NHALDMTSKS  189

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLI WD+LS+ ARY+LN TD+ +         +P+ DG F   L KAWPF
Sbjct  190  GETQDLIMWDQLSEAARYALNTTDFGKA-------NVPMNDGNFVAKLGKAWPF  236

>PPTG_19331
Length=368

 Score = 236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 148/230 (64%), Gaps = 15/230 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PFP+PEPVT S+KAAVK+KPQ+ I +GCHPYPAV + G  SGGLK  G    +
Sbjct  152  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAK  211

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS WV  +WAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  212  CKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPS-------SGLGHRHDWEHVIVWIDN  264

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++EN  IL V+ SA  GY+ Q PP    VDG SVK+K Y +H   + +L+ T   G+FQ
Sbjct  265  PDVENPKILAVTPSAHDGYSKQVPPNADCVDGTSVKVK-YESHWPINHALESTSEGGDFQ  323

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI WD+LS+ AR ++N   W +          P  DG F   L KAWPF
Sbjct  324  DLIMWDQLSEDARRAMNGVGWGKA-------NTPFNDGNFKPKLEKAWPF  366

>PHYCA_107869
Length=342

 Score = 234 bits (598),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 149/238 (63%), Gaps = 23/238 (10%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E + I H+QV+PF +PEPVT S+KAAVKYKPQ+ I +GCHPYPAV + G  SGGLK  G 
Sbjct  124  EAKWIDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLKTKGA  183

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +          GHRH+WE+ IV
Sbjct  184  PSAGCKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPS-------SGLGHRHDWEHVIV  236

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQL  225
            WIDNP++EN  IL V+ SA  GY+ Q PP+   VDG SVK+KY      NH L STS   
Sbjct  237  WIDNPDIENPKILAVTPSAHSGYSKQVPPKADCVDGTSVKVKYESKWPVNHALDSTS---  293

Query  226  TEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
                G+FQDLI WD+LS+ AR ++N   W +          P  DG F   L+KAWPF
Sbjct  294  --EGGDFQDLIMWDQLSENARRAMNGVGWGKA-------NTPFNDGNFLPKLDKAWPF  342

>PHYRA_72386
Length=245

 Score = 229 bits (583),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 146/231 (63%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QVRPF +PEPVT S++AA+K+KPQL + DGCHPYPAV   G + GGLK +G    
Sbjct  30   TISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTA  89

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQIY RS W  D+WAIMY+WYFPK   +  +       GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWID  142

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++ N  IL VS SA  GY+   PP    +DG S K++Y  ++ + + +L  T   GEF
Sbjct  143  NPDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEF  201

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI W+++S LAR +LN         N     +P+ DG F   L+KAWPF
Sbjct  202  QDLIMWEQMSDLARQALN-------TMNFGDANVPMNDGNFVGKLDKAWPF  245

>PHYRA_72344
Length=245

 Score = 229 bits (583),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 146/231 (63%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QVRPF +PEPVT S++AA+K+KPQL + DGCHPYPAV   G + GGLK +G    
Sbjct  30   TISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTA  89

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQIY RS W  D+WAIMY+WYFPK   +  +       GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWID  142

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++ N  IL VS SA  GY+   PP    +DG S K++Y  ++ + + +L  T   GEF
Sbjct  143  NPDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEF  201

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI W+++S LAR +LN         N     +P+ DG F   L+KAWPF
Sbjct  202  QDLIMWEQMSDLARQALN-------TMNFGDANVPMNDGNFVGKLDKAWPF  245

>PPTG_17245
Length=257

 Score = 229 bits (583),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 161/239 (67%), Gaps = 11/239 (5%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I H+QV+PF E EP T S+K+A+KYKPQL I  GC+PYPAVQ +G+ISGGLKWSG  +
Sbjct  22   RTINHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWAN  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
             +C     GSQIY+RS W    WAIMYAWYFPK  GA       R  GHRH W  AIVW 
Sbjct  82   SDCEKPVQGSQIYSRSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWT  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVD-GDSVKLKYYYNHLLGSTSLQLTEATG  230
            DN   +NSTILGVSMS S GY  +  P+T+Y++ G ++KL  Y    L + +L+LT+ +G
Sbjct  138  DNTNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSG  197

Query  231  EFQDLITWDELSKLARYSLNHTDWD----ETLFNLAG--LKMPLKDGVFDELLNKAWPF  283
              QDL+TW++L+  AR +L+  D+D    + +F  +G  + MPL+DGVF  +L +++PF
Sbjct  198  GTQDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  256

>PHYSO_329843
Length=239

 Score = 228 bits (580),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 147/234 (63%), Gaps = 15/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            + ++I H+QV PF +PE VT SQKAAVK+KPQ+ I +GCHPYPA  + G  SGGLK +G 
Sbjct  21   QAEIIDHDQVVPFAQPEAVTISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGA  80

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y RS W +  WAIMY+WYFPK   +  +       GHRH+WE+ +V
Sbjct  81   PSSSCKGSGWGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVV  133

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP++EN TIL  S SA  GY+   PP    +DG SVK+  Y +H   + +L +T  +
Sbjct  134  WIDNPDVENPTILSTSPSAHSGYSYYVPPSADSIDGTSVKVN-YESHWPINHALDMTSES  192

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GEFQDLI WD+LS  AR +LN T       +     +P+ DG F   L KAWPF
Sbjct  193  GEFQDLIMWDQLSDAARLALNTT-------SFGSANVPMNDGNFLTKLGKAWPF  239

>PHYRA_76249
Length=326

 Score = 229 bits (585),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 144/234 (62%), Gaps = 23/234 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PF +PEP+T S+KA VK+KPQ+ + +GCHPYPAV + G   GGLK  G     
Sbjct  112  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLKTKGAPSAG  171

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  172  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  224

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEAT  229
            P++EN  IL V+ SA  GY+ Q PP    VDG SVK++Y      NH L STS       
Sbjct  225  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSVKVEYKSKWPINHALESTS-----QG  279

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G+FQDLI WD+LS+ AR +LN   W +          P+ DG F   L KAWPF
Sbjct  280  GDFQDLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFQNKLGKAWPF  326

>PHYCA_123779
Length=277

 Score = 228 bits (580),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 147/232 (63%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V PF +PEPVT S KAA+K+KPQL I +GCHPYPAV   G  SGGLK SG   
Sbjct  57   KIIDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPS  116

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +  +       GHRH+WE+ IVWI
Sbjct  117  AGCKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVIVWI  169

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNPE+    ILGV+ SA  GY+SQ PP+   VDG SVK+KY     + + +L+ T   G+
Sbjct  170  DNPEVPEPKILGVTPSAHSGYSSQVPPDADKVDGSSVKVKYLSKWPI-NHALESTGEGGD  228

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI W +++  AR  L+ T W +         +P+ DG F+  L KAWPF
Sbjct  229  FQDLIMWTQMTDAAREGLSKTGWGKA-------NVPMVDGNFEAKLGKAWPF  273

>PHYCA_129784
Length=246

 Score = 226 bits (577),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 144/231 (62%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PFP+P+PVT S++AA+K+KPQL + DGCHPYPAV   G   GGLK +G    
Sbjct  31   TIDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSPTA  90

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWI 
Sbjct  91   GCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIS  143

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++ N TIL V+ SA  GY+   PP    VDG S+K++Y   + +   +   TEA GEF
Sbjct  144  NPDVPNPTILAVTPSAHSGYSKYAPPSADTVDGTSIKVRYESTYPMNHATDVTTEA-GEF  202

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+++  AR +LN         +     +P+ DG F   L+KAWPF
Sbjct  203  QDLIMWDQMTDAARNALN-------TVSFGDANVPMNDGNFVPKLDKAWPF  246

>PHYSO_249692
Length=248

 Score = 226 bits (577),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 147/231 (64%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QVRPF +PEPVT S++AAVK+KPQL + +GCHPYPAV   G  SGGLK SG    
Sbjct  33   TISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAPSA  92

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWI+
Sbjct  93   GCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIN  145

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++ +  IL V+ SA  GY+  +PP    +DG S+K+ Y  N+ +   +   TE  G+F
Sbjct  146  NPDVPDPIILAVTPSAHSGYSKYSPPNADTLDGTSIKVNYESNYPMNHATDVTTEG-GDF  204

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD++S LAR +LN     E  F  A   +P+ DG F   L++AWPF
Sbjct  205  QDLIMWDQMSDLARRALN-----EVSFGDA--NVPMNDGNFVGKLDRAWPF  248

>PHYSO_507736
Length=236

 Score = 225 bits (573),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 145/232 (63%), Gaps = 15/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
               VI H+QV PF +P P + SQ AAVK+KPQL I +GCHPYPAV  DG+ SGGL  +G 
Sbjct  18   HASVIDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYPAVDADGNTSGGLNPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +V
Sbjct  78   SSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W++NP + +  +L VS SA  GY +  PP + Y+DG+S K+  YYN LL + + ++T  +
Sbjct  131  WLNNPAVTSPELLAVSTSAHSGYTTYYPPSSSYLDGNSAKID-YYNVLLINHAFRMTSDS  189

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L +TD+ +         +P KD  F+  L  AW
Sbjct  190  GETQDLIMWDQLTDAARTALENTDFGDA-------NVPFKDANFETKLANAW  234

>PHYKE_2376
Length=322

 Score = 228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 145/235 (62%), Gaps = 23/235 (10%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PF +PEPVT S+KA VK+KPQ+ I +GCHPYPAV + G  SGGLK  G    
Sbjct  107  TIDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSA  166

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W NDVWAIMY+WYFPK   +          GHRH+WE+ I+WID
Sbjct  167  GCKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWID  219

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEA  228
            NP++EN  IL V+ SA  GY++  PP    +DG S K+ Y      NH L STS      
Sbjct  220  NPDVENPRILAVTPSAHSGYSTYRPPNADTLDGTSAKVNYESHWPVNHALDSTS-----E  274

Query  229  TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             G+FQDLI WD+++  AR +LN   W +         +P+ DG F   L+KAWPF
Sbjct  275  GGDFQDLIMWDQMTDNARRALNEVSWGDA-------NVPMNDGNFGPKLDKAWPF  322

>PPTG_15224
Length=246

 Score = 225 bits (574),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/230 (50%), Positives = 148/230 (64%), Gaps = 8/230 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PF E +P T S+KAAVKYKP++ +  GCHPYPAVQ DGS+S GLK +GP DGE
Sbjct  24   INHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLKGTGPIDGE  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W    WAIMYAWY PKG  A   P        RH WE A+VWID+
Sbjct  84   CGGSDLGSQVYSRSSWYKGKWAIMYAWYLPKG-WAYRSP-------RRHFWETAVVWIDD  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P   NS+ILGV++++ +      P E +YVDG SV+L+           L+ T  +GE Q
Sbjct  136  PSPTNSSILGVTLNSGLRRKKYVPVERQYVDGSSVQLESCKGRGRPRPMLRFTTISGESQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI W++L+  ARY+L + ++D   F      MPLKD  F++ L  AWPF
Sbjct  196  DLIMWEQLTDKARYALANAEFDTGFFKKKRRNMPLKDDRFEKGLEDAWPF  245

>PPTG_06973
Length=165

 Score = 222 bits (565),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 3/166 (2%)

Query  118  KLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELE  177
            +L SQ+YAR+ WV D WAIMYAW+FPK R   PV   LR  GHRH WEYAIVW+D P  +
Sbjct  3    RLDSQVYARTTWVKDKWAIMYAWFFPKARAPFPV---LRFLGHRHGWEYAIVWLDKPNAD  59

Query  178  NSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLIT  237
            NSTILGVS+SA+ G+A + PP  +Y+DG+S+K+ YYYNH+ G+T+++ T+ TGEFQDLIT
Sbjct  60   NSTILGVSVSAAAGWAKEAPPPEKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLIT  119

Query  238  WDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            W++LS LAR  LN+TDWDET  N A LKMP+KDGVF + L  A+PF
Sbjct  120  WNQLSDLARSYLNNTDWDETPLNAALLKMPMKDGVFMKKLKSAYPF  165

>PHYRA_71477
Length=238

 Score = 224 bits (570),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V PFP+PEPVT S+KAAV++KP++ I +GCHPYPAV + G  SGGL+ +G    +
Sbjct  24   IGHDEVVPFPQPEPVTISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATGGPSSK  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W + VWAIMY WYFPK   +       RL GHRH+WE+ +VWIDN
Sbjct  84   CKGSGWGSQMYGRSTWYSGVWAIMYTWYFPKDSPST------RL-GHRHDWEHVVVWIDN  136

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++ N  +L VS SA  GY+   PP    VDG SVK+  Y +H   + +L  T  +GEFQ
Sbjct  137  PDVSNPILLAVSPSAHSGYSKYVPPSADSVDGTSVKIN-YESHWPVNHALDTTSKSGEFQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI W ++S  AR +LN TD+ + +       MP+ DG F   L  AWP+
Sbjct  196  DLIMWHQMSDAARLALNTTDFGKAI-------MPMNDGSFLGKLAGAWPW  238

>PHYRA_71404
Length=245

 Score = 223 bits (569),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 141/231 (61%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PFP+P+PVT S+KA VK+KPQL I +GCH YPAV   G  SGGLK +G    
Sbjct  30   TIDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSA  89

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  +       GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTGI-------GHRHDWEHVIVWID  142

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++EN  IL V+ SA  GY    PP    +DG + K+  Y +H     +L  +   G+F
Sbjct  143  NPDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDF  201

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+LS+ AR +LN         N     +P+ DG F   L +AWPF
Sbjct  202  QDLIMWDQLSENARRALNSV-------NFGNANVPMNDGNFQAKLGRAWPF  245

>PHYRA_52423
Length=193

 Score = 221 bits (564),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 137/201 (68%), Gaps = 8/201 (4%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR           +  RH WE A+VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRPTK--------YQRRHFWETAVVWIDD  112

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P L NSTILGVS++       +TP   R++DG SVKL  Y  +      LQ T+  GEFQ
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQ  172

Query  234  DLITWDELSKLARYSLNHTDW  254
            DLITW++L++ AR +L+  D+
Sbjct  173  DLITWEQLTEEARDALSTADF  193

>PHYRA_72433
Length=245

 Score = 223 bits (568),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 141/231 (61%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PFP+P+PVT S+KA VK+KPQL I +GCH YPAV   G  SGGLK +G    
Sbjct  30   TIDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSA  89

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +  +       GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPSTGI-------GHRHDWEHVIVWID  142

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++EN  IL V+ SA  GY    PP    +DG + K+  Y +H     +L  +   G+F
Sbjct  143  NPDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDF  201

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+LS+ AR +LN         N     +P+ DG F   L +AWPF
Sbjct  202  QDLIMWDQLSENARRALNSV-------NFGNANVPMNDGNFQAKLGRAWPF  245

>PPTG_07660
Length=216

 Score = 221 bits (563),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 153/220 (70%), Gaps = 8/220 (4%)

Query  66   EPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYA  125
            EP T S+K+A+KYKPQL I  GCHPYPAVQ +GSISGGLKWSG  +G+C    LGSQ+Y+
Sbjct  2    EPTTDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSGKTNGDCEQPNLGSQVYS  61

Query  126  RSKWVNDVWAIMYAWYFPKGRGAVPVPLILRL-FGHRHNWEYAIVWIDNPELENSTILGV  184
            RS W    WAIMYAWY PK         +L+   GHRH W Y++VW D+P  +NSTILGV
Sbjct  62   RSDWYKGKWAIMYAWYLPKA-----AQFMLKFDTGHRHFWLYSMVWTDSPNPDNSTILGV  116

Query  185  SMSASVGYASQTPPETRYVD-GDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSK  243
            SMS S GY  +  P+T+Y++ G ++KL+ Y    +G  +L+LT+ +GE QDL+TW++L+ 
Sbjct  117  SMSGSRGYVKKPSPKTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTD  176

Query  244  LARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             AR +L+  D+ E+  +++ + MPLKD VF  +L  ++PF
Sbjct  177  EARDALSEFDF-ESDPSISMVVMPLKDDVFRSILKDSYPF  215

>PHYKE_4438
Length=339

 Score = 225 bits (573),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 146/234 (62%), Gaps = 23/234 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PFP+PEP+T S++AAVK+KPQL I +GCH YPAV   G  SGGLK +G   G+
Sbjct  124  ISHSEVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLKTTGAPSGK  183

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ I+WI+N
Sbjct  184  CKGSGYGSQVYGRSGWHKDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWINN  236

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEAT  229
            PE+ +  IL V+ SA  GY++  PP    +DG + K+ Y      NH LG     +T   
Sbjct  237  PEVADPKILAVTPSAHSGYSTYAPPPADSMDGVAAKVNYESFWPVNHALG-----MTTKG  291

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G+FQDLI WD+L+  AR +LN  +W           +P+ DG F   L+KAWPF
Sbjct  292  GDFQDLIMWDQLTDNARRALNEVNW-------GAANVPMNDGNFGGKLDKAWPF  338

>PHYRA_72438
Length=236

 Score = 220 bits (560),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 143/231 (62%), Gaps = 15/231 (6%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G VI H+ V PF +P P + SQ AAV +KPQL I +GCHPYPAV  DG+ SGGL  +G  
Sbjct  19   GAVIDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSS  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
               C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +VW
Sbjct  79   SAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVW  131

Query  171  IDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            ++NP + +  IL VS SA  GY    PP++ Y+DG+S K+  YY+ LL + + ++T  TG
Sbjct  132  LNNPAVSSPEILAVSTSAHSGYTFYYPPDSDYLDGNSAKID-YYSVLLINHAFRMTSDTG  190

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            E QDLI WD+L+  AR +L  TD+ +         +P KD  F+  L  AW
Sbjct  191  ETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDTNFETKLANAW  234

>PPTG_15233
Length=235

 Score = 219 bits (558),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 142/232 (61%), Gaps = 15/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P P + SQ AA  +KPQL I +GCHPYPAV  DG+ SGGL  +G 
Sbjct  17   QAAVIDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTGS  76

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +V
Sbjct  77   SSAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVV  129

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W++NP + +  IL VS SA  GY    PP + Y+DG+S K+  YY+ LL + S ++T  +
Sbjct  130  WLNNPAVTSPEILAVSTSAHSGYTVYYPPSSDYLDGNSAKID-YYSVLLINHSFRMTSDS  188

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L  TD+ +         +P KD  F+  L  AW
Sbjct  189  GETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDANFETKLANAW  233

>PHYCA_108039
Length=215

 Score = 218 bits (556),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 144/234 (62%), Gaps = 23/234 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H+QV+PF +P+PVT S+KAAVK+KPQ+ I +GCHPYPAV   G  SGGLK  G     
Sbjct  1    MDHDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLKTKGAPSAG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  61   CKGSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEAT  229
            P++EN  IL V+ SA  GY+ Q PP    VDG SVK+KY      NH L ST    TE  
Sbjct  114  PDIENPKILAVTPSAHSGYSKQVPPSADCVDGTSVKVKYESKWPINHALEST----TEG-  168

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLI W++LS+ A  ++N   W +          P  DG F   L+KAWPF
Sbjct  169  GETQDLIMWNQLSENALRAMNSVTWGDA-------NCPFCDGNFQAKLDKAWPF  215

>PPTG_17409
Length=235

 Score = 219 bits (558),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 142/230 (62%), Gaps = 15/230 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PF +PEPVT S+KAAVK+KPQL I +GCHPYPAV   G   GGLK +G   G 
Sbjct  21   IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGAPSGS  80

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE  ++WI+N
Sbjct  81   CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPS-------SSLGHRHDWENVVIWINN  133

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++ N  IL +  SA  GY+   PP+   +DG S K+  Y +H   + +   T   G+FQ
Sbjct  134  PDVPNPVILAICPSAHGGYSRYAPPDADTIDGTSAKVN-YESHWPINHATDTTSEGGDFQ  192

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI WD+L+  AR +L  TD+ +         +P+K+G F   L KAWPF
Sbjct  193  DLIMWDQLTDAARTALQDTDFGDA-------NVPMKEGSFLSNLEKAWPF  235

>PPTG_15230
Length=252

 Score = 219 bits (558),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 142/231 (61%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             IGH+QV+PF +P+PVT S++AA+K+KPQ+ I DGCHPYPAV   G   GGLK +G    
Sbjct  37   TIGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSPTA  96

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWI+
Sbjct  97   GCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIN  149

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++ +  IL V+ SA  GY+   PP    +DG SVK+ Y   + +   +  +T   GEF
Sbjct  150  NPDVPDPIILAVTPSAHSGYSKYAPPNADTLDGTSVKVNYESTYPMNHAT-DVTTDPGEF  208

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+++  AR +LN         +     +P+ DG F   L+KAWPF
Sbjct  209  QDLIMWDQMTDAARLALN-------TVSFGDANVPMNDGNFIPKLDKAWPF  252

>PHYRA_71308
Length=236

 Score = 218 bits (556),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 142/231 (61%), Gaps = 15/231 (6%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G VI H+ V PF +P P + SQ AAV +KPQL I +GCHPYPAV  DG+ SGGL  +G  
Sbjct  19   GAVIDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSS  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
               C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +VW
Sbjct  79   SAGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVW  131

Query  171  IDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            ++NP + +  IL VS SA  GY    PP+  Y+DG+S K+  YY+ LL + + ++T  TG
Sbjct  132  LNNPAVSSPEILAVSTSAHSGYTFYYPPDLDYLDGNSAKID-YYSVLLINHAFRMTSDTG  190

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            E QDLI WD+L+  AR +L  TD+ +         +P KD  F+  L  AW
Sbjct  191  ETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDTNFETKLANAW  234

>PHYCA_9358
Length=252

 Score = 218 bits (556),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 149/240 (62%), Gaps = 29/240 (12%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V PF +PEPVT ++KAA+K+KPQL I +GCH YPAV   G  SGGLK +G     
Sbjct  31   IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAG  90

Query  114  CTGSKLGSQIYARSKW------VNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYA  167
            C GS  GSQ+Y RS W       N +WAIMY+WYFPK   +          GHRH+WE+ 
Sbjct  91   CKGSGWGSQVYGRSTWHNVPSPHNGIWAIMYSWYFPKDSPST-------GLGHRHDWEHV  143

Query  168  IVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSL  223
            IVWIDNPE+    IL V+ SA  GY++Q PP+   V+G SVK+ Y      NH LGST+ 
Sbjct  144  IVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDADKVEGTSVKVNYESKWPINHALGSTT-  202

Query  224  QLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
                  G++QDLI W++L+  AR +L +TD+ +         +P+KDG F   LNKAWPF
Sbjct  203  ----KGGDYQDLIMWEQLTDAARLALENTDFGKA-------NVPMKDGNFVGKLNKAWPF  251

>PHYRA_42876
Length=213

 Score = 217 bits (552),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 141/232 (61%), Gaps = 23/232 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PF +PEP+T S+K+ VK+KPQ+ + +GCHPYPAV   G   GGLK  G     
Sbjct  1    IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLKTKGAPSAG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y R+ W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  61   CKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEAT  229
            P++EN  IL V+ SA  GY+ Q PP    VDG S K++Y      NH L STS       
Sbjct  114  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSAKVEYKSKWPINHALESTS-----QG  168

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            G+FQDLI WD+LS+ AR +LN   W +          P+ DG F   L+KAW
Sbjct  169  GDFQDLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFLPKLDKAW  213

>PHYKE_5753
Length=238

 Score = 218 bits (554),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 145/234 (62%), Gaps = 14/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +    + +   A+K+KPQ+ I +GCHPYPAV  +G  SGGLK SG 
Sbjct  18   QADVISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            +   C GS  GSQ+Y RS W N+VWAIMY+WYFPK     PV       GHRH+WE+ +V
Sbjct  78   ESAGCKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDN---PV----TGMGHRHDWEHVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP +EN TIL V+ SA  GY++  PP+   VDG S K++Y  + ++ +  L  T   
Sbjct  131  WIDNPAMENPTILAVTPSAHSGYSTYAPPDPSTVDGASAKVQYTSSWIVINHHLDTTSTA  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GEFQDLI W +L+  AR +LN  D++          +P+KDG F+  L  A+P+
Sbjct  191  GEFQDLIMWGDLTDAARNALNTADFEAA-------NVPMKDGNFESKLGNAYPW  237

>PHYSO_527352
Length=245

 Score = 218 bits (554),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 151/235 (64%), Gaps = 13/235 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWS--  107
            E ++IGH+QV+PF +PEP T S+K+AVKYKPQL I  GCHPYPAVQ DGS++GGLKW+  
Sbjct  20   EVKMIGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHPYPAVQADGSVNGGLKWTFW  79

Query  108  GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLF--GHRHNWE  165
               D +C GS LGSQ+Y+RS W    WAI+YAWYFPKGR           F  GHRH W 
Sbjct  80   SWADSDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGRD------FEHSFKRGHRHYWL  133

Query  166  YAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQL  225
            YAI+W D+P  + STILGVS+       S  P     +DG ++K   Y +   G   L L
Sbjct  134  YAILWTDSPNPDTSTILGVSVPNGFRDKSAAPDAQFVIDGKTIKFDSYRSFTTGRQDLGL  193

Query  226  TEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            TE TG+ QDLITW++L++ AR +L++ ++D     +    +P+KDG F E L +A
Sbjct  194  TEKTGDTQDLITWEQLTEEARTALSNMNFDGPRQKIV---VPMKDGDFAERLARA  245

>PPTG_08017
Length=616

 Score = 228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 148/234 (63%), Gaps = 23/234 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V PF +PEPVT ++KAA+K+KPQL I +GCH YPAV   G  SGGLK +G     
Sbjct  400  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAG  459

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  460  CKGSGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWIDN  512

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEAT  229
            PE+    IL V+ SA  GY++Q PP+   VDG+SVK+KY      NH L ST        
Sbjct  513  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGNSVKVKYLSKWPINHALESTG-----EA  567

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G++QDLI W++L+  AR +L +T + +         +P+KDG F   L+KAWPF
Sbjct  568  GDYQDLIMWEQLTDAARLALQNTGFGKA-------NVPMKDGNFVSKLDKAWPF  614

>PYVX_22467
Length=236

 Score = 216 bits (551),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
             VI H+QV PF +P   + S KAAVK+KPQL I DGCHPYPAV   G+ SGGLK SG   
Sbjct  20   SVIDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYPAVDSSGNTSGGLKPSGSSS  79

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C GS  GSQIY RS W N VWAIMY+WYFPK   +  +       GHRH+WE+ +VWI
Sbjct  80   AGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVVWI  132

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
             NP +++ T+  VS SA  GY+   PP + Y+DG+S K+  Y+  ++ + + ++T + GE
Sbjct  133  SNPAVDSPTVYAVSTSAHSGYSIYYPPSSSYMDGNSAKID-YFKIVVINHAFRMTSSAGE  191

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             QDLI WD+++  AR +L +TD+ +         +P KDG F   L  AW
Sbjct  192  TQDLIMWDQMTDAARIALENTDFGDA-------NVPFKDGNFMTKLASAW  234

>PHYCA_118356
Length=252

 Score = 217 bits (552),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 146/234 (62%), Gaps = 9/234 (4%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G ++ H++V+PF +P P    ++AAVKYKP+L +  GCHPYPAVQ +GS+S GL+ SGP 
Sbjct  21   GTLMDHDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPD  80

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            DGEC GS+LGSQ+Y+RS W ND WAIMY WY PKGR              RH WE A++W
Sbjct  81   DGECKGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGK--------LQDRHFWETAVIW  132

Query  171  IDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSV-KLKYYYNHLLGSTSLQLTEAT  229
            ID+P LE+S +LGVS++      S+   + R+++   V K + Y         L+ TE  
Sbjct  133  IDDPTLEDSKLLGVSLNYEDRRVSKIAIKGRHLNASKVLKFESYEAEKSPKPRLRFTEKA  192

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G+ QDLITWD+L   AR  L+ T +  + F     +MPLKD VF + L  AWPF
Sbjct  193  GKTQDLITWDQLPAKARKGLSTTKFYSSPFGSVKREMPLKDEVFLKRLKDAWPF  246

>PHYSO_406265
Length=232

 Score = 216 bits (549),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 146/236 (62%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH++V PF +PEPVT S++AAVK+KPQL I +GCH YPAV + G  SGGLK +G   
Sbjct  16   KTIGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGAPS  75

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
             +C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  76   SKCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPS-------SGLGHRHDWEHVIVWI  128

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTE  227
            DNP++    IL V+ SA  GY++Q PP+   VDG SVK+ Y      NH L ST+     
Sbjct  129  DNPDMPEPKILAVTPSAHSGYSAQVPPDADKVDGPSVKVNYESKWPINHALESTT-----  183

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              G++QDLI W +++  AR +L++T       N     +P+  G F   L KAWPF
Sbjct  184  KGGDYQDLIMWTQMTDAARQALDNT-------NFGSANVPMNSGNFLGKLGKAWPF  232

>PHYCA_11951
Length=234

 Score = 216 bits (549),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 140/227 (62%), Gaps = 15/227 (7%)

Query  55   GHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGEC  114
            GH+QV PF +P P + SQ  AV +KPQL I +GCHPYPAV  DG+ SGGL  +G     C
Sbjct  21   GHDQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAGC  80

Query  115  TGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNP  174
             GS  GSQIY RS W N VWAIMY+WYFPK   +         FGHRH+WE+ +VW+DNP
Sbjct  81   KGSGYGSQIYGRSAWYNGVWAIMYSWYFPKDSPS-------SGFGHRHDWEHIVVWLDNP  133

Query  175  ELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQD  234
             + +  IL VS SA  GY    PP + Y++G S K+  YY+ LL + + ++T   GE Q+
Sbjct  134  AVASPKILAVSTSAHSGYTVYYPPNSNYLNGKSAKID-YYSILLINHAFRMTSDAGETQN  192

Query  235  LITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            LI WD+++  AR +L +TD+ +         +P KDG F+  L  AW
Sbjct  193  LIMWDQMTDAARTALQNTDFGDA-------NVPFKDGNFESKLANAW  232

>PPTG_19330
Length=316

 Score = 216 bits (551),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 138/235 (59%), Gaps = 23/235 (10%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PFP+P+PVT S+KAAVK+KPQL I +GCH YPAV + G  SGGLK  G    
Sbjct  101  TIDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLKTKGAPSA  160

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W   VWAIMY WYFPK   +  +       GHRH+WE+ IVWID
Sbjct  161  GCKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPSTGI-------GHRHDWEHVIVWID  213

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTEA  228
            NPE+ N  IL V+ SA  GY    PP    +DG + K+ Y      +H LGSTS      
Sbjct  214  NPEIANPKILAVTPSAHSGYHKYAPPNPDTIDGATTKVAYESHWPMDHALGSTS-----E  268

Query  229  TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             G+FQDLI W +LS+ A  +LN   W            P+ DG F   L KAWPF
Sbjct  269  AGDFQDLIMWGQLSENASRALNAVYW-------GNANTPMNDGNFLPKLAKAWPF  316

>PHYSO_254112
Length=224

 Score = 213 bits (543),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 142/228 (62%), Gaps = 28/228 (12%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PF +PEP T S+ AAVK+KP L++  GC PYPAV  +GS+S  LKW+G  DG+
Sbjct  24   INHDQVQPFAQPEPATDSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKNDGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG-RGAVPVPLILRLFGHRHNWEYAIVWID  172
            C GS LGSQ+Y+RS W  D WA+MYAWYFPKG +GA  V        HRH W +A+VWID
Sbjct  84   CEGSALGSQVYSRSDWYKDKWAMMYAWYFPKGWQGASTV-------SHRHLWLHAVVWID  136

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP L+NSTIL VS          TP          VKL            L+LT   GE 
Sbjct  137  NPALDNSTILAVS----------TP----------VKLDASRGFWASKMLLKLTTDKGES  176

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            QDLITWD++++ AR +L+  ++D+ LF     K+P KDGVF + L KA
Sbjct  177  QDLITWDQMTEEARTALSEANFDKHLFKRKNTKVPFKDGVFTDKLKKA  224

>PPTG_18464
Length=247

 Score = 214 bits (544),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 155/233 (67%), Gaps = 8/233 (3%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I H+QV+PF +PEP T S+K+AVKYKPQL I  GCHPY AVQ DGS+SGGL  SG  +
Sbjct  22   RTINHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWAN  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+  GS LGSQ+Y+RS W    WAI+YAWY+PKG    PV       G RH W Y +VW 
Sbjct  82   GDRKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKG----PVFTETGPPGQRHFWSYIVVWT  137

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATG  230
            D+P+  +STI GV++   VGY  Q PP+  ++ +  +VK++ Y N    + ++QLT+ +G
Sbjct  138  DSPKPNHSTIQGVTIPTEVGYEMQVPPKEDFIFEQATVKVESYLNS--ENQAVQLTDESG  195

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E QDLITW++L+  AR +L+  D++   +    + MPLKD VF  +L +A+PF
Sbjct  196  EIQDLITWEQLTDQARATLSEFDFN-IKWAYVDMVMPLKDDVFSTILEEAFPF  247

>PPTG_07661
Length=223

 Score = 213 bits (541),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 151/225 (67%), Gaps = 11/225 (5%)

Query  66   EPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYA  125
            EP T S+K+A+KYKPQL I  GC+PYPAVQ +G+ISGGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  126  RSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVS  185
            RS W    WAIMYAWYFPK  GA       R  GHRH W  AIVW DN   +NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  186  MSASVGYASQTPPETRYVD-GDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKL  244
            MS S GY  +  P+T+Y++ G ++KL  Y    L + +L+LT+ +G  QDL+TW++L+  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  245  ARYSLNHTDWD----ETLFNLAG--LKMPLKDGVFDELLNKAWPF  283
            AR +L+  D+D    + +F  +G  + MPL+DGVF  +L +++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  222

>PITG_22668
Length=519

 Score = 221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 143/236 (61%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V PF + EPVT S+KAAVK+KPQL I  GCHPYPAV   G  SGGLK SG   
Sbjct  302  KIIDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPS  361

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  362  AGCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWI  414

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTE  227
            DNPEL    IL VS SA  GY++Q PP+   V+G SVK+KY      NH L ST      
Sbjct  415  DNPELAEPKILAVSPSAHGGYSAQVPPDANKVEGTSVKVKYLSKWPINHALESTG-----  469

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              G++QDLI W +++  AR  L+ T + +         +P+ DG F+  L +AWPF
Sbjct  470  EGGDYQDLIMWGQMTDAAREGLSRTGFGKA-------NVPMNDGNFESKLGRAWPF  518

>PHYKE_7564
Length=473

 Score = 219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 143/234 (61%), Gaps = 14/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +   I H+QV+PFP+    + +  AA+KYKPQ+ I +GCHPYPAV  +G  SGGLK  G 
Sbjct  253  QAGTIDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGS  312

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y RS W N VWAIMY+WYFPK     PV       GHRH+WE+ IV
Sbjct  313  GSAGCRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDS---PV----SGMGHRHDWEHVIV  365

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNPE  N TIL ++ SA  GY++  PP    VDG SVK++Y   +L+ +  L+ T   
Sbjct  366  WIDNPENVNGTILAMTPSAHSGYSTYAPPPADMVDGASVKVEYTSTYLVINHHLEGTSTA  425

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLI W +++  ARY+LN TD            +P+KDG F   L KA+P+
Sbjct  426  GEMQDLIMWGDMTDAARYALNTTD-------FGNANVPMKDGNFLPKLEKAYPW  472

 Score = 199 bits (507),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 125/201 (62%), Gaps = 7/201 (3%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  +I H+QV+PFP+   ++ +  AA+K+KPQ+ I +GCHPYPAV  +G  SGGLK  G 
Sbjct  18   QADIINHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLKTHGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y RS W N VWAIMY+WYFPK              GHRH+WE+ +V
Sbjct  78   SSAGCRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDEPQ-------DFTGHRHDWEHVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP+  N  IL ++ SA  GY++  PP+   +DG SVK++Y  + L     L+ T   
Sbjct  131  WIDNPQNVNPRILAMTPSAHSGYSTYAPPDADMIDGTSVKVEYTSSWLFIDHHLEGTSTA  190

Query  230  GEFQDLITWDELSKLARYSLN  250
            GE QDLI W +++  AR SLN
Sbjct  191  GEMQDLIMWSDMTDAARNSLN  211

>PHALS_06162
Length=488

 Score = 219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 150/236 (64%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + + H++V PF +P+PVT ++ AAVK+KPQ+ I +GCHPYPAV   G ISGGLK SG  D
Sbjct  265  KTMRHDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNATGEISGGLKASGSSD  324

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C GS+ GSQ+Y RS W   +WAIMY+WYFPK   A P      L GHRH+WE+ IVWI
Sbjct  325  AGCKGSEYGSQVYGRSTWHRGLWAIMYSWYFPKDT-AFP------LLGHRHDWEHIIVWI  377

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTE  227
            DNP L    IL V+ SA   Y  Q+PP T  V+G SVK+KY      NH L ST+     
Sbjct  378  DNPSLYKPRILAVASSAHSWYTVQSPPHTDRVNGTSVKVKYAGIWPLNHALTSTT-----  432

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             +GE+QDLI W++L++ AR SL   +     F +A   +P++DG F + L+ AW F
Sbjct  433  KSGEYQDLIMWEQLTEAARQSLQQAN-----FGMA--NVPMRDGNFLDKLDTAWSF  481

>PHYCA_18373
Length=246

 Score = 212 bits (539),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 136/211 (64%), Gaps = 13/211 (6%)

Query  73   KAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVND  132
            KAAVK+KPQL I  GCHPYPAVQ DG +S GLK +GP DGEC GS LGSQIYARS W   
Sbjct  49   KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTGPDDGECQGSSLGSQIYARSDWYKG  108

Query  133  VWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGY  192
            V+AIMY WY PKG  +            RH WE  +VWID+P   NSTILGVS++  +  
Sbjct  109  VYAIMYTWYLPKGSAS------------RHFWESVVVWIDDPAASNSTILGVSLNYGLQL  156

Query  193  ASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHT  252
              +T  + +Y+ G S+KL  +    + +  L+LTE  GEFQDL+T+D+L+  A  +L+H 
Sbjct  157  KKETNIDPKYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHA  216

Query  253  DWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            ++ + L   A   MPL DGVF+E L  AWPF
Sbjct  217  EFSKGLIK-AKTPMPLIDGVFNERLKDAWPF  246

>PPTG_08005
Length=759

 Score = 225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 145/236 (61%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H+ V PF +PEPVT S+KAA+K+KPQL I +GCH YPAV   G  SGGLK SG   
Sbjct  542  KIIDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPS  601

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  602  AGCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWI  654

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTE  227
            DNPE+    IL V+ SA  GY++Q PP+   VDG SVK+KY      NH L ST      
Sbjct  655  DNPEIAEPKILAVTPSAHSGYSAQVPPDANKVDGTSVKVKYLSKWPINHALESTG-----  709

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              G++QDLI W +++  AR +L+ T + +         +P+ DG F+  L KAWPF
Sbjct  710  EGGDYQDLIMWGQMTDAAREALSRTSFGDA-------NVPMNDGNFEPKLGKAWPF  758

>PHYSO_259736
Length=231

 Score = 211 bits (538),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 140/230 (61%), Gaps = 22/230 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV PF + EPV  S KAA+K+KP+L+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W    WAI+                      HRH W Y ++WIDN
Sbjct  84   CKGSGLGSQVYSRSDWYQGKWAII----------------------HRHLWLYLVLWIDN  121

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            PE  N  ILGV +  + G   + PP+ +++DG S+K++YY +   G T +QLTE  GEFQ
Sbjct  122  PEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYYKSSWHGKTGIQLTENPGEFQ  181

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DL+TW+++++ AR +L   ++D        L +P  DG F   L KAW F
Sbjct  182  DLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEFTVNLEKAWIF  231

>PPTG_19506
Length=223

 Score = 211 bits (536),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 151/225 (67%), Gaps = 11/225 (5%)

Query  66   EPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYA  125
            EP T S+K+A+KYKPQL I  GC+PYPAVQ +G+ISGGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  126  RSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVS  185
            RS W    WAIMYAWYFPK  GA       R  GHRH W  AIVW DN   +NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  186  MSASVGYASQTPPETRYVD-GDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKL  244
            MS S GY  +  P+T+Y++ G ++KL  Y    L + +L+LT+ +G  QDL+TW++L+  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  245  ARYSLNHTDWD----ETLFNLAG--LKMPLKDGVFDELLNKAWPF  283
            AR +L+  D+D    + +F  +G  + +PL+DGVF  +L +++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  222

>PHYRA_72345
Length=240

 Score = 211 bits (537),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 138/234 (59%), Gaps = 14/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +G VIGH+QV PFP+ +P + +  AA+ +KPQ+ I +GCHPYP V  +G   GGLK +G 
Sbjct  18   QGAVIGHDQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYPVVNANGDTGGGLKTTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y RS W N VWAIMY+WYFPK              GHRH+WE+ +V
Sbjct  78   SAAGCRGSGYGSQVYGRSAWYNGVWAIMYSWYFPKDEPQ-------DFTGHRHDWEHVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP+  N  IL ++ SA  GY++  PP+   VDG S K++Y  + L     L+ T   
Sbjct  131  WIDNPQNTNPKILAMTPSAHSGYSTYAPPDADMVDGTSCKVEYTSSWLFIDHHLEGTSTA  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE QDLI W +++  ARY+LN T       N      P+ DG F   L KA+P+
Sbjct  191  GETQDLIMWGDMTDAARYALNTT-------NFGKANTPMNDGNFLPKLGKAYPW  237

>PHYKE_4946
Length=263

 Score = 211 bits (538),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 144/232 (62%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I H  V+PF +PEP+T S+KAAVK+KPQL I  GC  YPAV   G  SGGL+ SG   
Sbjct  47   KTIPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQESGSPK  106

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W +DVWAIMY+WYFPK   +          GHRH+WE+ +VWI
Sbjct  107  GGCRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPS-------SRLGHRHDWEHVVVWI  159

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNPE+    IL VS S   G+    PP    +DG SVK+KY ++  L + +L +T+  G+
Sbjct  160  DNPEVLEPKILAVSPSYHSGHKKYAPPSADVIDGTSVKVKYEHSWPL-NHALDVTDKAGD  218

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI WD+++ LAR +LN     ET F  A +  P+ D  F   L +AWPF
Sbjct  219  FQDLIMWDQMTDLARVALN-----ETKFGKANV--PMNDHNFLRKLEQAWPF  263

>PHYRA_71931
Length=239

 Score = 211 bits (536),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 139/231 (60%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             + H+QV+PF +PEP T S+KA VK+KPQ+ I +GCHPYPAV  +G   GGLK +G    
Sbjct  22   AMDHDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGAPSS  81

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ +VWI 
Sbjct  82   SCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVVVWIT  134

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++EN  IL VS SA  GY+    P    +DG +VK+  Y +H   + +L +T   G+ 
Sbjct  135  NPDVENPVILAVSPSAHSGYSYYVSPSADTIDGTAVKVN-YESHWPINHALDITTEGGDT  193

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+++  AR SLN         +     +P+ DG F   L KAWP+
Sbjct  194  QDLIMWDQMTDAARNSLN-------TVSFGDANVPMNDGNFQNKLGKAWPW  237

>PHYSO_414520
Length=213

 Score = 209 bits (532),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 141/228 (62%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+ V+PFP+PEPVT S+KAA+K+KPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQTSGSPKGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y R+ W NDVWAIMY+WYFPK   +          GHRH+WE+ +VWI+N
Sbjct  61   CRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDSPS-------SRMGHRHDWEHVVVWINN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    ILG+S SA  GY   + P    +DG+SVK+ Y +   + + +L  T+  G FQ
Sbjct  114  PDVPEPKILGISASAHSGYKKYSSPPPENLDGNSVKVNYEHAWPI-NHALDTTDKAGTFQ  172

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI W+++++ AR +LN         +      P+ DG F   L +AW
Sbjct  173  DLIMWEQMTEDARRALN-------AVHFGKANTPMNDGNFRHKLERAW  213

>PHYSO_468315
Length=255

 Score = 210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 136/231 (59%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PF +PE VT S+KAAVK+KPQL I +GCH YPAV + G  SGGLK  G    
Sbjct  38   TIDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLKTKGAPSA  97

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W  DVWAIMY WYFPK   +  +       GHRH+WE+ +VWID
Sbjct  98   GCKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDEPSSGI-------GHRHDWEHVVVWID  150

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++EN  IL  + SA  GY    PP    VDG + K+  + +H     +L  T   G+F
Sbjct  151  NPDVENPKILAGTPSAHSGYHKYAPPNAGTVDGVTTKVA-FESHWPMDHALDSTTEGGDF  209

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+L+  AR +LN         +      P+ DG F   L +AWPF
Sbjct  210  QDLIMWDQLTDNARRALNS-------VSFGSADTPMNDGNFQAELGRAWPF  253

>PPTG_12847
Length=331

 Score = 211 bits (538),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 141/232 (61%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH++V+PFP+PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGL+ SG   
Sbjct  113  KTIGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPR  172

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+I
Sbjct  173  GGCRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFI  225

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNPE+    IL  S+S+  GY   +P     +DG S+K++Y +   L +  L  T   G 
Sbjct  226  DNPEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGT  284

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI WD++S  AR +LN         +      P  DG F   L KAWPF
Sbjct  285  FQDLIMWDQMSNDARRALNSV-------HFGKANTPFNDGNFRPKLEKAWPF  329

>PPTG_12853
Length=342

 Score = 212 bits (539),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 141/232 (61%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH++V+PFP+PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGL+ SG   
Sbjct  124  KTIGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPR  183

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+I
Sbjct  184  GGCRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFI  236

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNPE+    IL  S+S+  GY   +P     +DG S+K++Y +   L +  L  T   G 
Sbjct  237  DNPEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPL-NHDLDTTGDAGT  295

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI WD++S  AR +LN         +      P  DG F   L KAWPF
Sbjct  296  FQDLIMWDQMSNDARRALNS-------VHFGKANTPFNDGNFRPKLEKAWPF  340

>PPTG_07089
Length=255

 Score = 209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 142/232 (61%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I H +V+PF EP+PVT S+KA VK+KPQ+ ++ GC PYPAV +DG  SGGL+ SG   
Sbjct  37   KTISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQTSGSPQ  96

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W N +WAIMY+WYFPK   +          GHRH+WE+ +V+I
Sbjct  97   GGCRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKDAPS-------SRMGHRHDWEHIVVFI  149

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNPE+    ILG S S   GY    P     +DG SVK+KY ++  L + +L +T+  G+
Sbjct  150  DNPEVPEPKILGCSPSWHSGYNKYAPCPADVIDGSSVKVKYEHSWPL-NHALDITKEAGD  208

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI WD++S LAR +LN T              P+ D  F   + K+WPF
Sbjct  209  FQDLIMWDQMSDLARRALNDT-------KFGKANTPMNDWNFLGKVEKSWPF  253

>PHYCA_108409
Length=282

 Score = 209 bits (532),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 140/234 (60%), Gaps = 15/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E + IGH++V+PFPEP+PVT S+KA VK+KPQ++I  GC PYPAV + G  SGGLK +G 
Sbjct  64   ETKTIGHDEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPTGN  123

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
              G C GS  GSQ+Y R  W+  VW IMY+WYFPK   +          GHRH+WE+AIV
Sbjct  124  SKGGCRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPST-------GMGHRHDWEHAIV  176

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            +IDNP++    IL  S+S+  GY    P     +DG S+K++Y +   L +  L  T   
Sbjct  177  FIDNPDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVRYKHGWPL-NHDLDTTGDA  235

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G FQDLI WD++++ AR +LN         +      P  DG F   L KAWPF
Sbjct  236  GTFQDLIMWDQMTEDARRALNS-------VHFGSANTPFNDGNFKPKLEKAWPF  282

>PYU1_G011231
Length=238

 Score = 207 bits (527),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 140/228 (61%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV PF EP P + S+KAA+K+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  G+Q+Y RS W N  WAIMY+WYFPK              GHRH+WE+ +VWIDN
Sbjct  84   CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDS-------PFTGLGHRHDWEHVVVWIDN  136

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P   N TIL VS SA  GY    PP+   VDG S K+  Y + ++ + +L  T A GE Q
Sbjct  137  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             LI W+++++ AR +L +T + +         +P+KDG F + L KA+
Sbjct  196  PLIMWEQMTQAARTALENTGFGDA-------NVPMKDGNFMDKLAKAY  236

>PHYSO_510888
Length=255

 Score = 207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 141/232 (61%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH++V+PFP+P+PVT S+KAAVK+KPQ+ I  GC PYPAV   G  SGGL+ SG   
Sbjct  38   KTIGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQTSGSPR  97

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W+N VWAIMY+WYFPK   +          GHRH+WE+ +V+I
Sbjct  98   GGCRGSGHGSQVYGRSTWINGVWAIMYSWYFPKDAPS-------SKMGHRHDWEHVVVFI  150

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNP++    ILG S S   GY    P     +DG SVK+KY ++  L + +L+ T   G 
Sbjct  151  DNPDVPEPKILGCSPSWHNGYNKYAPCPANVIDGTSVKVKYEHSWPL-NHALETTTKPGA  209

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI W++++  AR +LN T              P+ D  F   + KAWPF
Sbjct  210  FQDLIMWNQMTDFARRALNDT-------KFGKANTPMNDWNFLPKVEKAWPF  254

>PHYRA_71588
Length=242

 Score = 207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 155/255 (61%), Gaps = 16/255 (6%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN R + ++   +    VE   IGH++V+PF +P+PVT S+K AV++KP L+I++GCH Y
Sbjct  1    MNLRTLFVSAAVATLCAVEAVSIGHDKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSY  60

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAV   G  + GLK +G   G+C GS LGSQ+Y RS W  D+WAIMYAWYFPK      +
Sbjct  61   PAVNAAGETNAGLKGTGRPSGDCKGSSLGSQVYGRSVWHGDLWAIMYAWYFPKD-----M  115

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKL  210
            P++ +  G RH+W   +VW+DNP  E  TI+GVS SA V  YA  TPP    + G +  +
Sbjct  116  PILGK--GKRHDWANVVVWLDNPAHERPTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMI  173

Query  211  KYYYNHL-LGSTSLQLT-EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPL  268
             Y  + L  G  +L +  EA GEFQDL+ W++L+  AR +LN TD+ E         +P 
Sbjct  174  SYLADDLNYGYHTLDMNWEAGGEFQDLVMWEQLTDEARAALNDTDFGENAL------VPF  227

Query  269  KDGVFDELLNKAWPF  283
             D  F   L KAWP+
Sbjct  228  IDANFKANLEKAWPY  242

>PYU1_G011237
Length=235

 Score = 207 bits (526),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 138/233 (59%), Gaps = 23/233 (10%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            VI H+QV PF EP P + S+KAA+K+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q  
Sbjct  20   VIDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSA  79

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  G+Q+Y RS W N  WAIMY+WYFPK              GHRH+WE+ +VWID
Sbjct  80   GCKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDSP-------FTGLGHRHDWEHVVVWID  132

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKY----YYNHLLGSTSLQLTEA  228
            NP   N TIL VS SA  GY    PP+   VDG S K+ Y      NH L ST+      
Sbjct  133  NPANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYSSTIVINHALDSTTT-----  187

Query  229  TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             GE Q LI W+++++ AR +L +TD+ +         +P+KDG F   L  A+
Sbjct  188  AGEKQPLIMWEQMTQAARTALENTDFGDA-------NVPMKDGNFMTKLANAY  233

>PHYRA_71618
Length=243

 Score = 207 bits (526),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 148/235 (63%), Gaps = 20/235 (9%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +P+PVT S+KAAV++KP L+I+ GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVWLDN  136

Query  174  PELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKYYY---NHLLGSTSLQLTEAT  229
            P LE  T++GVS S+ V  Y+  TPP    ++G +  + Y     NH  G  S+  T  T
Sbjct  137  PALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTTWKT  194

Query  230  -GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             GEFQDLI W++L+  AR +LN TD+ E         +P  D  F   L KAWP+
Sbjct  195  GGEFQDLIMWEQLTDEARAALNDTDFGEHAL------VPFIDANFKANLEKAWPY  243

>PHYCA_119748
Length=261

 Score = 207 bits (528),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 141/236 (60%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            +VIGH+QV+PFP+PEPVT S+KA VK+KPQ++I  GC PYPAV + G   GGLK +G   
Sbjct  45   KVIGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSR  104

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W   VWAIMY+WYFPK     P P +    GHRH+WE+AIV+I
Sbjct  105  GNCGGSGYGSQVYGRSTWYQGVWAIMYSWYFPKDS---PSPKM----GHRHDWEHAIVFI  157

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY----YNHLLGSTSLQLTE  227
            DNPE+    IL  S+S+  GY    P     +DG S+K++Y     YNH      L  T 
Sbjct  158  DNPEVSEPKILACSVSSHSGYTKYNPCPPWVIDGTSLKVRYKHAWPYNH-----DLDATG  212

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              G+FQDLI W++L++ AR +LN         +      P  D  F   +  AWPF
Sbjct  213  DGGKFQDLIMWNQLTEDARRALNSV-------SFGKANTPFSDDKFMPKIENAWPF  261

>PHYRA_74617
Length=337

 Score = 210 bits (534),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 143/230 (62%), Gaps = 15/230 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V+PFP+PEPVT S KA VK+KPQ++I  GC+PYPAV + G + GGLK SG   G 
Sbjct  123  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKTSGKSRGN  182

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W N VWAIMY+WYFPK     P P +    GHRH+WE+A+V+IDN
Sbjct  183  CAGSGHGSQVYGRSTWHNQVWAIMYSWYFPKDS---PSPGM----GHRHDWEHAVVFIDN  235

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    ILG S+S+  GY    P     +DG S+K++Y ++  + +  L  T   G FQ
Sbjct  236  PDVPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGIFQ  294

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI W +++  AR +LN         N      P+ DG F   + K+WPF
Sbjct  295  DLIMWGQMTDNARRALNEA-------NFGSANTPMNDGNFYSKVEKSWPF  337

>PHYSO_334487
Length=258

 Score = 207 bits (526),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 136/234 (58%), Gaps = 14/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
             G +IGH+QV PFP+ +P T S KAA+K+KPQL I +GCHPYP V   G   GGLK  G 
Sbjct  18   SGGIIGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYPVVNAAGDTGGGLKTHGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C  S  GSQ+Y RS W N VWAIMY WYFPK              GHRH+WE+ IV
Sbjct  78   SAAGCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDEPQDGT-------GHRHDWEHVIV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP++EN  I+ ++ SA  GY++   P    VDG S K++Y  + L     L+ T   
Sbjct  131  WIDNPDVENPKIMAMTPSAHSGYSTYALPPADMVDGTSCKVEYTSSWLFIDHHLEGTSTA  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GEFQDLI W +L+  AR +LN T + +          P+ DG F   + KA+P+
Sbjct  191  GEFQDLIMWSDLTDGARLALNTTSFGKA-------NTPMNDGNFLPKIQKAYPW  237

>PHYCA_69480
Length=213

 Score = 205 bits (521),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 139/228 (61%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V+PFP+PEPVT S+KA VK+KPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+IDN
Sbjct  61   CRGSGHGSQVYGRSTWIQGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    IL  S+S+  GY    P     +DG S+KL+Y ++  + +  L  T  +G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKLRYKHSWPI-NHDLDTTGDSGTFQ  172

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI WD++++ AR +LN         +      P  DG F   L KAW
Sbjct  173  DLIMWDQMTEDARRALNSV-------SFGKANTPFNDGSFKPKLEKAW  213

>PPTG_13769
Length=349

 Score = 208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 139/234 (59%), Gaps = 23/234 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H  V+PFP+PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGL  SG   G+
Sbjct  134  IAHKDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLHTSGKSRGK  193

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+  VW IMY+WYFPK   +          GHRH+WE AIV+IDN
Sbjct  194  CGGSGHGSQVYGRSAWLKGVWVIMYSWYFPKDSPS-------HGLGHRHDWEEAIVFIDN  246

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYY----NHLLGSTSLQLTEAT  229
            P++    ILG S+S+  GYA   P     +DG S+K++Y +    NH      L +T   
Sbjct  247  PDVSEPKILGCSVSSHGGYARHAPCPPWVIDGTSLKVRYKHSWPKNH-----DLAITGDG  301

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G+FQDLI W +++  AR +LN         +      P KDG F + + KAWPF
Sbjct  302  GKFQDLIMWGQMTNDARRALN-------AVSFGSANTPFKDGTFQDKIEKAWPF  348

>PHYSO_334498
Length=229

 Score = 204 bits (519),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 134/220 (61%), Gaps = 15/220 (7%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G VI H+QV PF +PEPVT S+KAAVK+KPQL I +GCHPYPAV + G   GGL  +G  
Sbjct  22   GAVISHDQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGAP  81

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
             G+C GS LGSQ+Y RS W  DVW IMYAWYFPK   +  +       GHRH+WE+A++W
Sbjct  82   SGKCKGSGLGSQVYGRSGWHKDVWTIMYAWYFPKDMASFDL-------GHRHDWEHAVIW  134

Query  171  IDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            IDNP++    ILGVS S+  GY   T      ++G SV L Y     +    L+ T   G
Sbjct  135  IDNPDVAEPKILGVSASSHAGYEKVTTIPAGSLNGTSVLLNYESTWPV-DHELRFTTKGG  193

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKD  270
            E+Q LI W +L+  AR SL+ TD+   L       MP+ D
Sbjct  194  EYQPLIMWTQLTDAARVSLSTTDFGSAL-------MPMTD  226

>PPTG_12852
Length=331

 Score = 207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 141/236 (60%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH+ V+PFP+PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGLK SG   
Sbjct  115  KTIGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLKTSGKSR  174

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P P +    GHRH+WEY +V+I
Sbjct  175  GNCGGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDS---PSPGM----GHRHDWEYVVVFI  227

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYY----NHLLGSTSLQLTE  227
            +NPE++   IL  S+++  GY    P     +DG S+K++Y +    NH      L  T 
Sbjct  228  NNPEVQEPKILACSVASHGGYKKFNPCPPWVIDGTSLKVRYKHAWPMNH-----DLDTTG  282

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              G FQDLI WD+++  AR +LN         +      P  DG F + L  AWPF
Sbjct  283  DGGSFQDLIMWDQMTNDARRALNSV-------SFGKANTPFIDGRFRKKLEDAWPF  331

>PHYKE_4541
Length=147

 Score = 200 bits (509),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 113/147 (77%), Gaps = 0/147 (0%)

Query  137  MYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQT  196
            MYAWYFPKGR AV +    R FGHRHNWEYAIVWIDNP L++  ILGVSMSA+  Y+ + 
Sbjct  1    MYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDNPALDDPAILGVSMSAATSYSKRA  60

Query  197  PPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256
            PP  +Y+DGDS+K++YY N ++ ST+L+LT+  GEFQDL+TWD+L   AR +L  TDWD 
Sbjct  61   PPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQDLVTWDQLPDAARNALIDTDWDT  120

Query  257  TLFNLAGLKMPLKDGVFDELLNKAWPF  283
            TLFN AG K PLKDGVF+E L KA+P 
Sbjct  121  TLFNTAGAKFPLKDGVFNETLAKAYPL  147

>PYU1_G011233
Length=239

 Score = 203 bits (517),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 138/232 (59%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV+PF EP P T ++K A+K+KPQ+ I +GCHPYPAV   G++ GGLK  G 
Sbjct  20   QAAVIDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLKPDGS  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            Q   C GS  G+Q+Y R+   NDV+AIMY+WY PK     P+P I    GHRH+WE  +V
Sbjct  80   QSAGCKGSGWGTQVYGRAAPYNDVYAIMYSWYMPKD---TPIPGI----GHRHDWENVVV  132

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP   N  IL VS SA  GY    PP+   VDG S K+ Y   +L+   SL  T   
Sbjct  133  WIDNPNAANPKILAVSPSAHSGYEKYAPPKAGTVDGTSAKVIYSTTNLVMDHSLDSTTHA  192

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE Q LI W++L+  AR +L         ++     +P+KDG F + L K++
Sbjct  193  GEQQPLIMWEQLTDAARSTLQD-------YDFGNANVPMKDGNFMDKLGKSY  237

>PHYRA_74630
Length=343

 Score = 206 bits (525),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 141/230 (61%), Gaps = 15/230 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V+PFP+PEPVT S KA VK+KPQ++I  GC+PYPAV + G + GGLK +G   G+
Sbjct  129  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPTGKSRGK  188

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W N VW IMY+WYFPK     P P +    GHRH+WE+A+V+IDN
Sbjct  189  CAGSGHGSQVYGRSTWHNSVWVIMYSWYFPKDS---PSPGL----GHRHDWEHAVVFIDN  241

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    IL  S+S+  GY    P     +DG S+K++Y ++  + +  L  T   G FQ
Sbjct  242  PDVPEPKILACSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDGGTFQ  300

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI W +++  AR +LN         N      P+ DG F   +  AWPF
Sbjct  301  DLIMWGQMTDNARRALNEA-------NFGSANTPMNDGNFPNKVQAAWPF  343

>PPTG_22174
Length=771

 Score = 216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 152/231 (66%), Gaps = 6/231 (3%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF E EP T S+K+A+KYKPQL I DGCHPYP VQ DGS+S GLKWSG     
Sbjct  545  IDHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWSGRYRSG  604

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W    WAIMYAWYFPK  GA PV +     GHRH W +AIVW D+
Sbjct  605  CKGSDLGSQVYSRSAWYKGKWAIMYAWYFPK--GANPVSVFGS--GHRHYWLHAIVWTDS  660

Query  174  PELENSTILGVSMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            P  +NSTILG SM+ +      +  +++Y+ +G S+KL  +     G  +L+LT+ +GE 
Sbjct  661  PNPDNSTILGASMAGTTNNEKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGET  720

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLITW++L+  AR +L+   ++ +      + MPL+D  F  LL  ++PF
Sbjct  721  QDLITWEQLTDEARDALSDFSFESSESR-EWVVMPLRDSAFKVLLKNSYPF  770

>PHYRA_72165
Length=240

 Score = 202 bits (514),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 152/256 (59%), Gaps = 22/256 (9%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN RA+L++        VE   I H++V+PF +PEPVT S+KAAV++KP L+I+ GCHPY
Sbjct  1    MNLRALLLSAATITLCAVEAVSIDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPY  60

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAV   G  + GLK +GP  G+C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     
Sbjct  61   PAVNAAGETNAGLKGTGPSSGDCKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----  115

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKL  210
            P      G RH+W   +VW+DNP +E  TI+GVS S+ V  Y   TPP    + G +  +
Sbjct  116  PTFGE--GGRHDWANVVVWLDNPAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMI  173

Query  211  KYYYNHLLGSTSLQLTEAT----GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKM  266
             Y  + +  +      + T    GEFQDLI W++L+  AR +L+ TD+        G  +
Sbjct  174  NYLADDM--NNGFHTVDTTWLPGGEFQDLIMWEQLTDEARAALSDTDF--------GALV  223

Query  267  PLKDGVFDELLNKAWP  282
            P  D  F   L KAWP
Sbjct  224  PFIDANFKANLEKAWP  239

>PHYSO_249751
Length=238

 Score = 201 bits (512),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 143/233 (61%), Gaps = 14/233 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E  VIGH+QV PFP+    + +  AA+K+K Q+ I +GCHPYPAV   G  SGGLK SG 
Sbjct  18   EAGVIGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYPAVNAAGDTSGGLKPSGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             +  C GS  GSQ+Y RS   N+  AIMY+WYFPK     PV       GHRH+WE+ IV
Sbjct  78   VNAGCKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDN---PV----TGLGHRHDWEHVIV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP   N+TIL ++ SA  GY++  PP    VDG SVK++Y  + ++ +  L+ T   
Sbjct  131  WIDNPASSNATILAMTPSAHSGYSTYAPPPATMVDGTSVKVEYTSSKVVINHHLEGTSTA  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWP  282
            GE Q+LI W++++  ARY+LN TD+           +P+KDG F   L KA+P
Sbjct  191  GETQNLIMWEDMTDAARYALNTTDFGSA-------NVPMKDGNFISKLGKAYP  236

>PHYRA_72475
Length=243

 Score = 201 bits (512),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 146/235 (62%), Gaps = 20/235 (9%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+KAAV++KP L+I+ GCHPYPAV   G  SGGLK +G   G+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGMPSGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQ-----PTFSK--GKRHDWANVVVWLDN  136

Query  174  PELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKYYY---NHLLGSTSLQLTEAT  229
            P LE  TI+GVS S+ V  Y+  TPP    + G +  + Y     NH  G  S+  T  T
Sbjct  137  PALERPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNH--GFHSVDTTWKT  194

Query  230  -GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             GEFQDLI W++L+  AR + N TD+ E         +P  D  F   L KAWP+
Sbjct  195  GGEFQDLIMWEQLTDEARGAFNDTDFGEH------APVPFIDPNFKANLEKAWPY  243

>PHYCA_69477
Length=213

 Score = 200 bits (509),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 139/228 (61%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH++V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+IDN
Sbjct  61   CRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    IL  S+S+  GY    P     +DG S+K++Y ++  + +  L  T   G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPI-NHDLDTTGDAGTFQ  172

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI WD++++ AR +LN   + + +        P  DG F   L KAW
Sbjct  173  DLIMWDQMTEDARRALNSVSFGKAM-------TPFNDGSFKPKLEKAW  213

>PITG_08522
Length=382

 Score = 205 bits (522),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 137/232 (59%), Gaps = 15/232 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH+ V+ FP+PEPVT S+KA VK+KPQ++I  GC PYP V + G  SGGL+ SG   
Sbjct  124  KTIGHDDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQTSGNSR  183

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK              GHRH+WE+AIV+I
Sbjct  184  GGCRGSGHGSQVYGRSTWMEGVWAIMYSWYFPKD-------FPSSRMGHRHDWEHAIVFI  236

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            DNPE+    IL  S+S+  GY    P  +  +DG S+K++Y +   L +  L  T   G 
Sbjct  237  DNPEVAEPKILACSVSSHDGYKKYNPCPSYVIDGTSLKVRYKHAWPL-NHDLDTTGDAGT  295

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLI WD++S  AR +LN         +      P  DG F   L KAWPF
Sbjct  296  FQDLIMWDQMSNDARRALNSV-------HFGKANTPFNDGNFRPKLEKAWPF  340

>HYAP_09243
Length=266

 Score = 201 bits (512),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 141/229 (62%), Gaps = 15/229 (7%)

Query  55   GHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGEC  114
            GH+ + PF EP+PVT S+KA VK+KP L +  GC PY AV  +G  SGGL+ SG  +  C
Sbjct  46   GHDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDPESGC  105

Query  115  TGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNP  174
             GSK GSQ+Y RS W NDVWAIMYAWYFPK       P++  L GHRH+WE  +V+I++P
Sbjct  106  RGSKYGSQVYGRSTWYNDVWAIMYAWYFPKDS-----PML--LMGHRHDWENVVVFINDP  158

Query  175  ELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQD  234
            +    TILG S S   GY    P  T  ++G SV +KY ++  L + +L +T+  G +QD
Sbjct  159  DEVEPTILGCSTSWHSGYIKYAPCPTDSINGSSVMIKYEHSFPL-NHALNITKDAGAYQD  217

Query  235  LITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            LI W ++  LAR +LN TD+ + +        P+ D  F E +  AWPF
Sbjct  218  LIMWHQMPDLARRALNDTDFGKAI-------TPMNDLNFMEKIEAAWPF  259

>PHYSO_397673
Length=224

 Score = 200 bits (508),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 136/230 (59%), Gaps = 15/230 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+KA VK+KPQ++I +GCHPYPAV + G  SGGLK +G  + +
Sbjct  10   IPHDKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLKTTGGHNSK  69

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
               S   SQ+Y RS W   VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  70   SKRSGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPS-------HGLGHRHDWEHVIVWIDN  122

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P+     IL V+ SA   Y    PP    VDG S K+  Y +H   +  L +T  +GEFQ
Sbjct  123  PDASEPKILAVTPSAHGDYQKYAPPNANTVDGTSAKV-VYESHWPMNHELSVTSDSGEFQ  181

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            DLI W ++S+ AR + N         +      P+ D  F++ L KAWPF
Sbjct  182  DLIMWSQMSENARRAFNSV-------SFGKANTPMNDWGFEDRLGKAWPF  224

>PITG_22734
Length=168

 Score = 198 bits (503),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 112/153 (73%), Gaps = 8/153 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+
Sbjct  24   VNHDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D+
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWADS  135

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGD  206
                NS+I GVSMSA VG+A  TPP  +Y+ G 
Sbjct  136  STSTNSSIQGVSMSAGVGHAKATPPMLKYIHGS  168

>PITG_22916
Length=248

 Score = 200 bits (508),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 139/232 (60%), Gaps = 5/232 (2%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + I H+QVRPF +P   T  +KAAVKYKPQL IEDGCHPYPAV++DG+IS GL+WSG  +
Sbjct  21   ETIDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSGDHN  80

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C  S  GSQ+Y+R     D +AIMYAWYFPKG+G            HRH+WE+ I+W 
Sbjct  81   GHCKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSR----KHHDEHRHDWEFGIIWF  136

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            D     +S+I GV+ +       + P +  +V G  +KL+ Y         L+LT+  G+
Sbjct  137  DRDSDTDSSIAGVTTNIGRDLHDEVPLQPVHVVGSHIKLESYSTFWSAKQGLRLTKKKGD  196

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             QDLI W++L K A+ +LN  D+D T      + +P  D  F E +  ++PF
Sbjct  197  IQDLIQWEQLPKAAQTALNDADFD-TDKAKTPVVVPFNDNYFQEKVAASYPF  247

>PHYSO_330015
Length=241

 Score = 199 bits (507),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 136/235 (58%), Gaps = 19/235 (8%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G  I H++V+PFP+P PVT S+KAAVKYKP L I D CHPYPAV   G  SGGLK +G +
Sbjct  21   GATIDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGTGKR  80

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG---RGAVPVPLILRLFGHRHNWEYA  167
            DG C GS LGSQ+Y R+ W +D+WAIMYAWYFPK    RG           G RHNW  A
Sbjct  81   DGACKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKDVYYRG------TFSDKGFRHNWVNA  134

Query  168  IVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTE  227
            +VW+DNP LE        +    GY   +PP T Y +G S  L Y  N    S   Q T 
Sbjct  135  VVWLDNPALETPRYSPCRLR---GYQECSPPFTGYFNGTSAMLVYEANGEEPSALSQNTL  191

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWP  282
              GE QDLI W++L+  AR +L+ TD+ ET       K+P  D  F+  L  A P
Sbjct  192  GGGELQDLIMWEQLTVEARDALSTTDFGET-------KVPFIDANFNANLKAARP  239

>PHYRA_54327
Length=219

 Score = 199 bits (505),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 140/232 (60%), Gaps = 15/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E + I H  V+PFP+PEP+T S+KA VK+KPQ++I  GC PYPAV + G  SGGL+ SG 
Sbjct  3    ELKTISHKDVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGS  62

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
              G C GS  GSQ+Y RS W N VWAIMY+WYFPK   A          GHRH+WE+ +V
Sbjct  63   PRGGCRGSGHGSQVYGRSTWYNQVWAIMYSWYFPKDSPA-------SGMGHRHDWEHVVV  115

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            +IDNP+L    ILG S+S+  GY    P     +DG SVK++Y ++  L +  L  T   
Sbjct  116  FIDNPDLPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSVKVRYKHSWPL-NHDLDTTGDG  174

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            G FQDLI W++++  AR +LN     ET F  A    P+ D  F   + K+W
Sbjct  175  GTFQDLIMWNQMTDNARRALN-----ETKFGKA--NTPMNDWNFHSKVEKSW  219

>PPTG_13736
Length=236

 Score = 199 bits (506),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 136/231 (59%), Gaps = 15/231 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             + H+QVRPF +P PV+ S+KAAVK+KPQL I +GCHPYPAV   G  SGGL  SG    
Sbjct  21   ALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYPAVNAAGETSGGLAKSGAPSA  80

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQ+Y RS W    WAIMY+WYFPK   +          GHRH+WE+ IVWID
Sbjct  81   GCKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWID  133

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++ N  IL V+ SA  GY+   PP+   V G++ K+  Y +H   + +L  T+  GE 
Sbjct  134  NPDVANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKIN-YESHWPVNHALDSTDKGGET  192

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            Q LI WD+++  AR SLN   + +         +P+ DG F   +  A P+
Sbjct  193  QPLIMWDQMTDAARRSLNTVSFGDA-------NVPMNDGNFLRKIGNASPW  236

>PYU1_G011236
Length=237

 Score = 198 bits (504),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 137/232 (59%), Gaps = 15/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +G  I H+ V PF EP P T +QK  +K+KPQL I +GCHPYPAV   G+ SGGLK +G 
Sbjct  19   QGAEIAHDAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGS  78

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             D  C GS  G+Q+Y R+   N V+A+MY+WYFPK   +        L GHRH+WE+ +V
Sbjct  79   SDAGCKGSGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST-------LLGHRHDWEHVVV  131

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            WIDNP+  +  IL VS SA  GY    PP T  + G+S K+ Y    +L + +  +T A 
Sbjct  132  WIDNPDAASPKILAVSASAHSGYNKYHPPATTTLAGNSAKIDYKSIVVL-NHAFDMTTAA  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE Q LI WD+++  AR +L  TD+ +         +P+KDG F   L  A+
Sbjct  191  GETQPLIMWDQMTVAARTALETTDFGDA-------NVPMKDGNFMTKLANAY  235

>PHYRA_86968
Length=239

 Score = 198 bits (504),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/237 (46%), Positives = 140/237 (59%), Gaps = 18/237 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            EG  + H++V+PFP+P PVT S+KA VK+KPQL I+ GC PYPAV   G  SGGLK +G 
Sbjct  18   EGVTVDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-  76

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
             + +C  S LGSQ+Y R+ W N VWAIMYAWYFPKG    VP          RH+W  A+
Sbjct  77   DELDCILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY--------WRHDWSNAV  128

Query  169  VWIDNPELENSTILGVSMSASVGYASQT--PPETRYVDGDSVKLKYYYNHLLGSTSLQLT  226
            VWIDNP LEN  ILG+S+S S      T  P   R ++  +    Y Y   L +  L+L+
Sbjct  129  VWIDNPALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLS  188

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             + G  QDLI W +L+  AR +LN  D      N     +P+ D  F +LL +AWPF
Sbjct  189  TSRGPVQDLIMWGQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAWPF  239

>PYIR_13251
Length=236

 Score = 198 bits (503),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 135/232 (58%), Gaps = 23/232 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+ V PF +P PVT  QK A+K+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q   
Sbjct  22   IAHDAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  81

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  G+Q+Y R+    DV+A+MY+WYFPK              GHRH+WE+ +VWIDN
Sbjct  82   CKGSGWGTQVYGRAAAYKDVYALMYSWYFPKDSP-------FTGLGHRHDWEHVVVWIDN  134

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKY----YYNHLLGSTSLQLTEAT  229
            P + N TIL V+ SA  GY    PP+   VDG S K+ Y      NH L ST    T+A 
Sbjct  135  PAVANPTILAVTPSAHSGYEKYAPPKAGTVDGTSAKVDYTSKVVINHALDST----TDA-  189

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE Q LI WD+L+  AR +L +T       N     +P+KDG F   L  A+
Sbjct  190  GEKQPLIMWDQLTAAARSALENT-------NFGDANVPMKDGNFMTKLGNAY  234

>PYU1_G011235
Length=238

 Score = 198 bits (503),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 137/229 (60%), Gaps = 15/229 (7%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV PF EP P + S+K AVK+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q  
Sbjct  23   TINHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSA  82

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  G+Q+Y R     D WAIMY+WYFPK          +   GHRH+WE+ +VWID
Sbjct  83   GCKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDSP-------ITGLGHRHDWEHVVVWID  135

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP+  N  IL +S SA  GY    PP+   VDG S K+  Y + ++ + +L  T A GE 
Sbjct  136  NPKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEK  194

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            Q LI W++++  AR +L +TD+ +         +P+KDG F   L KA+
Sbjct  195  QPLIMWEQMTDAARSALENTDFGKA-------NVPMKDGNFMNKLAKAY  236

>PHYKE_5655
Length=243

 Score = 198 bits (504),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 151/239 (63%), Gaps = 18/239 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E  +IGH++V+PFP+P+PVT S+K AVK+KP L+I+ GCH YPAV     ISGGLK +G 
Sbjct  18   EVVIIGHDKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DG+CTGS LGSQ+Y R+ W ND+WAIMY+WYFPK      +P+ +   G RH+W   +V
Sbjct  78   DDGDCTGSSLGSQVYGRAVWYNDLWAIMYSWYFPKD-----MPVAIFKKGRRHDWVNVVV  132

Query  170  WIDNPELENSTILGVSMSASVGYASQ-TPPETRYVDGDSVKLKYY---YNHLLGSTSLQL  225
            W+++P  E   +LGVS S+ V   S+ TPP    ++G S  + Y    Y+H  G  ++  
Sbjct  133  WLNDPAAEKPIMLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDH--GYHTVDT  190

Query  226  TEAT-GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            T    GEFQDL+ W++L+  AR SLN T + ET       ++P  D  F   L KAWP+
Sbjct  191  TRNRGGEFQDLVMWEQLTDAARISLNETAFGET------AQVPFIDENFVANLEKAWPY  243

>PPTG_07277
Length=298

 Score = 199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 139/236 (59%), Gaps = 23/236 (10%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            + IGH++++PFP+P+PVT S+KA VK+KPQ++I  GC PYP V + G  SGGL+ SG   
Sbjct  82   KTIGHDEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQTSGSPR  141

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C GS  GSQ+Y RS W+N  WAIMY+WYFPK   +          GHRH+WE+A+V+I
Sbjct  142  GGCRGSVHGSQVYGRSAWINGFWAIMYSWYFPKDSPS-------SRMGHRHDWEFAVVFI  194

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYY----NHLLGSTSLQLTE  227
            DNP +    I+G S+S+  G     P  +  +DG+S+K++Y +    NH      L +T 
Sbjct  195  DNPGIPEPKIIGCSVSSHDGRKKYNPCPSWVIDGNSLKVRYKHAWPMNH-----DLDVTG  249

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              G FQDLI WD+++  AR +LN         +      P  DG F   L  AW F
Sbjct  250  DAGTFQDLIMWDQMTDDARRALNSV-------SFGKANTPFNDGKFLPTLESAWAF  298

>PHYKE_7566
Length=260

 Score = 197 bits (501),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 137/232 (59%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P   T  Q A +K+KPQ+ I +GCHPYPAV KDG+ SGGLK +G 
Sbjct  41   QADVISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHPYPAVNKDGNTSGGLKPTGS  100

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQIY R      V+AIMY+WYFPK          +   GHRH+WE+ IV
Sbjct  101  ASAGCKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDSP-------ITGLGHRHDWEHVIV  153

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L N +I+ VS SA  GY    PP++  +DG S K+ Y  ++L+ + +L  T   
Sbjct  154  WVDDITLTNPSIVAVSPSAHSGYNIYYPPKSGTIDGYSAKVDYSSSYLVVNHALDSTSDA  213

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L +TD+ +         +P+KD  F   L  A+
Sbjct  214  GETQDLIMWDQLTDAARTALENTDFGDA-------NVPMKDANFQAKLGNAY  258

>PHYRA_49009
Length=216

 Score = 195 bits (496),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 144/233 (62%), Gaps = 22/233 (9%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+KAAV++KP L+I+ GCHPYPAV   G  + GLK +G   G+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGMPSGD  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLF--GHRHNWEYAIVWI  171
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +          +F  G RH+W   +VW+
Sbjct  61   CKGSGLGSQVYARAVWHSDLWAIMYAWYFPKDKA---------IFGKGERHDWANVVVWL  111

Query  172  DNPELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKYYYNHL-LGSTSLQLTEAT  229
            DNP +E  TI+GVS S+ V  Y   TPP    + G +  + Y  N +  G  ++  T  T
Sbjct  112  DNPAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDMNNGFHTVDTTWKT  171

Query  230  -GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             GEFQDLI W++L+  AR +L++TD+        G  +P  D  F   L KAW
Sbjct  172  GGEFQDLIMWEQLTDEARAALSNTDF--------GALVPFIDANFKANLEKAW  216

>PHYCA_69479
Length=213

 Score = 194 bits (493),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 136/228 (60%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+ ++PFP+P PVT S+KA VK+KPQ++I  GC PYPAV + G  SGGLK +G   G 
Sbjct  1    ISHHDIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPTGNPRGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P P +    GHRH+WE+AIV+IDN
Sbjct  61   CRGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDS---PSPGL----GHRHDWEHAIVFIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    IL  S+S+  GY    P     +DG S+K++Y +   + +  L  T   G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPM-NHDLDTTGDGGSFQ  172

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI W+++++ AR +LN         N      P  DG F   L  AW
Sbjct  173  DLIMWNQMTEDARRALNSV-------NFGSANTPFNDGRFMPKLENAW  213

>PHYRA_46230
Length=212

 Score = 194 bits (493),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 136/227 (60%), Gaps = 15/227 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H +V+PF +P P T S+KA VK+KPQ++I  GC PYPAV   G  SGGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+NDVWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWAIMYSWYFPKDSPS-------SGMGHRHDWEHVVVFIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    I+G S S+  GY    P     +DG SVK++Y ++  + +  L +T   G FQ
Sbjct  114  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQ  172

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            DLI WD++++ AR +LN   + +          P+ DG F   L KA
Sbjct  173  DLIMWDQMTEDARRALNGVHFGDA-------NTPMNDGNFIPKLEKA  212

>PPTG_15231
Length=258

 Score = 195 bits (495),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 140/232 (60%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+ V PF +P   T  QKA VK+KPQ+ I +GCHPYPAV  +G+ SGGLK +G 
Sbjct  39   QADVISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPTGS  98

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQ+Y R    N V+AIMY+WYFPK     PV       GHRH+WE+ +V
Sbjct  99   SSAGCKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDS---PV----TGLGHRHDWEHVVV  151

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+ +L++ +I+ VS SA  GY    PPE+  +DG S K+ Y  + ++ + +L  T   
Sbjct  152  WVDDIKLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVINHALDSTTDA  211

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L +TD+ +         +P+KDG F   +  A+
Sbjct  212  GETQDLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKVGNAY  256

>PHYRA_52960
Length=223

 Score = 193 bits (490),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 135/228 (59%), Gaps = 14/228 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH+ V PF +P P T  QK AVK KPQ+ I +GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS+LGSQIY R      V+A MY+WY PK +        L   G+RH+WE  +VWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ-------TLPGLGYRHDWEACVVWISN  121

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
              LE   I+ +S+S    Y +  P +  Y++GDS K++Y  + ++   SL  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI WD+L+  AR +L  TD+        G ++P KD  F E L KA+
Sbjct  182  DLIMWDQLTAAARTALEDTDF-------GGARVPFKDANFKEKLAKAY  222

>PHYRA_52955
Length=223

 Score = 193 bits (490),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 135/228 (59%), Gaps = 14/228 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            IGH+ V PF +P P T  QK AVK KPQ+ I +GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS+LGSQIY R      V+A MY+WY PK +        L   G+RH+WE  +VWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ-------TLPGLGYRHDWEACVVWISN  121

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
              LE   I+ +S+S    Y +  P +  Y++GDS K++Y  + ++   SL  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI WD+L+  AR +L  TD+        G ++P KD  F E L KA+
Sbjct  182  DLIMWDQLTAAARTALEDTDF-------GGARVPFKDANFKEKLAKAY  222

>PYU1_G011230
Length=238

 Score = 193 bits (490),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 137/228 (60%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV PF EP P +  +K AVK+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  G+Q+Y R    N V+ +MY+WYFPK          +   GHRH+WE+ +VWIDN
Sbjct  84   CKGSGWGTQVYGRGAAYNGVYGLMYSWYFPKDS-------PITGLGHRHDWEHVVVWIDN  136

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P+  N  IL +S SA  GY    PP+   VDG S K+  Y + ++ + +L  T A GE Q
Sbjct  137  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             LI W+++++ AR +L +T + +         +P+KDG F + L KA+
Sbjct  196  PLIMWEQMTQAARTALENTGFGDA-------NVPMKDGNFMDKLAKAY  236

>PHYCA_12462
Length=177

 Score = 191 bits (485),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 120/163 (74%), Gaps = 11/163 (7%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H++V+PF +PEP T S+K+AVKYKPQL+I        AVQ DGS+S GLKW+G  D
Sbjct  22   EMINHDKVQPFTQPEPTTNSEKSAVKYKPQLRIS------TAVQADGSVSAGLKWTGWSD  75

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS+LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  76   GDCKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYIS----KYRFGHRHYWSYAIVWM  131

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYY  213
            D+   +NSTILGVSMSA VGY+ +T P+++Y VDG +VK + Y
Sbjct  132  DSDVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYRA_39489
Length=237

 Score = 193 bits (490),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 138/235 (59%), Gaps = 18/235 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            EG  + H++V+PFP+P PVT S+KA VK+KPQL I+ GC PYPAV   G  SGGLK +G 
Sbjct  18   EGVTVDHDKVQPFPQPAPVTISEKAXVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-  76

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
             + +C  S LGSQ+Y R+ W N VWAIMYAWYFPKG    VP          RH+W  A+
Sbjct  77   DELDCILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY--------WRHDWSNAV  128

Query  169  VWIDNPELENSTILGVSMSASVGYASQT--PPETRYVDGDSVKLKYYYNHLLGSTSLQLT  226
            VWIDNP LEN  ILG+S+S S      T  P   R ++  +    Y Y   L +  L+L+
Sbjct  129  VWIDNPALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLS  188

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             + G  QDLI W +L+  AR +LN  D      N     +P+ D  F +LL +AW
Sbjct  189  TSRGPVQDLIMWGQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAW  237

>PHYRA_72477
Length=238

 Score = 193 bits (490),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 136/236 (58%), Gaps = 17/236 (7%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            EG  + H++V+PFP+P PVT S+KA VK+KP L I  GC  YPAV   G  SGGLK SG 
Sbjct  18   EGVTVDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGG  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
                C    LGSQ+Y R+ W NDVWAIMYAWYFPKG   A P          RH+W  A+
Sbjct  78   TTSGCALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF--------WRHDWSNAV  129

Query  169  VWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTE  227
            VWIDNP LEN   LG+S+S S   Y S    E  + +G +  L  Y   +  +T L    
Sbjct  130  VWIDNPALENPKALGLSISRSENKYGSTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGY  188

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             +GEFQDLI WD+L+  AR +LN  D      N    ++P+ D  F + L +AWPF
Sbjct  189  DSGEFQDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKRLEEAWPF  238

>PYIR_13252
Length=236

 Score = 193 bits (490),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 132/232 (57%), Gaps = 23/232 (10%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+ V+PF EP P T + + A+K+KPQ+ I +GC PYPAV   G+ SGGLK SG Q   
Sbjct  22   IAHDAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYPAVDSAGNTSGGLKPSGSQSAG  81

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  G+Q+Y R+    D + IMY+WYFPK          L   GHRH+WE+ +VWIDN
Sbjct  82   CKGSGWGTQVYGRAAQYKDAYGIMYSWYFPKDS-------PLTGLGHRHDWEHVVVWIDN  134

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKY----YYNHLLGSTSLQLTEAT  229
            P   N  IL VS SA  GY+   PP+   VDG S K+ Y      NH L ST    T+A 
Sbjct  135  PNAANPKILAVSPSAHSGYSKYAPPKAGTVDGTSAKVDYTSKVVINHALDST----TDA-  189

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE Q LI WD+L+  AR +L +T       N     +P+KDG F   L  A+
Sbjct  190  GEQQPLIMWDQLTAAARSALENT-------NFGDANVPMKDGNFMNKLANAY  234

>PHYRA_83592
Length=237

 Score = 192 bits (489),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 138/231 (60%), Gaps = 16/231 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PFP+P+PVT S+KA VK+KP+L I++GC  YPAV   G  SGGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C    LGSQ+Y R++W NDVWAIMYAWYFPKG          +    RH+W   +VWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDKCPYWRHDWSNVVVWIDN  133

Query  174  PELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            P++E S +LG+S+S S   Y  +  P     +G +  L Y Y    GS  L      G+F
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPML-YRYLPSFGSAGLNTYVDLGQF  192

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI WD+L+  AR +LN  D      N    ++P+ D  F E L KAWPF
Sbjct  193  QDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPEHLEKAWPF  237

>PYIR_13275
Length=237

 Score = 192 bits (488),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 133/236 (56%), Gaps = 23/236 (10%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
               VI H+ V PF +P  VT  QK  VK+KPQ+ I +GCHPYPAV   G+ SGGL  +G 
Sbjct  19   NAAVIAHDAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGS  78

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             D  C GS  G+Q+Y R    N V+A+MY+WYFPK              GHRH+WE+ +V
Sbjct  79   SDAGCKGSGYGTQVYGRGVAYNGVYALMYSWYFPKDSP-------FTGLGHRHDWEHVVV  131

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKY----YYNHLLGSTSLQL  225
            WIDNP+  +  IL +S SA  GY    PP+T  VDG+S K+ Y      NH L ST+   
Sbjct  132  WIDNPDAASPVILAISPSAHSGYEKYAPPKTDTVDGNSAKVDYKSIVVINHALDSTT---  188

Query  226  TEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
                GE Q LI WD+L+  AR +L +TD+ +         +P+KDG F   +  A+
Sbjct  189  --TAGEQQPLIMWDQLTAAARTALENTDFGDA-------NVPMKDGNFMTKIANAY  235

>PHYSO_336498
Length=238

 Score = 192 bits (488),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 138/232 (59%), Gaps = 17/232 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V PFP+P+PVT S+KAAVK+KPQL IEDGC  +PAV   G  SGGLK     +  
Sbjct  22   IDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFPAVNAAGETSGGLK-GNSGNSA  80

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG         + +   R +W  A+VWIDN
Sbjct  81   CDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKG-------FFVGVASRRFDWSSAVVWIDN  133

Query  174  PELENSTILGVSMSAS-VGYASQTP-PETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            P+     ILG+S S S   Y ++TP P+   +DG +  L    +   G   L  +  TG+
Sbjct  134  PDFAAPKILGISTSTSDDDYETKTPAPDYAILDGTTTLLFRSTSREAGQPKLYYSSRTGD  193

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             Q LI W++L + AR +LN TD     F LA   +P+ D  F++ L KAWPF
Sbjct  194  SQPLIMWEQLPEAARLALNTTD-----FGLA--YVPINDDTFEKKLKKAWPF  238

>PYIW_25259
Length=246

 Score = 192 bits (489),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 133/241 (55%), Gaps = 32/241 (13%)

Query  54   IGHNQVRPFPEPEPVTFSQK---------AAVKYKPQLKIEDGCHPYPAVQKDGSISGGL  104
            I H+ V PF +P PVT  Q          AA+K+KPQ+ I +GCHPYPAV   G+  GGL
Sbjct  23   IAHDAVVPFAQPAPVTLEQTPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGGGL  82

Query  105  KWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNW  164
            K SG Q   C GS  G+Q+Y RS W N  WAIMY+WYFPK              GHRH+W
Sbjct  83   KPSGSQSAGCKGSGWGTQVYGRSTWFNGKWAIMYSWYFPKDS-------PFTGLGHRHDW  135

Query  165  EYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKY----YYNHLLGS  220
            E+ +VWIDNP   N  IL V+ SA  GY    PP++  VDG+S K++Y      NH L S
Sbjct  136  EHVVVWIDNPANANPAILAVTPSAHSGYKKYAPPKSGTVDGNSAKVEYKAIIVINHALDS  195

Query  221  TSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            T+       GE Q LI WD+L+  AR  L +TD+           +P+KDG F   +  A
Sbjct  196  TTTG-----GEQQPLIMWDQLTDAARSGLENTDFGSA-------NVPMKDGNFMTKVANA  243

Query  281  W  281
            +
Sbjct  244  Y  244

>PHYCA_123205
Length=177

 Score = 189 bits (480),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 119/163 (73%), Gaps = 11/163 (7%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
            ++I H++V+PF +PEP T S+ +AVKYKPQL+I        AVQ DGS+S GLKW+G  D
Sbjct  22   EMINHDKVQPFTQPEPTTNSENSAVKYKPQLRIS------TAVQADGSVSAGLKWAGWSD  75

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G+C GS+LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  76   GDCKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYIS----KYRFGHRHYWSYAIVWM  131

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYY  213
            D+   +NSTILGVSMSA VGY+ +T P+++Y VDG +VK + Y
Sbjct  132  DSDVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYRA_45457
Length=199

 Score = 190 bits (482),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 121/197 (61%), Gaps = 8/197 (4%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            VI H+QV PF EP PVT S+KA VK+KPQL I +GCH YPAV + G   GGLK SG    
Sbjct  11   VISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSS  70

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
            +C GS  GSQIY RS W +DVWAIMYAWYFPK   +          GHRH+WE+A++WID
Sbjct  71   KCKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMAST-------TLGHRHDWEHAVIWID  123

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP++    ILGVS+S+  GYA  T      + G +V + Y     L    L LT   G+ 
Sbjct  124  NPDVAEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPL-DHELSLTTKGGDL  182

Query  233  QDLITWDELSKLARYSL  249
            Q LI W +L+  AR SL
Sbjct  183  QPLIMWSQLTDAARNSL  199

>PHYSO_496064
Length=254

 Score = 191 bits (486),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 129/223 (58%), Gaps = 24/223 (11%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H++V+PF +PEP T S+KAAVK+KP ++I  GCHPYPAV   G  SGGLK SG 
Sbjct  18   EAVNIDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPSGE  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DG+C  S LGSQ+Y R+ W  D+WAIMY WYFPK              G RH W   IV
Sbjct  78   PDGDCKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGT-----FFRSGQRHKWASFIV  132

Query  170  WIDNPELENSTILGVSMS-------------ASVGYASQTPPETRYVDGDSVKLKY---Y  213
            W+DNP LE   IL VS S              + G  S +PP T Y++G S  L Y   +
Sbjct  133  WLDNPSLEKPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLAYLDTF  192

Query  214  YNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256
            Y  +L  T+ +     GE QDLI W++L++ A+ +LN TD+ E
Sbjct  193  YGSILEMTTAR---TGGELQDLIMWEQLTEEAQIALNETDFGE  232

>PHYKE_7568
Length=372

 Score = 194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 134/232 (58%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P P T  Q+ A+K+KPQ+ I +GCHPYPAV +DG+ SGGL  +G 
Sbjct  153  QATVISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYPAVDEDGNTSGGLAPTGS  212

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            +   C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +V
Sbjct  213  ESAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWEACVV  265

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L+   I+ +S SA  GY    PP + Y+DGDS K++Y  ++++   SL  T   
Sbjct  266  WLDDITLDEPNIVALSASAHSGYNVYYPPSSSYLDGDSAKIEYSSSYIVIDHSLSATSTA  325

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L  TD+           +P K+  F   L  A+
Sbjct  326  GETQDLIMWDQLTDAARAALEDTDF-------GSANVPFKEANFQTKLGNAY  370

 Score = 109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 84/144 (58%), Gaps = 15/144 (10%)

Query  137  MYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQT  196
            MY+WYFPK          L  FGHRH+WE+ +VW++NP + +  IL VS SA  GY    
Sbjct  1    MYSWYFPKDSP-------LTGFGHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYY  53

Query  197  PPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256
            PP++ Y+DG+S K+  YY+ LL + + ++T   GE QDLI WD+L+  A+ +L  TD+ +
Sbjct  54   PPDSDYLDGNSAKID-YYSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALEDTDFGD  112

Query  257  TLFNLAGLKMPLKDGVFDELLNKA  280
                     +P KD  F+  L  A
Sbjct  113  A-------NVPFKDANFETKLANA  129

>PHYRA_72390
Length=237

 Score = 189 bits (481),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 137/231 (59%), Gaps = 16/231 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PFP+P+PVT S+KA VK+KP+L I++GC  YPAV   G  SGGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C    LGSQ+Y R++W NDVWAIMYAWYFPKG          +    RH+W   +VWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDKCPYWRHDWSNVVVWIDN  133

Query  174  PELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            P++E S +LG+S+S S   Y  +  P     +G +  L Y Y    GS  L      G+F
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPML-YRYLPSFGSAGLNTYVDLGQF  192

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            Q LI WD+L+  AR +LN  D      N    ++P+ D  F E L KAWPF
Sbjct  193  QGLIMWDQLADAARAALNDQD------NFGRTEVPISDDHFPEHLEKAWPF  237

>PHYCA_6835
Length=210

 Score = 188 bits (477),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 124/216 (57%), Gaps = 23/216 (11%)

Query  72   QKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVN  131
            +++AVK+KPQL I +GCH YPAV + G   GGLK  G     C GS  GSQ+Y RS W  
Sbjct  13   RRSAVKFKPQLHITNGCHSYPAVDEAGETGGGLKTKGAPSAGCKGSGWGSQVYGRSGWYQ  72

Query  132  DVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVG  191
            DVWAIMY WYFPK   +  +       GHRH+WE+ IVWIDNP +EN  IL V+ SA  G
Sbjct  73   DVWAIMYCWYFPKDEPSSGI-------GHRHDWEHVIVWIDNPAVENPKILAVTPSAHSG  125

Query  192  YASQTPPETRYVDGDSVKL----KYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARY  247
            Y    PP    +DG + K+    K+  +H L STS       G+FQDLI WD+LS+ AR 
Sbjct  126  YHKYAPPNADTIDGVTTKVAYDSKWPMDHALDSTS-----EAGDFQDLIMWDQLSENARR  180

Query  248  SLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            +LN         N      P+ DG F   L KAWPF
Sbjct  181  ALNSV-------NFGKANTPMNDGNFQPKLAKAWPF  209

>PHYSO_490000
Length=241

 Score = 189 bits (479),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/254 (44%), Positives = 151/254 (59%), Gaps = 16/254 (6%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            M++RA+ + ++  L   +E  +I H+QV PFP+ +P T + KAA+K KP+L I +GCH +
Sbjct  1    MSFRALSVTIIIVLLKPIEAGIIDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLH  60

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIY--ARSKWVNDVWAIMYAWYFPKGRGAV  149
            PAV  +G  SGGLK  G  +G C GS  GSQ+Y   RS W N VWAIMYAWYFPK     
Sbjct  61   PAVNANGDTSGGLKPKGSPEGGCRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPKDEPT-  119

Query  150  PVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVK  209
                     GHRH+WE+ IV I+NP LEN TIL ++ SA  GY++  PP    V G S K
Sbjct  120  ------DFDGHRHDWEHVIVRINNPVLENPTILAMTPSAHSGYSTYAPPPADMVSGTSCK  173

Query  210  LKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLK  269
            ++Y  + +     L+ T   GE QDLI W +L+  ARY+L+ T       N      P+ 
Sbjct  174  VEYTSSWIFIDHHLEGTSTAGETQDLIMWSDLTDAARYALSTT-------NFGKADTPMN  226

Query  270  DGVFDELLNKAWPF  283
            +G F+  L+KAWP+
Sbjct  227  NGTFNWKLSKAWPW  240

>PHYSO_329114
Length=236

 Score = 188 bits (477),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 132/224 (59%), Gaps = 9/224 (4%)

Query  32   MNYRavliavvaslaavvEGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPY  91
            MN R   + +VA   AV +   I H+QVRPF +P+P T S+KAAVK+ PQ+ I +GCHPY
Sbjct  1    MNLRFFFVTLVAVFTAVADAGSINHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPY  60

Query  92   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPV  151
            PAV   G  SGGL+ +G     C GS  GSQ+Y RS W    WAIMY+WYFPK   +   
Sbjct  61   PAVNAAGETSGGLQTNGAPSAGCKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPST--  118

Query  152  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLK  211
                   GHRH+WE+ +VWIDNP + N  IL V+ SA  GY+   PP+   V G++ K+ 
Sbjct  119  -----TLGHRHDWEHVVVWIDNPAVANPKILAVTPSAHSGYSKYAPPKAGTVTGNTAKVN  173

Query  212  YYYNHLLGSTSLQLTEATGEFQDLITWDEL-SKLARYSLNHTDW  254
             Y +H   + +L  T+  G+ QDLI W++   KL R    H  W
Sbjct  174  -YESHWPVNHALDSTDVGGDAQDLIMWEQQHGKLRRRQCTHERW  216

>HYAP_06628
Length=245

 Score = 188 bits (478),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 136/231 (59%), Gaps = 15/231 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+ F +PEPVT S+KAAV+  P L +  GC PYPAV + G  SGGLK +G  +G 
Sbjct  29   IPHHEVKAFAQPEPVTISEKAAVRLNPTLLVTYGCQPYPAVNEFGQTSGGLKPTGDHNGH  88

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+YARS W  D WAIM+A+YFPK +    V +       RH+WE+A+VWI N
Sbjct  89   CKGSGHGSQVYARSAWFGDKWAIMFAYYFPKSQPRRSVSV-------RHSWEFAVVWIAN  141

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF-  232
            PE    T+   + S + GY   T  +   +DG+ VKL+ Y+ H      L+LT   G   
Sbjct  142  PEAPEKTLALTTRSFAYGYFKYTSFDASEMDGERVKLR-YWQHADSDLYLELTSLDGGVT  200

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            + LI W++L + AR +LN   W+       G K PL D  F+ LLN +WPF
Sbjct  201  RPLIMWEQLPEKARCALNEATWN------GGFKCPLSDEAFEPLLNASWPF  245

>PHYSO_526541
Length=239

 Score = 188 bits (477),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 131/241 (54%), Gaps = 29/241 (12%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G  I H++V+PF +P P T S+KAAVK+KP L+I DGCHPYPAV   G  SGGLK +GP 
Sbjct  19   GVTIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPV  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            DG+C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L   G RH W  A+VW
Sbjct  79   DGKCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH-------LGYKGQRHKWVDAVVW  131

Query  171  IDNPELENSTIL---------GVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGST  221
            +DNP  E   +L         G    A   + + T P   Y         +Y      + 
Sbjct  132  LDNPAFETPKVLANVPQRCEHGSCGKAFAEFMNNTTPMISY-------RPFYMETSFHTL  184

Query  222  SLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             +  T  TGE QDLI W++LS  AR +L+ TD+ E        K+P  D  F+  L  A 
Sbjct  185  EMTSTRGTGELQDLIMWEQLSPEARTALSETDFGE------AAKVPFIDANFETNLELAR  238

Query  282  P  282
            P
Sbjct  239  P  239

>PHYRA_43347
Length=220

 Score = 187 bits (475),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 134/205 (65%), Gaps = 17/205 (8%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +P+PVT S+KAAV++KP L+I+ GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  114  CTGSKLGSQI---YARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            C GS LGSQ+   YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW
Sbjct  84   CKGSGLGSQVVLRYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVW  136

Query  171  IDNPELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKYYY---NHLLGSTSLQLT  226
            +DNP LE  T++GVS S+ V  Y+  TPP    ++G +  + Y     NH  G  S+  T
Sbjct  137  LDNPALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNH--GFHSVDTT  194

Query  227  EAT-GEFQDLITWDELSKLARYSLN  250
              T GEFQDLI W++L+  AR +LN
Sbjct  195  WKTGGEFQDLIMWEQLTDEARAALN  219

>PHALS_06084
Length=260

 Score = 188 bits (478),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 137/234 (59%), Gaps = 15/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            + + I ++QVR F +P+P T SQ+ A+ +KPQL I  GC PYPAV + G  SGGL     
Sbjct  41   QPKTIPYDQVRGFRQPKPTTISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLPKDAD  100

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             + +C GS+  SQ+Y RS W NDVW +M++WYFPK     P PL+    GHRH+WE  ++
Sbjct  101  TETKCHGSQFNSQVYGRSTWFNDVWVMMFSWYFPKDS---PFPLL----GHRHDWENVVI  153

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            +ID+P++    ILG SMS    Y    P  T   +G SVK+KY  +  L   +L +TE  
Sbjct  154  FIDSPKVPLPKILGCSMSYHSEYIKFAPCPTFATNGTSVKVKYEDSFPLNH-ALNVTEKE  212

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G FQDLI W++L  + R SLN TD            +P+ D  F + + +AWPF
Sbjct  213  GTFQDLIMWNQLPPIVRKSLNDTD-------FGSANVPMNDWNFLKKVEEAWPF  259

>PHYSO_255972
Length=215

 Score = 185 bits (470),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 130/233 (56%), Gaps = 37/233 (16%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G  I H++V+PF +P P T S+KAAVK+KP L+I DGCHPYPAV   G  SGGLK +GP 
Sbjct  19   GVTIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPV  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            DG+C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L   G RH W  A+VW
Sbjct  79   DGKCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH-------LGYKGQRHKWVDAVVW  131

Query  171  IDNPELENSTILGVSM-SASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            +DNP  E   +L VS  S   GY S                     H L  TS   T  T
Sbjct  132  LDNPAFETPKVLAVSTWSWGGGYTS--------------------FHTLEMTS---TRGT  168

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWP  282
            GE QDLI W++LS  AR +L+ TD+ E        K+P  D  F+  L  A P
Sbjct  169  GELQDLIMWEQLSPEARTALSETDFGE------AAKVPFIDANFETNLELARP  215

>PHYCA_132529
Length=232

 Score = 186 bits (472),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 141/236 (60%), Gaps = 27/236 (11%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            ++ + +++PF +PEP+T S K AV++KPQL+I+DGCHPYPAV + G IS G   SG  D 
Sbjct  11   IVDYQEIKPFAQPEPITVSDKVAVRFKPQLRIKDGCHPYPAVNEAGDISSGAD-SGWGDS  69

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C+GS +GSQ+Y RS W   VW +MYAWYFPK                 H WE  +VWID
Sbjct  70   SCSGSDVGSQVYGRSAWCGGVWGMMYAWYFPKDETT-------------HRWENVVVWID  116

Query  173  NPELENSTILGVSMSASVGYASQTPPETR--YVDGDSVKLKYYYNHLLGSTS----LQLT  226
            +P +EN TILGVS S+  GY    P +      DGD+V+++Y  + ++ +T     L  +
Sbjct  117  DPAVENPTILGVSTSSDGGYIRYAPLDDNDWARDGDNVQIQYRLDDVMATTRVFHHLDTS  176

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWP  282
               G+ Q L+TW++L++ AR +L + D+ E+       K+PLK+  F   L+ A P
Sbjct  177  WRGGDIQGLVTWEQLTEEARNTLENGDFGES-------KVPLKNSTFTANLDFAIP  225

>PHYCA_69457
Length=213

 Score = 185 bits (470),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 138/228 (61%), Gaps = 15/228 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+PFP+PEPVT S+KA VK+KPQ+++  GC PYPAV + G  SGGLK +G   G 
Sbjct  1    INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPTGNPRGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P P +    GHRH+WE+AIV+IDN
Sbjct  61   CGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDS---PSPGL----GHRHDWEHAIVFIDN  113

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    IL  S+S+  GY    P     +DG S+K++Y ++    +  L  T   G FQ
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHS-WPTNHDLDTTGDGGSFQ  172

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            DLI W+++++ AR +LN         N      P  DG F   L  AW
Sbjct  173  DLIMWNQMTEDARRALNSV-------NFGSANTPFNDGKFMPKLENAW  213

>PHALS_13513
Length=240

 Score = 186 bits (471),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 138/232 (59%), Gaps = 14/232 (6%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I  N V+PFPE +P T S+++A+KYKP L + +GCHPYPAVQ++GS+S G +W      
Sbjct  22   AIDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQ  81

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C  S  GSQIY+RS W    WAIMYAWYFPK      V +   + G RH W +AIVW D
Sbjct  82   PCGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKA----AVHIGRGVSGRRHYWLHAIVWTD  137

Query  173  NPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
                 NS+ILGV+MSA +G   +T  ++ Y + G ++KL  Y +      +L+ T   GE
Sbjct  138  EENPNNSSILGVTMSAGIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFTVKLGE  197

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             QDLITW++LS  AR +L      +T         PL+D  FD L+ +A+PF
Sbjct  198  TQDLITWEQLSHEARKALALDYKSDT---------PLQDYRFDGLIKEAYPF  240

>PPTG_04799
Length=245

 Score = 186 bits (472),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 144/240 (60%), Gaps = 24/240 (10%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQL--KIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
             I H+++ PFP+P+PVT S+KAA+K+KPQL   I+  C P+PAV   G ++GGLK +   
Sbjct  21   TIDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTVCAPFPAVNAAGDVTGGLKGTNGN  80

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            D  C  ++ GSQ+Y R+ W  D+WAIMYAWYFPKG         +     RH+W+  +VW
Sbjct  81   DA-CRFARKGSQVYGRAGWHKDMWAIMYAWYFPKG-------FWMDFPTRRHDWKNVVVW  132

Query  171  IDNPELENSTILGVSMSASVGYASQTPPET------RYVDG-DSVKLKYYYNHLLGSTSL  223
            IDNP+LE+  I+ VSMS S G +  T  ++       + +G D   L+++Y   LGS  L
Sbjct  133  IDNPDLESPKIVAVSMSKS-GRSYHTEDQSGGLISRSFFNGFDRTSLRFHYQTDLGSPYL  191

Query  224  QLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
                  GE+QDLI W++L+  AR +LN       ++N    ++P  D  F++ L+KAWPF
Sbjct  192  NFAWWGGEYQDLIMWEQLTDPARVALND------IYNFGDAEVPFSDNNFEDYLDKAWPF  245

>PPTG_00460
Length=259

 Score = 186 bits (472),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 138/227 (61%), Gaps = 12/227 (5%)

Query  56   HNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  115
            H++V+PF +PEP+T ++KAAVK+KP L ++ GCHPYPAV   G  S GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPDGECE  81

Query  116  GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPE  175
            GS LGSQ+Y+RSKW  D WAIMYAWYFPK      + LI +  G RH+W   +VW+DNP 
Sbjct  82   GSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQN--IGLIKK--GVRHDWVNLVVWLDNPA  137

Query  176  LENSTILGVSMSA-SVGYASQTPPE-TRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            L   TIL  S S    GY    PP+ +  ++G + K++Y  ++  G  ++      GE+Q
Sbjct  138  LAEPTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEEGEYQ  197

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            DLI W++L+   R +L +TD+ +         +P  D  F+  L  A
Sbjct  198  DLIQWNQLTNATRKALENTDFGDF------ANVPFNDAYFETNLKAA  238

>PPTG_15234
Length=235

 Score = 185 bits (469),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 136/232 (59%), Gaps = 16/232 (7%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P P T  Q  AV++KPQ+ I +GCHPYPAV +DG+ SGGLK +G 
Sbjct  18   DAAVIDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            +   C GS  GSQIY R+   + V+A MY+WY PK          L   GHRH+WE  +V
Sbjct  78   ESAGCKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDE-------TLDGLGHRHDWENCVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L+N +I+ +S S    Y    PP++ Y+DGDS K++Y  + ++   SL  T   
Sbjct  131  WLDS--LDNPSIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVILDHSLSATSTV  188

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L  TD+ +         +P K+  F   +  A+
Sbjct  189  GETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKETNFATKVANAY  233

>PHYRA_52426
Length=152

 Score = 182 bits (461),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 109/160 (68%), Gaps = 8/160 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I + +++PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  D WAIMY WY PKG            +  RH WE A+VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKG--------CPTKYQRRHFWETAVVWIDD  112

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYY  213
            P L NSTILGVS++       +TP   R++DG SVKL  Y
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSY  152

>HYAP_08306
Length=286

 Score = 186 bits (472),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 129/232 (56%), Gaps = 17/232 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            +GH+ ++PFP+P+PVT     A+K KP+L I  GCHPYPAV   G  S GLK SG  DG 
Sbjct  58   VGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTSNGLKTSGDADGH  117

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y R+ W    WAIMYAWYFPK              G RH+WE+AIVWI+N
Sbjct  118  CKGSGHGSQVYGRATWFRGKWAIMYAWYFPKDAPD-------EESGQRHDWEHAIVWINN  170

Query  174  PELENSTILGVSMSAS--VGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            P+++   IL VS+S     GY  +  P     DG  +KL Y  +H      L LT   GE
Sbjct  171  PKVKQPKILAVSVSCGKFFGYLKKVAPGPAVFDGTRLKLSYGADH-KHEHRLDLTAEKGE  229

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             QDLI W++L+  AR + +   W   +       MPL D  +   L +AWPF
Sbjct  230  DQDLIMWEQLTDEARCAFDTILWTNDM-------MPLNDAWYKHELTRAWPF  274

>PHYRA_84277
Length=240

 Score = 184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 132/237 (56%), Gaps = 17/237 (7%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            EG  + H++V+PFP+P PVT S+KA VK+KP L I  GC  YPAV   G  SGGLK SG 
Sbjct  18   EGVTVDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGG  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
                C    LGSQ+Y R+ W NDVWAIMYAWYFPKG   A P          RH+W  A+
Sbjct  78   TTSGCALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF--------WRHDWSNAV  129

Query  169  VWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHL-LGSTSLQLT  226
            VWIDNP LEN   LG+S+S S   Y S    ++ +  G +  L  Y   +   + S    
Sbjct  130  VWIDNPALENPKALGLSISRSENKYGSTYTDDSVFEYGTTPSLSRYLPPMQTAALSTSSF  189

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
                E QDLI WD+L+  AR +LN  D      N     +P+ D  F +LL +AWPF
Sbjct  190  PNDFELQDLIMWDQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAWPF  240

>PITG_16866
Length=238

 Score = 184 bits (467),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 137/231 (59%), Gaps = 15/231 (6%)

Query  52   QVIGHNQVRPFPEPEPVTFS-QKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
             VI H+ V PF +P   T + QKA +K+KPQ+ I +GCHPYPAV  DG+ SGGL  +G  
Sbjct  20   DVISHDAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSS  79

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
               C GS  GSQIY R    N V+AIMY+WYFPK          L   GHRH+WE+ +VW
Sbjct  80   SAGCKGSGYGSQIYGRVATYNGVFAIMYSWYFPKDSP-------LTGLGHRHDWEHVVVW  132

Query  171  IDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            +D+ +L + +++ VS SA  GY    PPE+  +DG S K+ Y  + L+ + +L  T   G
Sbjct  133  VDDIKLNSPSVIAVSPSAHSGYNIYHPPESNTIDGYSTKVDYSSSWLVINHALDSTTDAG  192

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            E Q+LI WD+L+  AR +L +TD+ +         +P+KDG F   +  A+
Sbjct  193  ETQNLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKVGNAY  236

>PHYRA_71307
Length=237

 Score = 184 bits (466),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 132/232 (57%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P P T  Q  AV +KPQ+ I +GCHPYPAV +DG+ SGGLK +G 
Sbjct  18   QAAVIDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            Q   C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +V
Sbjct  78   QSAGCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWENCVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L+   I+ +S S    Y    PP++ Y+DG+S K++Y  + ++   SL  T  +
Sbjct  131  WLDDITLDEPNIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTS  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI W +L+  AR +L  TD+           +P K+G F   +  A+
Sbjct  191  GETQDLIMWGQLTDAARTALEDTDF-------GSANVPFKEGNFATKVANAY  235

>PHYRA_44405
Length=232

 Score = 183 bits (465),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 138/234 (59%), Gaps = 16/234 (7%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H++V+PF +PEPVT S+KAAV++KP+L+I  GCHPYPAV   G  S GLK +G 
Sbjct  12   EAISIDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGT  71

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DG+C  S+LGSQ+Y RS W  D+W IMYAWYFPK +     P   +  GHRH W   +V
Sbjct  72   HDGDCMRSRLGSQVYGRSVWYGDLWGIMYAWYFPKDK-----PKYRK--GHRHEWANVVV  124

Query  170  WIDNPELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKYYYNHLL-GSTSLQLT-  226
            W+DNP  E  T++G+S S  V  YA      T   DG +  + Y  + L  G  S+ +  
Sbjct  125  WLDNPAHERPTMIGMSTSWFVTTYAKYKFVPTNGFDGKTYTINYKDDVLNDGFHSVDVIW  184

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            E  GEFQDLI W++L+  AR +L+ TD+ E         +P  D  F   L KA
Sbjct  185  EIGGEFQDLIMWEQLTDEARAALSDTDFGED------APVPFIDANFKANLEKA  232

>PHYRA_76657
Length=239

 Score = 183 bits (465),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 138/237 (58%), Gaps = 18/237 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWS  107
            E   I H++V+PFP+P+PVT ++K+ VK+KP+LKI  E GC  YPAV   G  SGGLK +
Sbjct  18   EAASIDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLKGT  77

Query  108  GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYA  167
                  CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG          R    RH+W  A
Sbjct  78   KGTSA-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWNRRAYWRHDWSNA  129

Query  168  IVWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLT  226
            +VWID+P LEN  +LG+S+S S   Y  +  P     +G +  L Y         +L L 
Sbjct  130  VVWIDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAALALY  188

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             A+G+ QDLI W +L+  AR +LN  D      N    ++P+ D  F + L KAWPF
Sbjct  189  YASGDVQDLIMWGQLTDAARAALNDQD------NFGRTEVPINDDHFLKHLEKAWPF  239

>PHYRA_75425
Length=237

 Score = 182 bits (462),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 136/232 (59%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+ V PF +P P T  Q  AVK+KPQ+ I +GCHPYPAV +DG+ SGGLK +G 
Sbjct  18   KAAVIDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            Q   CTGS LGSQIY R+     V+A MY+WY PK          L   GHRH+WE  +V
Sbjct  78   QSSGCTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLDGVGHRHDWENCVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L+   I+ +S S    Y    PP++ Y+DGDS K++Y  + +L   SL  T  +
Sbjct  131  WLDDITLDEPNIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVLLDHSLSATSTS  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L  TD+ +         +P K+  F+  L  A+
Sbjct  191  GETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKEANFETKLANAY  235

>PHYRA_84273
Length=237

 Score = 182 bits (462),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 134/233 (58%), Gaps = 18/233 (8%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             + H++V+PFP+P PVT S+KA VK+KPQL I  GC  YPAV   G  SGGLK SG   G
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPQLHITTGCTSYPAVNAAGETSGGLKGSGGTSG  80

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAIVWI  171
             C    LGSQ+Y R+ W NDV+AIMYAWYFPKG   A P          RH+W  A+VWI
Sbjct  81   -CMLPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDASPF--------WRHDWSNAVVWI  131

Query  172  DNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            DNP  +   ILG+S+S S   Y      E  + +G +  L  Y   +  +T L     +G
Sbjct  132  DNPAHKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSG  190

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            EFQDLI WD+L+  AR +LN  D      N    ++P+ D  F + L +AWPF
Sbjct  191  EFQDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKRLEEAWPF  237

>PPTG_17295
Length=238

 Score = 182 bits (461),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 136/232 (59%), Gaps = 17/232 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H+++ P P+P+PVT S+KAA+K+KPQL I DGC  +PAV   G  SGGLK S   +  
Sbjct  22   VDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFPAVNDGGDFSGGLKGSN-GNSA  80

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C  + +GSQ+Y R+ W ND WAIMYAW+FPKG         + +   R++W  A+VWIDN
Sbjct  81   CDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKG-------FFMGVASRRYDWSSAVVWIDN  133

Query  174  PELENSTILGVSMSASVG-YASQTP-PETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            P+     +LG+S S S   Y  ++P P+   ++G +  L    + + G   L  +  TG+
Sbjct  134  PDFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLLYRSISEVAGQPMLDYSSRTGD  193

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQ LI W++L+  AR +LN        F+    ++P  D  F+E L KA+PF
Sbjct  194  FQPLIMWEQLTDAARETLNT-------FDFGNAQVPFNDANFEEKLKKAYPF  238

>PPTG_11469
Length=253

 Score = 182 bits (462),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 138/248 (56%), Gaps = 31/248 (13%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQD  111
             + H++++PFP+PEPVT S+KAA+K+KPQL I +G C  YPAV   G  +GGLK S   D
Sbjct  20   TVDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGSNGND  79

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG         +     RH+W+  +VWI
Sbjct  80   A-CKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKG-------FWVGFPTRRHDWKSVVVWI  131

Query  172  DNPELENSTILGVSMSAS---------------VGYASQTPPETR-YVDGDSVKLKYYYN  215
            DNP+LE   I+GVSMS S                G+        R Y  G +  L++ Y 
Sbjct  132  DNPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRFGYQ  191

Query  216  HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDE  275
              LGS  L      GE+QDLI W++L+  AR +LN  +      N    ++P  D  +++
Sbjct  192  MELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALNDDN------NFEKAEVPFSDEHYED  245

Query  276  LLNKAWPF  283
             L+KAWP 
Sbjct  246  HLDKAWPL  253

>PHYRA_72385
Length=237

 Score = 181 bits (460),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 141/232 (61%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P P T  Q A +K+KPQ+ I +GCHPYPAV + G+ SGGLK +G 
Sbjct  18   QADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQIY R      V+A+MY+WYFPK     PV  +    GHRH+WE+ +V
Sbjct  78   SSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDS---PVTGL----GHRHDWEHVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L++ +I+ VS SA  GY    PPE+  +DG S K+ Y  + ++ + +L  T  +
Sbjct  131  WVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVVNHALDSTSDS  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L +TD+ +         +P+KDG F   L  A+
Sbjct  191  GESQDLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKLGNAY  235

>PHYRA_41766
Length=209

 Score = 180 bits (457),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 131/227 (58%), Gaps = 18/227 (8%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H +V+PF +P P T S+KA VK+KPQ++I  GC PYPAV   G  SGGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W+NDVW    +WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWX---SWYFPKDSPS-------SGMGHRHDWEHVVVFIDN  110

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            P++    I+G S S+  GY    P     +DG SVK++Y ++  + +  L +T   G FQ
Sbjct  111  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPI-NHDLDVTGDAGTFQ  169

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            DLI WD++++ AR +LN         +      P+ DG F   L KA
Sbjct  170  DLIMWDQMTEDARRALNGV-------HFGDANTPMNDGNFIPKLEKA  209

>PPTG_17453
Length=254

 Score = 181 bits (460),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/248 (41%), Positives = 139/248 (56%), Gaps = 31/248 (13%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQD  111
             + H+++ PFP+PEP T S+KAAVK+KPQL   +  C PYPAV   G ++GGLK +   D
Sbjct  21   TVDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPYPAVNVAGEVAGGLKGTNGND  80

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C  +  GSQIY R+ W ND+WAIMYAWYFPKG         +     RH+W+  +VWI
Sbjct  81   A-CKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKG-------FWMDSPSRRHDWKSVVVWI  132

Query  172  DNPELENSTILGVSMSAS---------------VGYASQTPPETR-YVDGDSVKLKYYYN  215
            DNPE +   I+GVSMS S                GY  +     R Y+ G +  L++ Y 
Sbjct  133  DNPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEGRRYHRTYIYGSNTSLRFQYQ  192

Query  216  HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDE  275
              LGS  L   +  GE+QDLI W++L+  AR +LN  +      N    ++P  D  +++
Sbjct  193  SDLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALNDGN------NFGDAEVPFSDEHYEK  246

Query  276  LLNKAWPF  283
             L+KAWPF
Sbjct  247  HLDKAWPF  254

>HYAP_07436
Length=267

 Score = 182 bits (461),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 135/230 (59%), Gaps = 14/230 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H++++PF E EP T ++KA V++KPQ+K  DGCH Y AV   G  SGGLK  G  +G+
Sbjct  48   LPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGK  107

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQIY RS    + WAIMYA YFPK      + ++ R  G+RH +E+ IVWID+
Sbjct  108  CKGSGFGSQIYGRSAPFGNKWAIMYALYFPKD-----MKVLNR--GYRHAFEHVIVWIDD  160

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
              L++  IL V+   +  Y     P+ R +DGDSVKL Y    L G   L  +   GEFQ
Sbjct  161  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  220

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             LI W++L+  AR +L   +W          KMPL D  F+E L +AWPF
Sbjct  221  PLIMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>PPTG_13026
Length=238

 Score = 180 bits (457),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 132/231 (57%), Gaps = 15/231 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            +  N+V P  +P P T +QKAA+K+KP+L I +GC  +PAV   G  S GL+        
Sbjct  22   VDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSSG  81

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CT + LGSQ+Y R+ W N  +AI+Y WYFPKG               RH+W  A+VWIDN
Sbjct  82   CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKG-------FWNEYATRRHDWASAVVWIDN  134

Query  174  PELENSTILGVSMS-ASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            PEL + +ILG+S+S A   + +  P  +   DG + +L +  N   G   L  T+  G+F
Sbjct  135  PELASPSILGLSVSTADWKFKTFAPASSGITDGTTPRLAHVLNVEKGYPYLTTTDTVGDF  194

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            Q+LI WD+L+  AR +LN TD     F +A  K+P+ D  FD  L KAWPF
Sbjct  195  QELIMWDQLTTAARTALNTTD-----FGVA--KVPVSDAAFDTKLKKAWPF  238

>HYAP_07925
Length=267

 Score = 181 bits (459),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 135/230 (59%), Gaps = 14/230 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            + H++++PF E EP T ++KA V++KPQ+K  DGCH Y AV   G  SGGLK  G  +G+
Sbjct  48   LPHDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGK  107

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQIY RS    + WAIMYA YFPK      + ++ R  G+RH +E+ IVWID+
Sbjct  108  CKGSGFGSQIYGRSAPFGNKWAIMYALYFPKD-----MKVLNR--GYRHAFEHVIVWIDD  160

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
              L++  IL V+   +  Y     P+ R +DGDSVKL Y    L G   L  +   GEFQ
Sbjct  161  IALKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQ  220

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             LI W++L+  AR +L   +W          KMPL D  F+E L +AWPF
Sbjct  221  PLIMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>PHYCA_576423
Length=234

 Score = 179 bits (455),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 131/229 (57%), Gaps = 16/229 (7%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            VI H+QV PF +P P T  Q  A+++KPQ+ I +GCHPYPAV  DG+ SGGLK +G Q  
Sbjct  20   VIDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPTGSQSA  79

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLDGQGHRHDWENCVVWLD  132

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            +  L+  +I+ +S S    Y    PP + Y+DG+S K++Y  + ++   SL  T   GE 
Sbjct  133  S--LDRPSIVALSASYHSTYNYYYPPSSSYLDGNSAKIQYSTSWIVLDHSLSATSTAGEI  190

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            QDLI WD+L+  AR +L  TD+           +P K+  F   L KA+
Sbjct  191  QDLIMWDQLTDAARTALEDTDF-------GSANVPFKEDNFIAKLAKAY  232

>PHYSO_527850
Length=195

 Score = 178 bits (451),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 113/174 (65%), Gaps = 9/174 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PFPE EPV  S+KAAVK+KPQL+I  G H YPAV++DG++S GLKW G  DGE
Sbjct  20   INHDEVQPFPELEPVGASEKAAVKFKPQLQISYGFHTYPAVRRDGAVSNGLKWGGKPDGE  79

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W    WAIMYAWYFPK            L  HRH W Y +VWIDN
Sbjct  80   CKGSAWGSQVYTRSDWYQGKWAIMYAWYFPKAWQEN------DLISHRHLWLYIVVWIDN  133

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTE  227
            PE  N  +LGV +  + G   + PP+ ++ +G S+K +YY +   G T LQ T+
Sbjct  134  PEAVNPAVLGVYVRTAGGSERRAPPDAKFFEGSSLKSEYYKS---GKTGLQRTD  184

>PHYSO_560790
Length=237

 Score = 179 bits (455),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 134/234 (57%), Gaps = 18/234 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
               VI H+QV PF +P P T  Q+AAVKYKPQ+ I +GCHPYPAV  +G+ SGGL  +G 
Sbjct  18   SASVINHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYPAVDNNGNTSGGLNPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEY--A  167
            +   C GS  G+QIY R+     V+A MY+WY PK          L   GHRH+WE    
Sbjct  78   ESAGCKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKDE-------TLTGLGHRHDWEACNC  130

Query  168  IVWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTE  227
            +VW+D+  L+N +I+ +S S    Y    PP++ Y+DG+S K++Y  + ++   SL  T 
Sbjct  131  VVWLDS--LDNPSIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATS  188

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
              GE QDLI WD+L+  AR +L  TD+ +         +P K+  F+     A+
Sbjct  189  TAGETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKEANFETKRANAY  235

>PHALS_14425
Length=302

 Score = 181 bits (460),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 137/231 (59%), Gaps = 12/231 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            +G + V PFP  +  T SQK+A+ ++PQL IEDGCHPYPAVQ +GS++ GL++   +D  
Sbjct  81   LGADSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELFRDPT  140

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRG-AVPVPLILRLFGHRHNWEYAIVWID  172
            C GS LGSQ+Y+RS W    WA +Y WYFP     A P        GHRH W +AIVW  
Sbjct  141  CEGSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHASPFST-----GHRHYWLWAIVWTT  195

Query  173  NPELENSTILGVSMSASVGYASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            +P       L VSMS + G +S T P  ++ V+G +V LK + + +    +L LTE +GE
Sbjct  196  DPNPAEGHFLAVSMSGNFGISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGE  255

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWP  282
             +DLITW+EL+  AR +L+     E   N      PL+D  F  LL KA+P
Sbjct  256  KEDLITWEELTPEARAALSSVKRTEATAN-----SPLQDNKFFSLLEKAYP  301

>PHYSO_254099
Length=235

 Score = 179 bits (454),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 129/233 (55%), Gaps = 28/233 (12%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV PF + E    S+KAA+K+KPQL+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEAANASEKAAIKFKPQLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  114  CTGSKLGSQIYA-----RSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAI  168
              GS LGSQ+Y+     R +    V AI                           W Y +
Sbjct  84   YQGSGLGSQVYSARPGTRYERREQVSAIATC-----------------------GWLYMV  120

Query  169  VWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEA  228
            +WIDNPE  N  ILGV +    G   + PP+ +++DG S+KL YY       T LQLT+ 
Sbjct  121  IWIDNPEAINPAILGVCVRTEGGNEQRVPPDAKFLDGSSLKLDYYKRTWHRKTGLQLTKD  180

Query  229  TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
             GEFQDL+TW+++++ AR +L   D+D+       L +P  DG F   L KAW
Sbjct  181  KGEFQDLVTWEQMTEEARITLTEADFDDHWQERNDLDVPFIDGEFTVNLEKAW  233

>PHYCA_129892
Length=234

 Score = 178 bits (452),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 136/229 (59%), Gaps = 16/229 (7%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            VI H+QV PF +P P T  Q  AV+YKPQ+ I +GCHPYPAV +DG+ SGGLK +G Q  
Sbjct  20   VIDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSQSA  79

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWEACVVWLD  132

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            +  LEN  ++ +S S    Y +  PP++ Y+DG+S K++Y  + ++   SL  T  +GE 
Sbjct  133  S--LENPNVVALSASYHSTYLTYYPPDSGYLDGNSAKIEYSTSWVILDHSLSATSTSGET  190

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            QDLI WD+L+  AR +L  TD+ +         +P KD  F+  L  A+
Sbjct  191  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDANFETKLANAY  232

>PHYRA_71310
Length=237

 Score = 179 bits (453),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 140/232 (60%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+QV PF +P P T  Q A +K+KPQ+ I +GCHPYPAV + G+ SGGLK +G 
Sbjct  18   QADVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
                C GS  GSQIY R      V+A+MY+WYFPK     PV  +    GHRH+WE+ +V
Sbjct  78   SSAGCKGSGYGSQIYGRITTYEGVYALMYSWYFPKDS---PVTGL----GHRHDWEHVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L++ +I+ VS SA  GY    PPE+  +DG S K+ Y  + ++ + +L  T  +
Sbjct  131  WVDDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVVNHALDSTSDS  190

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI W +L+  AR +L +TD+ +         +P+KDG F   L  A+
Sbjct  191  GESQDLIMWGQLTDAARTALGNTDFGDA-------HVPMKDGNFLTKLGNAY  235

>PPTG_07991
Length=276

 Score = 179 bits (455),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 135/234 (58%), Gaps = 30/234 (13%)

Query  53   VIGHNQVRPF--PEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
             I ++QV PF   +P   T ++KAA+K++P+L + +GCHPYPAV   G +S GL+ +   
Sbjct  69   TIAYDQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKADAT  128

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            D EC+GSKLG+Q+Y RS W   VWAIMYAWYFP                   +WE+ IVW
Sbjct  129  DAECSGSKLGTQVYGRSAWFGRVWAIMYAWYFPD---------------VSPDWEHVIVW  173

Query  171  IDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
             +NP + N  IL V+ S S G Y+SQ PP+   + G SVK+ Y  N      +L+ T   
Sbjct  174  TNNPNVTNQVILAVTTSDSTGKYSSQVPPDASMISGKSVKIAYNNN------ALESTTKE  227

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G  Q+L+ W +L+  A+ +LN    D+  F   G+++P+ D  F   L KAWPF
Sbjct  228  GGAQNLVLWHQLTPEAQEALN----DDQSF--GGVQVPVNDDYFLLNLGKAWPF  275

>PPTG_08703
Length=254

 Score = 179 bits (453),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 136/248 (55%), Gaps = 31/248 (13%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI-EDGCHPYPAVQKDGSISGGLKWSGPQD  111
             + H+++ P P+PEPVT SQKAA+K+KPQL   E  C  +PAV   G ++GGLK +   D
Sbjct  21   TVDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSFPAVNAAGEVTGGLKGTNGND  80

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG         +     RH+W+  +VWI
Sbjct  81   A-CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKG-------FWMDFPTRRHDWKNVVVWI  132

Query  172  DNPELENSTILGVSMSAS---------------VGYASQTPPETR-YVDGDSVKLKYYYN  215
            DNP+LE   I+GVSMS S                GY  +     R Y+ G +  L++ Y 
Sbjct  133  DNPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEGRRYHRTYIYGSNTSLRFQYQ  192

Query  216  HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDE  275
              LGS  +      GE+QDLI W++L+ + R +LN +       N    ++P  D  F++
Sbjct  193  TTLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALNDSK------NFGKAEVPFSDEHFED  246

Query  276  LLNKAWPF  283
             L+KAWP 
Sbjct  247  HLDKAWPL  254

>PHYSO_423056
Length=233

 Score = 178 bits (451),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 130/222 (59%), Gaps = 26/222 (12%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+K AVK+KP L+I+ GCHPYPAV   G  S GLK SGP DG+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGPDDGK  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +G   +       G RH W  A+VW+DN
Sbjct  61   CKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGFGGI----LAKGQRHKWVSAVVWLDN  116

Query  174  PELENSTILGVSM-SASVGYA--SQTPPET----------RYVDGDSVKLKY--YYN---  215
            P +E   IL +S  +   GY      PPE            Y++  +  L Y  Y+    
Sbjct  117  PAVETPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDS  176

Query  216  -HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256
             H L  T+ +    TGE QDL+ W++LS+ AR +L   D+ E
Sbjct  177  FHTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGE  215

>PPTG_14652
Length=257

 Score = 179 bits (453),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 134/232 (58%), Gaps = 18/232 (8%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+ V+PF +PEP+T ++KAAVK+KP L ++ GCHPYP V   G  S GL+ +GP DG 
Sbjct  20   INHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTGPPDGG  79

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPVPLILRLFGHRHNWEYAIVW  170
            C G +LGSQ+Y+RS W  D WAIMYAWYFPK    RG V         G RH+W   +VW
Sbjct  80   CEGPELGSQVYSRSTWCEDKWAIMYAWYFPKDIQNRGLVKT-------GVRHDWVNLVVW  132

Query  171  IDNPELENSTILGVSMSASVG-YASQTPPETR-YVDGDSVKLKYYYNHLLGSTSLQLTEA  228
            +DNP L    +L  S S     Y    PP+T   ++G + KL+Y  +      ++     
Sbjct  133  LDNPALVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHE  192

Query  229  TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
             GE+QDLI W++L+  AR +L +TD     F + G  +P  D  F+  L +A
Sbjct  193  EGEYQDLIQWNQLTDAAREALTNTD-----FGVFG-HVPFIDAFFETNLKEA  238

>PHYCA_553546
Length=280

 Score = 179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 140/272 (51%), Gaps = 57/272 (21%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PFP+PEPVT S+KAAVKYKPQL+I DGC  +PAV   G I+GGLK  G +D 
Sbjct  25   TIDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLK--GTKDT  82

Query  113  E-CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            E CT + LGSQ+Y RS W  D WA+MY+WYFPK   A            RH+W   ++WI
Sbjct  83   EACTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCAYKA-------AGRHDWANVVIWI  135

Query  172  DNPELENSTILGVSMSAS-----------VGYASQTPPET-------------RYVDGDS  207
            DNP  EN T LG S+S             +G  ++ P +              R   G  
Sbjct  136  DNPAAENVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRV  195

Query  208  VKLKYYYNHLLGSTS----------------LQLTEATGEFQDLITWDELSKLARYSLNH  251
             +  Y Y ++ GS +                +   ++ GE QDLI W++L+  AR +L  
Sbjct  196  GRWSYTYKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALES  255

Query  252  TDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             D+ +T       ++P  D  FD  L  AWPF
Sbjct  256  ADFGDT-------QVPFTDKNFDTNLQAAWPF  280

>PHYCA_123797
Length=241

 Score = 178 bits (451),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 131/234 (56%), Gaps = 30/234 (13%)

Query  53   VIGHNQVRPFP--EPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
             I +++V PFP  +P   T ++KAA+K++P+LK+ +GCHPYPAV   G +S GL+ + P 
Sbjct  34   TIAYDKVVPFPMAQPSESTVTEKAAIKFRPKLKVVNGCHPYPAVNAAGQVSNGLEVADPT  93

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
               C GSKLG+Q+Y RS W   VWAIMYAWYFP                   +WE+ IVW
Sbjct  94   GAACKGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVTA---------------DWEHVIVW  138

Query  171  IDNPELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
             +NP + N  +L V+ S S  GY SQ PP+   + G SVK+ Y  N       L+ T   
Sbjct  139  TNNPNVTNQVVLAVTTSNSKGGYTSQVPPDATMMSGKSVKVSYNNN------GLESTTEE  192

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            G  Q+LI W +L+  A+ +LN         N  G+++P+ D  F   L KAWPF
Sbjct  193  GGAQNLILWHQLTAAAQEALNDDQ------NFDGVQVPVNDDYFLLNLGKAWPF  240

>PYVX_22469
Length=474

 Score = 184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 135/234 (58%), Gaps = 15/234 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+ V  F +P P T S++ A+ YKPQL I +GCHPYPAV  DG+ SGGLK +G 
Sbjct  18   QAAVINHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYPAVDADGNTSGGLKPTGA  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            QD +C GS LG+QIY R+   N V+AIMY+WY PK          L   GHRH WE  +V
Sbjct  78   QDSDCKGSALGTQIYGRATEYNGVYAIMYSWYMPKDSP-------LSGLGHRHEWENVVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+    + +I+ VS SA   Y    PP +  V+G S K+K Y + ++ + SL +T  +
Sbjct  131  WLDSATASSPSIVAVSPSAHGNYHIYNPPSSSNVNGTSAKVK-YESQVVINHSLDITTVS  189

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            GE Q LI +++LS+ AR +L  TD+           +P K+  F   L  A P 
Sbjct  190  GETQPLILYEQLSEAARQALETTDF-------GSATVPFKNTTFTANLALASPI  236

 Score = 175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 132/232 (57%), Gaps = 14/232 (6%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI H+ V PF +P P T  Q AAVK+KP L I++GCHPYPAV +DG+ SGGLK +G 
Sbjct  255  DAAVIDHDAVVPFAQPTPNTTEQSAAVKFKPTLYIDNGCHPYPAVDEDGNTSGGLKPTGS  314

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
              G CTGS LGSQIY R    + VWAIMY+WY PK     P P I    GHRH+WE A++
Sbjct  315  TTGGCTGSSLGSQIYGRVMEYDGVWAIMYSWYMPKDE---PSPYI----GHRHDWENAVI  367

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+    + +I+ +S S   GY    PP   Y  G + K+KY     L    L  T   
Sbjct  368  WVDDITSASPSIVAISASEHSGYKVYYPPSADYYSGYTAKIKYESVFFLVDHCLYATSTA  427

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  A+ +L  TD+           +P K+  F   + KA+
Sbjct  428  GETQDLIMWDQLTAAAQTALEDTDF-------GSANVPFKEANFATKVAKAY  472

>PITG_23228
Length=254

 Score = 178 bits (452),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 141/247 (57%), Gaps = 31/247 (13%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI-EDGCHPYPAVQKDGSISGGLKWSGPQDG  112
            I H++V+PF +P PVT S+KAA+ +KPQL   +  C P+PA    G I+GGLK S   D 
Sbjct  22   IDHDKVQPFSQPTPVTISEKAAITFKPQLYTPKSVCVPFPAANAYGEITGGLKGSNGNDA  81

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C    LGSQ+Y R  W  DVWAIMYAWYFPKG         +     RH+W+  +VWID
Sbjct  82   -CVFPPLGSQVYGRVGWFRDVWAIMYAWYFPKG-------FWMGFVSRRHDWKNVVVWID  133

Query  173  NPELENSTILGVSMSAS---------------VGYASQTPPETR-YVDGDSVKLKYYYNH  216
            NP LE   ILGVSMS S                G+        R Y+ G +  L++YY+ 
Sbjct  134  NPGLEEPKILGVSMSKSETKYTKERRLWPSNFAGFYRMGRRYDRSYIYGFNTFLRFYYHF  193

Query  217  LLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDEL  276
             +G+ +L L+E  GE+QDLI W++L+ +AR +LN ++      N   +++P+ D  F+  
Sbjct  194  DVGTPNLYLSEWEGEYQDLIMWEQLTDVARAALNGSN------NFEEVEVPISDEHFETR  247

Query  277  LNKAWPF  283
            L++AW F
Sbjct  248  LDEAWLF  254

>PHYSO_365942
Length=233

 Score = 177 bits (450),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 126/223 (57%), Gaps = 28/223 (13%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+K AVK+KP L+I  GCHPYPAV   G  S GLK  GP+DGE
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGPKDGE  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +G   +       G RH W  A+VW+DN
Sbjct  61   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGYGSI----LAKGQRHKWVSAVVWLDN  116

Query  174  PELENSTILGVSM-SASVGY--ASQTPPETRYVDGDSVKLKYYYN---------------  215
            P LE   IL +S  +   GY      PP+      D+ K   Y N               
Sbjct  117  PALETPKILAISTWNVEGGYDILKNEPPQCYRYSCDA-KFAEYINMTTPMLSYERCRPEP  175

Query  216  --HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256
              H L  T+ +    TGE QDL+ W++LS+ AR +L   D+ E
Sbjct  176  SYHTLRPTTAR---GTGELQDLVMWEQLSEEARIALGEADFGE  215

>PHYRA_72531
Length=236

 Score = 177 bits (450),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 136/238 (57%), Gaps = 23/238 (10%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +   IGH++V+PFP+PE VT ++K+ VK+KPQL IE GC PYPAV   G  S GL+ +G 
Sbjct  18   DAVAIGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGV  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
             D  C    L SQ+Y R++W NDVWAIMYAWYFPKG     P          RH+W  A+
Sbjct  78   FD--CIIPSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP--------WWRHDWSNAV  127

Query  169  VWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTE  227
            VWIDNP  E   +LG+S+S S   Y +   P     +G +  L     ++L   S  L  
Sbjct  128  VWIDNPAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLS---RNVLPMRSAALGP  184

Query  228  AT--GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            A   GEFQDL+ WD+L+  AR +LN  D      N    ++P+ D  F + L KAWPF
Sbjct  185  AVNPGEFQDLVMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLKKAWPF  236

>PHYRA_72403
Length=239

 Score = 177 bits (448),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 136/237 (57%), Gaps = 18/237 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWS  107
            E   I H++V+PFP+P+PVT ++K+ VK+KP+L I  E GC  YPAV   G  SGGLK +
Sbjct  18   EAASIDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGT  77

Query  108  GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYA  167
                  CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG          R +  RH+W  A
Sbjct  78   KGTSA-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDS------RAYW-RHDWSNA  129

Query  168  IVWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLT  226
            +VWID+P LEN  +LG+S+S S   Y  +  P     +G +  L Y          L   
Sbjct  130  VVWIDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYECAELVPY  188

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             A+GE QDLI WD+L+  AR +LN  D      N    ++P+ D  F + L KAWP 
Sbjct  189  YASGEVQDLIMWDQLTDAARAALNDQD------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYSO_521124
Length=254

 Score = 176 bits (447),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 137/248 (55%), Gaps = 31/248 (13%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +G VI +++V+PFPE EP T S+KAA+KYKP L I DGCH Y AV   G  SGG+    P
Sbjct  7    QGAVIDYDKVQPFPELEPKTISEKAAIKYKPSLAIWDGCHSYAAVNAAGDTSGGMDPKAP  66

Query  110  QDGE---------CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG-----RGAVPVPLIL  155
              G          C GS LGSQ+Y+RS W  DVWAIMYAWYFP+        + PV    
Sbjct  67   DGGTQVQNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEESSPPV----  122

Query  156  RLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQTPPETR-YVDGDSVKLKYYY  214
                 RH+W   IVW+DNP LEN ++LGVS S         PP  + Y++G   K++YY 
Sbjct  123  -----RHDWINTIVWLDNPALENPSLLGVSASREGAVYVTYPPTVKGYMNGTHPKMEYYL  177

Query  215  NHLLGS-TSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVF  273
              ++G   ++ ++   G+FQDL+ W +L+  AR +L   D+           +P  D  F
Sbjct  178  GFIVGGYHTIDVSLEAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNF  231

Query  274  DELLNKAW  281
            ++ L + W
Sbjct  232  EKNLERGW  239

>PHYRA_83851
Length=239

 Score = 176 bits (445),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 135/238 (57%), Gaps = 20/238 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H++V+PFP+P+PVT S+KA VK+KPQL  E GC  YPAV   G  SGGLK +G 
Sbjct  18   EAVSIAHDEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLKGNGD  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
              G C  S LGSQ+Y RS+W NDVWAIMYAWYFPKG   A P          RH+W  A+
Sbjct  78   ISG-CEISLLGSQVYGRSEWYNDVWAIMYAWYFPKGFWDADP--------HWRHDWSNAV  128

Query  169  VWIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEA  228
            +WIDNP LEN  ILG+S+S S          +  ++  +  L       + S +L  ++ 
Sbjct  129  LWIDNPALENPKILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPS-VASAALVSSDV  187

Query  229  TG---EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             G   E QDLI W +L+  AR +LN  D      N    ++P+ D  F + L +AWP 
Sbjct  188  CGRPLETQDLIMWGQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLEEAWPL  239

>PHYRA_52427
Length=124

 Score = 172 bits (435),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 95/132 (72%), Gaps = 8/132 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR              RH WE A+VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRST--------RHQRRHFWETAVVWIDD  112

Query  174  PELENSTILGVS  185
            P L NSTILGVS
Sbjct  113  PALANSTILGVS  124

>PHYKE_208
Length=187

 Score = 174 bits (440),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 102/151 (68%), Gaps = 7/151 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV PF +PE  T S+KAAVK+KPQ+ + +GCHPYPAV   G  SGGLK +G   G 
Sbjct  22   ISHDQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYPAVNSAGDTSGGLKPTGAPSGS  81

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQ+Y RS W +  WAIMY+WYFPK   +  +       GHRH+WE+ +VWIDN
Sbjct  82   CKGSGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTGL-------GHRHDWEHVVVWIDN  134

Query  174  PELENSTILGVSMSASVGYASQTPPETRYVD  204
            P++EN TILGVS SA  GY+   PP +  VD
Sbjct  135  PDVENPTILGVSPSAHSGYSKYVPPSSDTVD  165

>PHYCA_109174
Length=277

 Score = 176 bits (447),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 142/276 (51%), Gaps = 60/276 (22%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G  IGH++V+PF +P+PVT S+KAAVKYKPQL+I D C  +PAV   G I+GGLK +   
Sbjct  19   GATIGHDKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLKGTKGT  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPVPLILRLFGHRHNWEYA  167
            DG CT + LGSQ+Y RS W  D WA+M+AWYFPK   G GA            RH W   
Sbjct  79   DG-CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNFWGGGA----------KSRHLWANM  127

Query  168  IVWIDNPELENSTILGVSMSA-----------SVGYASQTP-------PETRYVDGDSV-  208
            ++WIDNP LE   ILG S+S            S+G   + P       P   +V   ++ 
Sbjct  128  VLWIDNPALETPKILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQ  187

Query  209  -----KLKYYYNHLLGS----------------TSLQLTEATGEFQDLITWDELSKLARY  247
                 + +Y YN+  GS                 SL      GE+QDLI W++L+  AR 
Sbjct  188  TSRISRFRYTYNYTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARA  247

Query  248  SLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            +L   D+ E        K+P  D  F+  L +AWPF
Sbjct  248  ALESADFGED------TKVPFNDKNFEAALAQAWPF  277

>PHYSO_504553
Length=257

 Score = 176 bits (445),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 136/245 (56%), Gaps = 27/245 (11%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+K AVK+KP L I DGCHPYPAV   G  S GLK SG  DG+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGLKGSGRIDGK  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +    V  + +  G RH W  A+VW+DN
Sbjct  84   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDK----VDFLNK--GQRHKWVSAVVWLDN  137

Query  174  PELENSTILGVSM-SASVGY--ASQTPPET----------RYVDGDSVKLKYYYNHLLGS  220
            P +E   IL +S  +   GY      PPE            Y++  +  L Y  +     
Sbjct  138  PAVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRSLEEPV  197

Query  221  TSLQLTEA--TGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLN  278
             +L+ T A  TGE QDL+ W++LS+ AR +L   D+ E         +P  D   +  L 
Sbjct  198  HTLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGEK------SPVPFIDTNLNANLE  251

Query  279  KAWPF  283
             A PF
Sbjct  252  AARPF  256

>PHYSO_365377
Length=220

 Score = 174 bits (442),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 130/227 (57%), Gaps = 17/227 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I ++QV PFPE  P T S+KAA+K+KP L I+DGCHPY AV   G  SGGL      D E
Sbjct  1    IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGLD-PKASDDE  59

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+Y+RS W  + WA MYAWYFPK          L L G RH+W  AIVW+DN
Sbjct  60   CKGSTLGSQVYSRSTWYRNTWATMYAWYFPKDTN-------LYLRGVRHDWVSAIVWLDN  112

Query  174  PELENSTILGVSMSA-SVGYASQTPPETR----YVDGDSVKLKY-YYNHLLGSTSLQLTE  227
            P L N T++GVS S+    Y       +R    YVDG   K++Y   +   G  ++  +E
Sbjct  113  PALANQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASE  172

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETL---FNLAGLKMPLKDG  271
              G+FQDLI W +L++ AR +L   D+       FN A  K  L+ G
Sbjct  173  DVGDFQDLIHWSQLTEEARNALETGDFGSDTPVPFNNANFKKNLERG  219

>PPTG_00471
Length=239

 Score = 174 bits (440),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 130/227 (57%), Gaps = 13/227 (6%)

Query  56   HNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  115
            H++V+PF +PEP+T ++KAA+KYKP L ++ GCHPYPAV   G  S GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPDGECE  81

Query  116  GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPE  175
            GS LGSQ+Y+RS W    WAIMYAWYFPK      V LI +  G RH+W   +VW+DNP 
Sbjct  82   GSPLGSQVYSRSTWYEGKWAIMYAWYFPK--DIKDVGLIKK--GLRHDWVNLVVWLDNPA  137

Query  176  LENSTILGVSMSASVGYASQTPPETR--YVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQ  233
            L    IL  + S    Y   + P  R   ++G + K+ Y  +   G  ++      GE+Q
Sbjct  138  LAKPKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQ  197

Query  234  DLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            DLI W++L+  AR +  + D+ E         +P  D  F+  L  A
Sbjct  198  DLIQWNQLTDAAREAFENGDFGEA-------NVPFNDAYFETNLKSA  237

>PHYRA_52260
Length=234

 Score = 174 bits (440),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 135/234 (58%), Gaps = 19/234 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   + +++V+PFP+P+PVT ++K+ VK+KPQL IE GC  YPAV   G I+GGL  SG 
Sbjct  18   EALSVDYDKVQPFPQPDPVTTTEKSGVKFKPQLDIEYGCSSYPAVNAAGDINGGLPTSGI  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
             D  C  +  GSQ+Y R++W NDVWAIMYAWYFPKG   A P          RH+W  A+
Sbjct  78   AD--CQFALGGSQVYGRAEWYNDVWAIMYAWYFPKGFWDAAPY--------WRHDWSNAV  127

Query  169  VWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTE  227
            VWIDNP LEN  ILG+S+S S   Y +   P     +G +  L      +  +  L+ + 
Sbjct  128  VWIDNPALENPKILGLSLSTSENKYGNTYVPAEAIENGTTPTLNRNL-PVFRAAELRPST  186

Query  228  ATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
              GEFQDLI W +L+  AR +LN  D           ++P+ D  F + L +AW
Sbjct  187  NRGEFQDLIMWGQLTDAARAALNDQD------TFGRTEVPISDDHFPKRLEEAW  234

>PHYRA_76603
Length=239

 Score = 173 bits (439),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 133/237 (56%), Gaps = 18/237 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWS  107
            E   I H++V+PFP+P+PVT ++K+ VK+KP+L I  E GC  YPAV   G  SGGLK +
Sbjct  18   EAASIDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLKGT  77

Query  108  GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYA  167
                  CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG          R    RH+W  A
Sbjct  78   KGTSA-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDRRAYWRHDWSNA  129

Query  168  IVWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLT  226
            +VWID+P LEN  +LG+S+S S   Y  +  P     +G +  L Y          L   
Sbjct  130  VVWIDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPY  188

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             A+GE QDLI W +L+  AR +LN         N    ++P+ D  F + L KAWP 
Sbjct  189  YASGEVQDLIMWGQLTDAARAALNDQG------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYCA_124462
Length=280

 Score = 175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/276 (37%), Positives = 138/276 (50%), Gaps = 65/276 (24%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             IGH+QV+PFP+PEPVT S+KAAVKYKP L I +GC  +PAV   G I+GGLK  G +D 
Sbjct  25   TIGHDQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLK--GTKDT  82

Query  113  E-CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGH----RHNWEYA  167
            E CT + LG+Q+Y RS W  D WA+MY+WYFPK              GH    RH+W   
Sbjct  83   EDCTEAPLGTQVYGRSTWFQDKWAMMYSWYFPK-----------NFCGHKAADRHDWANV  131

Query  168  IVWIDNPELENSTILGVSMSAS--------------------------------------  189
            ++WIDNP LEN+T LG S+S                                        
Sbjct  132  VIWIDNPALENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIV  191

Query  190  VGYASQTPPETRYVDGDSVKLKYYYNHLLGST--SLQLTEATGEFQDLITWDELSKLARY  247
             G  S+     +YV G +  +++ + +   S    +    + GE QDLI W++L+  AR 
Sbjct  192  TGRVSRHSYTYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARA  251

Query  248  SLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            +L   D+  T       ++P  D  F+  L  AWPF
Sbjct  252  ALESADFGNT-------QVPFTDKNFETNLQAAWPF  280

>PHYCA_544885
Length=256

 Score = 174 bits (440),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 145/250 (58%), Gaps = 33/250 (13%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI-EDGCHPYPAVQKDGSISGGLKWSGPQD  111
             + H+Q+ PFP+PEPVT S+KAA+K+KPQL   +  C P+PAV   G ++GGLK +   D
Sbjct  21   TVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIVCVPFPAVNAAGEVTGGLKGTNGND  80

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C  +  G+QIY R+ W  D+WAIMY+WYFPKG G    P        RH+W+  +VWI
Sbjct  81   G-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT------RRHDWKNVVVWI  133

Query  172  DNPELENSTILGVSMSAS---------------VGYASQTPPETR--YVDGDSVKLKYYY  214
            DNP+LE   I+GV+MS S               VGY ++    +R  Y+ G +  L++ Y
Sbjct  134  DNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYL-GSNTSLRFEY  192

Query  215  NHL-LGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVF  273
            +   +G+  +      GE+QDLI W++L+  AR +LN    D   F  A  ++P  D  +
Sbjct  193  DTSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----DGKSFGKA--EVPFNDEHY  246

Query  274  DELLNKAWPF  283
            ++ L KAWPF
Sbjct  247  EDHLGKAWPF  256

>PITG_23211
Length=245

 Score = 173 bits (439),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 131/229 (57%), Gaps = 12/229 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+ V+PF +PEP T ++K AVK+KP L ++ GCHPYP V   G    GLK +G  DGE
Sbjct  6    IDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGE  65

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            CTGS LGSQ+Y+RS    + WAIMYAWYFPK      + LI +  G RH+W   +VW+DN
Sbjct  66   CTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQN--IGLIKK--GVRHDWVNLVVWLDN  121

Query  174  PELENSTILGVSMSA-SVGYASQTPPE-TRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
            P L   TIL  S S     Y    PP+ +  ++G + K++Y  +   G  ++      GE
Sbjct  122  PTLAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHEEGE  181

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            +QDLI W +L+  AR +L +TD+ +         +P  D  F+  +  A
Sbjct  182  YQDLIQWTQLTDAAREALENTDFGDF------ANVPFNDAYFETNVKAA  224

>PHYSO_334500
Length=235

 Score = 172 bits (437),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 136/232 (59%), Gaps = 16/232 (7%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
             G VI H+ V PF +P P T  Q  AVK+KPQ+ I +GCHPYPAV +DG+ SGGLK +G 
Sbjct  18   SGAVIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYPAVDEDGNTSGGLKPTGS  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
            +    TGS LGSQIY R+     V+A MY+WY PK          L   GHRH+WE  +V
Sbjct  78   ESSGYTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWEACVV  130

Query  170  WIDNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            W+D+  L++ +I+ +S S    Y +  PP++ Y+DG+S K++Y  + ++   SL  T   
Sbjct  131  WLDS--LDDPSIVALSASYHSTYLTYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTA  188

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            GE QDLI WD+L+  AR +L  TD+           +P K+  F   + KA+
Sbjct  189  GETQDLIMWDQLTDAARTALEDTDF-------GSANVPFKEANFATKVAKAY  233

>PHYSO_254223
Length=227

 Score = 172 bits (436),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 133/234 (57%), Gaps = 41/234 (18%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H+QV+ FP+PEPVT  +K AVKYKPQL I +GCHPYPAVQ D                
Sbjct  24   IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQAD----------------  67

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
                     +Y+RS W    W IMYAWYFPKGR            GHRH WE  +VW+DN
Sbjct  68   ---------VYSRSDWYRGKWTIMYAWYFPKGRACKDDFKT----GHRHFWEDVVVWVDN  114

Query  174  PELENSTILGVSMSASVGYASQTPPETRYV-DGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            P  +NST+LGV M A   +    P + +Y+ DG +VK   Y +  LG+  + LTE  GE 
Sbjct  115  PNPDNSTLLGVPMYAGHRHIKVVPVDEKYLKDGKTVKFGSYKS--LGAQVVGLTEDYGEI  172

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAG----LKMPLKDGVFDELLNKAWP  282
            QDLITW++L+  AR +L+     E  F++ G    + +P+KDG F++ L  A+P
Sbjct  173  QDLITWEQLTVEARTALS-----EANFHVDGGVREVVVPIKDGQFEKTLESAYP  221

>PITG_00957
Length=298

 Score = 174 bits (441),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 131/231 (57%), Gaps = 16/231 (7%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +P+P+T  +KAAVK+KP L +  GCHPYPAV   G  S GLK +G  DG 
Sbjct  58   IDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGTGEPDGG  117

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG--RGAVPVPLILRLFGHRHNWEYAIVWI  171
            C GS+LGSQ+Y+RS W    WAIMYAWYFPK    G       L   G RH+W   +VW+
Sbjct  118  CEGSELGSQVYSRSTWYEGRWAIMYAWYFPKDIQNGG------LAKKGIRHDWVNVVVWL  171

Query  172  DNPELENSTILGVSMSA-SVGYASQTPPETR-YVDGDSVKLKYYYNHLLGSTSLQLTEAT  229
            +NP +   TIL  S S     Y    PP++   +DG + KL+Y         ++      
Sbjct  172  NNPAVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKLRYDEEGGEEWHTIFQFYGE  231

Query  230  GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            GEFQDLI WD+L+  AR +L +TD+ +       + +P  D  F+  L  A
Sbjct  232  GEFQDLIQWDQLTDAAREALQNTDFGDY------VNVPFNDAYFETNLKAA  276

>PITG_22981
Length=259

 Score = 172 bits (436),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 131/228 (57%), Gaps = 14/228 (6%)

Query  56   HNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  115
            H+ V+PF +PEP T ++K AVK+KP L ++ GCHPYP V   G    GLK +G  DGECT
Sbjct  22   HDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGECT  81

Query  116  GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPE  175
            GS LGSQ+Y+RS    + WAIMYAWYFPK      + LI +  G RH+W   +VW+DNP 
Sbjct  82   GSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQ--DIGLIKK--GVRHDWVNLVVWLDNPT  137

Query  176  LENSTILGVSMSA-SVGYASQTPPE-TRYVDGDSVKLKYYYNHLLG-STSLQLTEATGEF  232
            L   TIL  S S     Y    PP+ +  ++G + K++Y  +   G  T  Q  E  GE+
Sbjct  138  LAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEE-GEY  196

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            QDLI W +L+  AR +L +TD+ +         +P  D  F+  L  A
Sbjct  197  QDLIQWTQLTDAAREALENTDFGDF------ANVPFNDAYFETNLKAA  238

>PHALS_14423
Length=379

 Score = 175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 141/236 (60%), Gaps = 19/236 (8%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            +  N+V+PF + +P T SQK+A+KY+P+L +   C+PYPAVQ DGS+S GL W       
Sbjct  157  VNVNEVQPFKQRKPTTDSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQSR  216

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS  GSQIY+RS W    WAIMYAWY P+         I  + GH H W + +VW D+
Sbjct  217  CNGSPRGSQIYSRSDWYRGKWAIMYAWYLPRALDQN----IWDVDGHSHFWTFVVVWTDS  272

Query  174  PELENSTILGVSMSASVG--YASQTPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            P+ + STIL  S S  VG      +P +++Y ++  S+K+K + NH    T L+LTE  G
Sbjct  273  PDPDVSTILAASTSG-VGNRIKKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVG  331

Query  231  EFQDLITWDELSKLARYSL---NHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            E Q LITW++L+  AR +L   +++DW         ++ P++D  F  +L+ A+PF
Sbjct  332  ELQTLITWEQLTDEARAALSSVHYSDWR--------MESPIQDKWFRPMLSSAYPF  379

>PHYRA_72541
Length=239

 Score = 171 bits (433),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 134/237 (57%), Gaps = 18/237 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWS  107
            E   I H++V+PFP+P+PVT ++K+ VK+KP+L I  E GC  YPAV   G  SGGLK +
Sbjct  18   EAASIDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGT  77

Query  108  GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYA  167
                  CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG          R +  RH+W  A
Sbjct  78   KGTSA-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGF------WDSRAY-WRHDWSNA  129

Query  168  IVWIDNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLT  226
            +VWID+P LEN  +LG+S+S S   Y  +  P     +G +  L Y          L   
Sbjct  130  VVWIDDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPY  188

Query  227  EATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             A+GE QDLI W +L+  AR +LN         N    ++P+ D  F + L KAWP 
Sbjct  189  YASGEVQDLIMWGQLTDAARAALNDQG------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHALS_12600
Length=267

 Score = 172 bits (435),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 144/232 (62%), Gaps = 17/232 (7%)

Query  57   NQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTG  116
            ++V+PF + +P T SQ++A+KYKP+L +++GCHPYP VQ++GS+S G++W       C G
Sbjct  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107

Query  117  SKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPEL  176
            S  GSQIY+RS W    WA++Y WY P    +        + GHRH W + ++W D+P+ 
Sbjct  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDST----AWFVDGHRHFWLWVVIWTDSPDP  163

Query  177  ENSTILGVSMSASVGYASQ----TPPETRYVDGD-SVKLKYYYNHLLGSTSLQLTEATGE  231
            ++STIL  SMS   G+  +     P +++Y+  D ++K+K   + +     L+LT+  GE
Sbjct  164  DDSTILAASMS---GFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGE  220

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            FQDLITW++LS  AR +L++    E   N      P++D +F E+L K++PF
Sbjct  221  FQDLITWEQLSDEARAALSNFHRLEKRAN-----PPIQDKLFYEVLEKSYPF  267

>PPTG_18463
Length=254

 Score = 171 bits (433),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 136/250 (54%), Gaps = 35/250 (14%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I  + V+PF +P PVT S+KAA+K+KPQL I DGC  +PAV   G  +GGL  +G Q G
Sbjct  21   TINRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFPAVNAAGDTTGGL--NGTQGG  78

Query  113  E-CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            E C+ + LGSQ+Y RS W  D WA+M+AWY PK   A        +   RH+W   +VWI
Sbjct  79   EGCSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAA-------ITSRRHDWASMVVWI  131

Query  172  DNPELENSTILGVSMSASV----------------GYASQTPPETRYVDGDSVKLK--YY  213
            +NP LE   ILGVS+S S                 GY +++    R + G S  L+  + 
Sbjct  132  ENPSLEIPEILGVSLSNSANGYLRYTGNIYDWNFSGYVARSRRRDRDIPGSSTSLRVEHT  191

Query  214  YNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVF  273
                  S  L L +  G++QDLI W +L++ AR +LN TD+  +       K+P  DG F
Sbjct  192  VRKDFRSAFLNLAQTDGDYQDLIMWGQLTEEARMALNTTDFGRS-------KVPFNDGNF  244

Query  274  DELLNKAWPF  283
               L +A+PF
Sbjct  245  LIKLRQAYPF  254

>PHYRA_47241
Length=176

 Score = 168 bits (426),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 107/160 (67%), Gaps = 8/160 (5%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +PEPVT S+KAAV++KP L+I  GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIFSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWVNVVVWLDN  136

Query  174  PELENSTILGVSMSASV-GYASQTPPETRYVDGDSVKLKY  212
            P LE  TI+GVS S+ V  Y   TPP    + G +  + Y
Sbjct  137  PALERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTSMINY  176

>PHYKE_8391
Length=778

 Score = 181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 108/141 (77%), Gaps = 4/141 (3%)

Query  137  MYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSMSASVGYASQT  196
            MYAWYFPKGR       +    GHRHNWEYAIVWIDNP L+NSTILGVSMSAS GY+  +
Sbjct  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56

Query  197  PPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDE  256
            PP+ ++VDG SVKL YYY+ + G+T+L+ TE  GE QDLITWD+L  +A+ +LN+TDWD 
Sbjct  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116

Query  257  TLFNLAGLKMPLKDGVFDELL  277
            TL+N+  +KMPLKDG F + L
Sbjct  117  TLWNMCDVKMPLKDGEFTKNL  137

>PHYSO_482931
Length=254

 Score = 170 bits (431),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 128/247 (52%), Gaps = 36/247 (15%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +P PVT S+K AVK+KP L I + CHPYPAV   G  S GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS+LGSQ+Y R+ W   +WAIMYAWYFPK          +  FG RH W  A+VW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPKDS--------VSKFGQRHKWNAAVVWLDN  135

Query  174  PELENSTILGVSMSASVG-YASQT---PP---ETR-----------YVDGDSVKLKYYYN  215
            P +    IL VS     G Y  +T   PP   +TR            ++G +  L+Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  216  HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDE  275
             +            GEFQDLI W++L++ AR +L   D+            P  DG F  
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAADFGA----------PFVDGAFKS  245

Query  276  LLNKAWP  282
             L+ A P
Sbjct  246  NLDSARP  252

>PITG_23051
Length=280

 Score = 171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/243 (42%), Positives = 131/243 (54%), Gaps = 31/243 (13%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLK-WSGPQD  111
            + H++V PFP+PEPVT S+KAA+K+K QL I  G C  YPAV   G + GGL  W    D
Sbjct  22   VDHDKVEPFPQPEPVTISEKAAIKFKTQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  81

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C  + LGSQ+Y R+ W  D WAIMYAWYFPK               HRH+W+  +VWI
Sbjct  82   A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPKD-------FWTGFPTHRHDWKSVVVWI  133

Query  172  DNPELENSTILGVSMSAS-----------VGYASQTPPETRYVDGDSVKLKYYYNHLLGS  220
            DNP LE   I GVSMS S             Y S  P      +G +  L++ Y    GS
Sbjct  134  DNPALEIPKIEGVSMSKSDTKYKKKLKLKESYFSGAP-----TNGSNTSLRFEYEAGFGS  188

Query  221  TSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKA  280
            T +  T   GE+Q+LI W++L+  AR +LN    D   F      +P  D  F++ L++A
Sbjct  189  TFMGFTRWDGEYQNLIMWEQLTDAARATLN----DGNNFGKEA-SVPFSDEHFEDRLDEA  243

Query  281  WPF  283
            WPF
Sbjct  244  WPF  246

>PHYCA_69122
Length=249

 Score = 169 bits (428),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 142/248 (57%), Gaps = 33/248 (13%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIED-GCHPYPAVQKDGSISGGLKWSGPQD  111
             + H+Q+ PFP+PEPVT S+KAA+K+KPQL      C P+PAV   G I+GGLK +   D
Sbjct  16   TVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPFPAVNTAGEITGGLKGTNGND  75

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
            G C  +  G+QIY R+ W  D+WAIMY+WYFPKG G    P        RH+W+  +VWI
Sbjct  76   G-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT------RRHDWKNIVVWI  128

Query  172  DNPELENSTILGVSMSAS---------------VGYASQTPPETR--YVDGDSVKLKYYY  214
            DNP+LE   I+GV+MS S               VGY ++    +R  Y+ G +  L++ Y
Sbjct  129  DNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYL-GSNTSLRFEY  187

Query  215  NHL-LGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVF  273
            +   +G+  +      GE+QDLI W++L+  AR +LN    D   F  A  ++P  D  +
Sbjct  188  DTSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----DGKSFEKA--EVPFSDEHY  241

Query  274  DELLNKAW  281
            ++ L KAW
Sbjct  242  EDHLGKAW  249

>PHYCA_114913
Length=224

 Score = 168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 124/227 (55%), Gaps = 26/227 (11%)

Query  57   NQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTG  116
            ++V PFPE EP T SQKAAV+ KPQL I  GCHPY AV   G I+ G+  +  +D +C+G
Sbjct  21   DKVEPFPELEPTTISQKAAVRLKPQLHISKGCHPYAAVNAAGEITAGI--TTTRDPDCSG  78

Query  117  SKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPEL  176
              +GSQ+Y RS W  DVWAIMYAWYFP         LI       H+W+  +VWIDNP L
Sbjct  79   RGIGSQVYVRSTWYKDVWAIMYAWYFPSS-------LI-------HDWKNIVVWIDNPSL  124

Query  177  ENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLI  236
                +LGVS     GY           DG S K+KY Y        L  T   GEFQ+LI
Sbjct  125  AVPRVLGVSAQVDGGYLRYNKFNWDKFDGASPKIKYDY------PDLDWTSKRGEFQNLI  178

Query  237  TWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             WD+L++ AR +LN+T++           +P  D  F   L+ A P+
Sbjct  179  MWDQLTEAARTALNNTNFKGN----GDATVPFIDANFKANLDFAIPY  221

>PHYRA_72430
Length=238

 Score = 168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 126/231 (55%), Gaps = 15/231 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I   +V P  +P P T ++K  VK+KPQL I DGC  +PAV   G  + GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C+ + LGSQ+Y RS W N  +AI+YAWYFPKG  A        +   RH+W  A+VWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWA-------NVATRRHDWASAVVWIDR  134

Query  174  PELENSTILGVSMS-ASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            P+  + +ILG+S+S A   Y +Q P  +    G + +L +      G   L  T++TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI W++LS  AR +L+ TD+          K+P+ D  F   L KAWPF
Sbjct  195  QDLIMWEQLSSAARTALSTTDFGNA-------KVPMSDANFQTKLKKAWPF  238

>PHYRA_72306
Length=238

 Score = 168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 126/231 (55%), Gaps = 15/231 (6%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I   +V P  +P P T ++K  VK+KPQL I DGC  +PAV   G  + GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C+ + LGSQ+Y RS W N  +AI+YAWYFPKG  A        +   RH+W  A+VWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWA-------NVATRRHDWASAVVWIDR  134

Query  174  PELENSTILGVSMS-ASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            P+  + +ILG+S+S A   Y +Q P  +    G + +L +      G   L  T++TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            QDLI W++LS  AR +L+ TD+          K+P+ D  F   L KAWPF
Sbjct  195  QDLIMWEQLSSAARTALSTTDFGNA-------KVPMSDANFQTKLKKAWPF  238

>PITG_23076
Length=276

 Score = 169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 141/274 (51%), Gaps = 55/274 (20%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
                I H++V+PF +P+PVT S+KAAVK+KPQL I+ GC  +P V   G ISGGLK +  
Sbjct  18   RASAIDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLKGTKG  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             DG C  S LGSQ Y+RS W  D WAI++AWYFPKG  A   P I      RH W   ++
Sbjct  78   TDG-CRESPLGSQTYSRSAWYQDRWAIVFAWYFPKGFAA-GQPRI------RHYWSSMVL  129

Query  170  WIDNPELENSTILGVSMSASV-----------------GYASQT--PPE-----------  199
            WIDNP L+  TILGVS+S  +                  Y  QT  PP            
Sbjct  130  WIDNPALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVS  189

Query  200  --------TRYVDGDSVKLKYYYNHLLGSTSLQLTEAT--GEFQDLITWDELSKLARYSL  249
                    + Y  G +V ++  + +      L LT AT  GE+ DL+TWD+L++ AR +L
Sbjct  190  QINGWSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAAL  249

Query  250  NHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            N  D+ E+       K+P  D  F   L  +W F
Sbjct  250  NSADFGES-------KVPFSDQNFQRTLELSWLF  276

>PHYCA_109089
Length=277

 Score = 169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 132/274 (48%), Gaps = 56/274 (20%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H+QV+PF +PEPVT S+KAAVK+KPQ+ I DGC P+PAV   G +SGGL  +  
Sbjct  20   EPVTINHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKY  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGH-RHNWEYAI  168
             DG CT S +GSQ+Y R+ W  D WAIMYAWYFPK   A         F   RH W   +
Sbjct  80   TDG-CTESPMGSQVYGRASWYRDHWAIMYAWYFPKNFRA--------FFARGRHGWANMV  130

Query  169  VWIDNPELENSTILGVSMSASVGYASQ-------------------TPP-------ETRY  202
            +W+DNP LEN  +LG S+S     A +                    PP       E R+
Sbjct  131  LWLDNPALENQKLLGASLSQQTLKAEKILFIPLDEREKEPYQKFNGIPPMGFVGMQEIRH  190

Query  203  VDGDSVKLKYYYN----------HLLGS---TSLQLTEATGEFQDLITWDELSKLARYSL  249
                     Y Y           H++       L      GE+QDLI W++L+  AR  L
Sbjct  191  TQLSRWSWNYTYEGGSNVSTRVIHMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGL  250

Query  250  NHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            N  D+ +T         P  D  F   L KAWPF
Sbjct  251  NSADFGDTF-------APFTDDNFKTALEKAWPF  277

>PHYCA_10570
Length=278

 Score = 169 bits (429),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 139/277 (50%), Gaps = 61/277 (22%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G  I H++V+PF +P+PVT S+KAA+KYKPQL I  GC  +PAV   G I+GGLK +   
Sbjct  19   GATIDHDKVQPFKQPDPVTVSEKAALKYKPQLVIGGGCVSFPAVNAAGDITGGLKGTKST  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPVPLILRLFGHRHNWEYA  167
            DG CT + LGSQ Y RS W  D WA+M+AWYFPK   G GA            RH W   
Sbjct  79   DG-CTEAPLGSQAYGRSTWYQDKWAMMFAWYFPKNFWGGGA----------DSRHLWSNM  127

Query  168  IVWIDNPELENSTILGVSMSAS------------------VGYASQTPPETRYVDG-DSV  208
            +VWIDNP LE   ILGVS+S                    V Y   T  +     G  ++
Sbjct  128  VVWIDNPSLETPKILGVSLSQQTIDVPKLFYMFPLVNRQKVPYKKVTAIKPMDFAGMQAI  187

Query  209  KL------KYYYNHLLGSTS----------------LQLTEATGEFQDLITWDELSKLAR  246
            K       +Y YN+  GST+                L    A GE+QDLI W++L+  AR
Sbjct  188  KTGRIGRHRYTYNYTGGSTTSTRVYNGYTDQSGWHGLDFVNADGEYQDLIMWNQLTDQAR  247

Query  247  YSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
             +L   D+ E        K+P  D  F+  L +AWPF
Sbjct  248  SALESADFGEK------TKVPFDDKNFEAALTQAWPF  278

>PHYCA_109095
Length=277

 Score = 169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 137/273 (50%), Gaps = 54/273 (20%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G +IGH++V+PF +P+PVT S+KAAVKYKPQL I D C  +PAV   G I+GGLK +   
Sbjct  19   GAIIGHDKVQPFAQPDPVTISEKAAVKYKPQLVIFDSCVSFPAVNAAGDITGGLKGTSGT  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVW  170
            D  CT + LGSQ+Y RS W    WA+M+AWYFPK    +           RH W   ++W
Sbjct  79   DA-CTKAPLGSQVYGRSTWYQGKWAMMFAWYFPKNFWNLES-------RSRHLWANMVLW  130

Query  171  IDNPELENSTILGVSMSASV-----------------GYASQTP-PETRYVDGDSV----  208
            +DNP LE  TILG S+S                     Y+  TP P   +V    +    
Sbjct  131  LDNPALETPTILGASLSRQTLEVPKWLFIPSGVQQKNSYSKATPIPPMGFVGTQQIRTAR  190

Query  209  --KLKYYYNHLLGST----------------SLQLTEATGEFQDLITWDELSKLARYSLN  250
              + +Y YN+  GST                 L  T   G++QDLI W++L+  AR +L 
Sbjct  191  IGRFQYTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALE  250

Query  251  HTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
              D+          K+P  D  F+  L +AWPF
Sbjct  251  SADFGR------DTKVPFNDKNFEAALAQAWPF  277

>HYAP_14846
Length=221

 Score = 167 bits (424),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/238 (42%), Positives = 127/238 (53%), Gaps = 31/238 (13%)

Query  54   IGHNQVRPFPE------PEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWS  107
            I H+QV+PF +      P  V     AA+K+KPQL I  GCH YPAV   G  SGGLK +
Sbjct  4    IKHDQVQPFQQVVGDDSPTAV-----AALKFKPQLHISSGCHSYPAVNTVGEFSGGLKPT  58

Query  108  GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYA  167
            G  +G+C GS  GSQ+Y RS W  D WAIMY WYFPK                RH+WE+ 
Sbjct  59   GHDNGKCKGSGYGSQVYGRSAWHQDKWAIMYVWYFPKDNRD----------DDRHDWEHI  108

Query  168  IVWIDNPELENSTILGVSM--SASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQL  225
            +VW+DNP + N  +L VS+       Y +   P   +VDG SVKL Y   +     +L L
Sbjct  109  VVWLDNPAVANQKLLAVSLWNGRKSDYWTLAIPGPVFVDGSSVKLDYGKAN-KDERTLSL  167

Query  226  TEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            T   GEFQ LI W ++S+ AR + N   W +         MPL D  F++ L KA+ F
Sbjct  168  THLAGEFQPLIMWGQMSEKARTTFNTVLWRKEF-------MPLSDSCFEQHLKKAYDF  218

>PHALS_13512
Length=243

 Score = 168 bits (425),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 136/228 (60%), Gaps = 17/228 (7%)

Query  61   PFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLG  120
            PF +P P T SQK+A+KY+P+L +   C+PYPAVQ +GS+S GL W      +C GS  G
Sbjct  28   PFKQPTPTTDSQKSAIKYQPRLYVVSDCYPYPAVQANGSLSYGLPWEVFAPTKCNGSPYG  87

Query  121  SQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPELENST  180
            SQIY+RS W   +WAIMYAWY P+            + GHRH W + +VW ++P+   ST
Sbjct  88   SQIYSRSDWYRGMWAIMYAWYLPRALDHSS----WLVDGHRHFWTFVVVWTNSPDPNVST  143

Query  181  ILGVSMSASVGYASQ-TPPETRY-VDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDLITW  238
            IL  S S +     +  P +++Y +D  ++K+K Y N+ L  T L+LT+  G+ Q LITW
Sbjct  144  ILAASTSGTDNRIKKYLPVKSKYLLDRRTLKVKLYQNYWLDKTGLKLTDKVGDLQPLITW  203

Query  239  DELSKLARYSL---NHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            ++L+  AR +L   ++ DW         ++ P++D  F  +L+ A+PF
Sbjct  204  EQLTDEARAALSSFHYPDWR--------METPIQDKWFRYMLSSAYPF  243

>PHYCA_109192
Length=278

 Score = 169 bits (427),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 137/282 (49%), Gaps = 71/282 (25%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G  I H++V+PF +P+PVT S+KAAVKYKPQL I  GC  +PAV   G I+GGLK +   
Sbjct  19   GTTIDHDKVQPFKQPDPVTVSEKAAVKYKPQLVIGSGCVSFPAVNAAGDITGGLKGTKST  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK----GRGAVPVPLILRLFGHRHNWEY  166
            DG CT + LGSQ+Y RS W  D WA+M+AWYFPK    G G             RH W  
Sbjct  79   DG-CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNFWGGEGE-----------SRHLWSN  126

Query  167  AIVWIDNPELENSTILGVSMSASVGYASQTPPETRYV-----------------------  203
             +VWIDNP LE   ILG S+S      +  PP+  ++                       
Sbjct  127  MVVWIDNPALETPKILGASLSRQ----TLDPPKALFLFSLADRQKVPYKKVTGIDPMHFV  182

Query  204  ------DGDSVKLKYYYNHLLGSTS----------------LQLTEATGEFQDLITWDEL  241
                   G   + +Y YN+  GS +                L+     GE+QDLI W++L
Sbjct  183  GMQAIQTGRIGRYRYTYNYTGGSNTSTRVYHGFPDSSAWIGLEFVNVNGEYQDLIMWNQL  242

Query  242  SKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            +  AR +L   D+ E        K+P  D  F+  L +AWPF
Sbjct  243  TDQARATLESADFGEK------TKVPFNDKNFEAALAQAWPF  278

>PHYSO_480321
Length=254

 Score = 167 bits (423),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 127/247 (51%), Gaps = 36/247 (15%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  113
            I H++V+PF +P PVT S+K AVK+KP L I + CHPYPAV   G  S GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  114  CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDN  173
            C GS+LGSQ+Y R+ W   +WAIMYAWYFPK          +  FG RH W  A+VW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPKDS--------VSKFGQRHKWNAAVVWLDN  135

Query  174  PELENSTILGVSMSASVG-YASQT---PP---ETR-----------YVDGDSVKLKYYYN  215
            P +    IL VS     G Y  +T   PP   +TR            ++G +  L+Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  216  HLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDE  275
             +            GEFQDLI W++L++ AR +L   D+            P  D  F  
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAADFGA----------PFVDEAFKS  245

Query  276  LLNKAWP  282
             L+ A P
Sbjct  246  NLDSARP  252

>PHYSO_253029
Length=252

 Score = 167 bits (423),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 127/233 (55%), Gaps = 18/233 (8%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQDG  112
            I  N+V PF +P   T +QKAAVK+KP+L I  G C  +PAV   G  S GL   G    
Sbjct  22   IDLNKVAPFAQPTASTSAQKAAVKFKPRLSIGSGACVSFPAVNSAGDTSSGLSEEGKGST  81

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAIVWI  171
            +CT + LGSQ+Y R+ W N  +AI+YAWYFPKG     P          RH+W  A+VWI
Sbjct  82   DCTNAPLGSQVYGRAAWYNTRFAILYAWYFPKGFWNDYPT--------RRHDWASAVVWI  133

Query  172  DNPELENSTILGVSMS-ASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATG  230
            DNP+     ILG+S+S A   Y++Q P  +   DG + KL +  +   G   L  T+ +G
Sbjct  134  DNPDSNTPKILGLSLSTADWEYSTQAPATSGISDGTTPKLSHELSVECGDPYLTTTDGSG  193

Query  231  EFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            +FQ LI W++L+  AR +LN  D           K+P  D  F+  L  AWPF
Sbjct  194  DFQPLIMWEQLTTAARTALNSAD-------FGNAKVPTSDVNFEMKLKSAWPF  239

>PHYSO_246397
Length=264

 Score = 167 bits (423),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 134/245 (55%), Gaps = 25/245 (10%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI +++V+PFPE EP T S+KAA+KYKP L I+DGC  Y AV   G  SGG+    P
Sbjct  18   QAAVIDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAP  77

Query  110  QDGE---------CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRG--AVPVPLILRLF  158
              G          C GS LGSQ+Y+RS W  DVWAIMYAWYFP+         P +    
Sbjct  78   DGGTVEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWDEASYPPV----  133

Query  159  GHRHNWEYAIVWIDNPELENSTILGVSMS-ASVGYASQTPPETRYVDGDSVKLKYYYNHL  217
              RH+W   IVW++NP LEN ++LGVS S     Y +  P    +++G   K++Y+    
Sbjct  134  --RHDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFY  191

Query  218  LGS-TSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDEL  276
            +G   ++ ++   G+FQDL+ W +L+  AR +L   D+           +P  D  F++ 
Sbjct  192  VGGYHTIDVSLEAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNFEKN  245

Query  277  LNKAW  281
            L + W
Sbjct  246  LERGW  250

>PHYSO_514298
Length=264

 Score = 167 bits (422),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 134/245 (55%), Gaps = 25/245 (10%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            +  VI +++V+PFPE EP T S+KAA+KYKP L I+DGC  Y AV   G  SGG+    P
Sbjct  18   QAAVIDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAP  77

Query  110  QDGE---------CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRG--AVPVPLILRLF  158
              G          C GS LGSQ+Y+RS W  DVWAIMYAWYFP+         P +    
Sbjct  78   DGGTVEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEASYPPV----  133

Query  159  GHRHNWEYAIVWIDNPELENSTILGVSMS-ASVGYASQTPPETRYVDGDSVKLKYYYNHL  217
              RH+W   IVW++NP LEN ++LGVS S     Y +  P    +++G   K++Y+    
Sbjct  134  --RHDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFY  191

Query  218  LGS-TSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDEL  276
            +G   ++ ++   G+FQDL+ W +L+  AR +L   D+           +P  D  F++ 
Sbjct  192  VGGYHTIDVSLDAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNFEKN  245

Query  277  LNKAW  281
            L + W
Sbjct  246  LERGW  250

>PHYCA_124383
Length=280

 Score = 167 bits (423),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 131/271 (48%), Gaps = 55/271 (20%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+QV+PF +PEPVT S+KAAVKYKP L I DGC  +PAV   G I+GGLK       
Sbjct  25   TIDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLK-GTKNTK  83

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
            +CT + LGSQ+Y RS W  D WA+MY WYFPK   A            RH+W   +VWID
Sbjct  84   DCTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCAYKA-------AGRHDWANVVVWID  136

Query  173  NPELENSTILGVSMSA-----------SVGYASQTPPET---------------------  200
            NP LEN+T LG S+S            ++    + P E                      
Sbjct  137  NPALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVG  196

Query  201  ------RYVDGDSVKLKYY--YNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHT  252
                  +YV G +  +++   Y        +    + GE QDLI W++L+  AR +L   
Sbjct  197  RWSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESA  256

Query  253  DWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            D+  T       ++P  D  F+  L  AWPF
Sbjct  257  DFGNT-------QVPFTDKNFETNLQAAWPF  280

>PHYRA_47103
Length=226

 Score = 165 bits (418),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 127/225 (56%), Gaps = 23/225 (10%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             IGH++V+PFP+PE VT ++K+ VK+KPQL IE GC PYPA    G  S GL+ +G  D 
Sbjct  21   AIGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEXGCSPYPAANAAGETSEGLETNGAFD-  79

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAIVWI  171
             C    LGSQ+Y R++W NDVWAIMYAWYFPKG     P          RH+W  A+VWI
Sbjct  80   -CIIPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP--------WWRHDWSNAVVWI  130

Query  172  DNPELENSTILGVSMSASVG-YASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEAT-  229
            DNP  E   +LG+S+S S   Y +   P     +G +  L     ++L   S  L  A  
Sbjct  131  DNPAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLS---RNVLPMRSAALGPAVN  187

Query  230  -GEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVF  273
             GEFQDL+ W +L+  AR +LN  D      N    ++P+ D  F
Sbjct  188  PGEFQDLVMWTQLTDAARAALNDQD------NFGRTEVPISDDHF  226

>PPTG_13004
Length=255

 Score = 166 bits (421),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 139/253 (55%), Gaps = 36/253 (14%)

Query  51   GQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  110
            G+ +  + V+PF +PEPVT  +K A+K+KP L I+ GC  +PAV + G+IS GL+     
Sbjct  19   GEKVDCDFVKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLRPLNGN  78

Query  111  DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAIV  169
            DG C  +  GSQ+Y RS    D WAIM+AWYFPKG    +P          RH+W   +V
Sbjct  79   DG-CIKAPQGSQVYGRSTQFQDKWAIMFAWYFPKGFWSGMP--------SRRHDWASMVV  129

Query  170  WIDNPELENSTILGVSMSASVG-YASQTPPETR----------------YVDGD--SVKL  210
            WID+P+ E   +LGVS+S S   Y   T P +                 YV+G   S+++
Sbjct  130  WIDDPDFETPKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRI  189

Query  211  KYYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKD  270
             +      G  SL L+   G++QDLI W +L++ AR +LN  ++ +++       +P  D
Sbjct  190  SHSSGFFFGPASLDLSTRDGDYQDLIMWKQLTEEARKALNSANFGKSV-------VPFND  242

Query  271  GVFDELLNKAWPF  283
              F+++L KAWPF
Sbjct  243  DNFEDMLEKAWPF  255

>PHYSO_328418
Length=219

 Score = 165 bits (417),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 121/233 (52%), Gaps = 26/233 (11%)

Query  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111
             +    QV+   EP      QKAAVK+KPQLK+ + CHPY AV   G ISGGL       
Sbjct  12   SLFAMTQVQSALEP-----GQKAAVKFKPQLKLSNTCHPYAAVDAHGYISGGLNSELHIR  66

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C GS LG+QIYARS W +DVWA +YAWYFPK       P        R  W YAI+W+
Sbjct  67   NNCGGSDLGAQIYARSAWHSDVWATVYAWYFPKNSNNGGGP--------RSLWMYAIIWV  118

Query  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231
              P +    ++G ++          P +  Y+DG S + K+ YN       L  T+ TG 
Sbjct  119  GGPGVGAPEVVGATLKTDDDTEKHAPVDADYIDGTSFECKFTYNFWTTKAKLTATKKTGG  178

Query  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLK-MPLKDGVFDELLNKAWPF  283
            +QDLITW++L ++AR              LAG   MPL +G F+ELL   WPF
Sbjct  179  YQDLITWEQLPEVART------------GLAGYADMPLLNGTFEELLTNGWPF  219

>PHYRA_52296
Length=237

 Score = 165 bits (418),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 129/236 (55%), Gaps = 20/236 (8%)

Query  50   EGQVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP  109
            E   I H++V+PFP+P+PVT S+KA VK+K  L I++GC  YPAV   G  SGGLK SG 
Sbjct  18   EAVSIAHDEVQPFPQPDPVTISEKAGVKFKIPLNIQEGCASYPAVNAAGETSGGLKGSGG  77

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPVPLILRLFGHRHNWEYAI  168
              G C  S LGSQ+Y R++W NDVWAIMYAWYFPKG   + P          RH+W  AI
Sbjct  78   ISG-CELSLLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDSTP--------WWRHDWSNAI  128

Query  169  VWIDNPELENSTILGVSMSAS---VGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQL  225
            +WIDNP  EN  ILG+S+S S    G  +  PP           +       +    +  
Sbjct  129  LWIDNPAHENPKILGLSLSTSENKYGNKNTYPPAENSTXSPLSPIAVRRKCCISDLHVCG  188

Query  226  TEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            T    E QDLI W +L+  AR +LN  D      N    ++P+ D  F + L +AW
Sbjct  189  TPPP-ENQDLIMWSQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLEEAW  237

>PPTG_03796
Length=255

 Score = 166 bits (419),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 133/250 (53%), Gaps = 34/250 (14%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQL---KIEDGCHPYPAVQKDGSISGGLKWSGP  109
             + H++V PFP+P+P T S+KAA+K+KPQL   K+E  C  +PAV   G ++GGLK +  
Sbjct  21   TVDHDKVEPFPQPDPATISEKAAIKFKPQLYSAKLE-YCVSFPAVNAVGEVTGGLKGTNG  79

Query  110  QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIV  169
             D  C  + LGSQIY R+ W ND WAIMYAWYFPKG         + L   RH+W+  +V
Sbjct  80   NDA-CRLAPLGSQIYGRAGWHNDRWAIMYAWYFPKG-------FYMGLPTRRHDWKSVVV  131

Query  170  WIDNPELENSTILGVSMSAS---------------VGYASQTPP-ETRYVDGDSVKLKYY  213
            WIDN ELE   ILGVS S S                GY  Q P      V G +  L++ 
Sbjct  132  WIDNAELETPKILGVSTSVSDTRYKRDLVIFPRNFAGYQLQGPRFHHTEVFGSNTSLRFK  191

Query  214  YNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVF  273
                L    +   +  GE+QDLI W++L+  AR +LN  +      N    ++P  D  +
Sbjct  192  IWPTLFVPYMGFADFDGEYQDLIMWEQLTDAARAALNDDN------NFGRAEVPFSDTHY  245

Query  274  DELLNKAWPF  283
             E L  AWPF
Sbjct  246  KEHLENAWPF  255

>PHYCA_109162
Length=257

 Score = 166 bits (419),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/252 (38%), Positives = 134/252 (53%), Gaps = 36/252 (14%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQD  111
            ++ H+++ PFP+PEPVT S+KAA+K+KPQL      C P+PAV   G ++GGL  +   D
Sbjct  21   IVDHDKIEPFPQPEPVTVSEKAAIKFKPQLYTHKQLCAPFPAVNAAGEVTGGLSGANGND  80

Query  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171
              C  +  G+Q+Y R+ W  DVWAIMY+WYFPKG   +  P        RH+W+  +VWI
Sbjct  81   A-CKYALKGAQVYGRAGWYKDVWAIMYSWYFPKGFNWLGFPT------RRHDWKNVVVWI  133

Query  172  DNPELENSTILGVSMSAS---------------VGYASQTPPETRYVD-----GDSVKLK  211
            DNPELE   I+GV+M+ S               VG   Q     R        G S  L+
Sbjct  134  DNPELETPKIIGVAMAGSDTKYRREREMYNSNFVGSQVQVTRRDRRYYRSDSPGSSTNLR  193

Query  212  YYYNHLLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDG  271
            +      G+T L      G++QDLI W++L+  AR +LN    D   F  +  ++P  D 
Sbjct  194  FEN----GATHLDFARQDGDYQDLIMWEQLTDAARIALN----DNGSFGYSYAEVPFSDE  245

Query  272  VFDELLNKAWPF  283
             F+   +KAWP 
Sbjct  246  HFEANRDKAWPL  257

>PPTG_16647
Length=254

 Score = 165 bits (418),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 132/247 (53%), Gaps = 31/247 (13%)

Query  54   IGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIE-DGCHPYPAVQKDGSISGGLKWSGPQDG  112
            + H++V PFP+P PVT S+KAA+K+KPQL    + C P+P V   G ++GGLK +   D 
Sbjct  22   VDHDKVEPFPQPVPVTISEKAAIKFKPQLYTPYNICVPFPGVNAVGEVTGGLKGTNGNDA  81

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
             C  +  GSQIY R  W  D+WAIMYA Y PKG         + L   RH+ +  +VWI+
Sbjct  82   -CKYAPKGSQIYGRGGWYKDIWAIMYACYLPKG-------FWMDLPSRRHDGKSVVVWIN  133

Query  173  NPELENSTILGVSMSAS---------------VGYASQTPPETR-YVDGDSVKLKYYYNH  216
            NP  E   I+GVSMS S                GY  +     R Y+ G +  L++ Y  
Sbjct  134  NPGFETPKIVGVSMSKSDTKYYKETKIGPFAFAGYRKEGRRSERAYIYGSNTSLRFQYES  193

Query  217  LLGSTSLQLTEATGEFQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDEL  276
             LGS+ L   +  GE+QDLI W++L+  AR +LN  +      N    ++P  D  + + 
Sbjct  194  GLGSSYLSFADCDGEYQDLIMWEQLTDAARAALNDGN------NFGDAEVPFSDEHYKQH  247

Query  277  LNKAWPF  283
            L+KAWP 
Sbjct  248  LDKAWPL  254

>PHYSO_516261
Length=227

 Score = 164 bits (415),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/231 (41%), Positives = 122/231 (53%), Gaps = 24/231 (10%)

Query  53   VIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  112
             I H+ V+PF +P PVT S+KAAVK++P L +E GC P+PAV   G  SGGLK +G   G
Sbjct  21   TIDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGTGGTSG  80

Query  113  ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWID  172
                   GSQ+Y R+ W  D WAIMYAWYFPKG          R     H+W   +VWID
Sbjct  81   CKEAGATGSQVYGRAVWYKDDWAIMYAWYFPKG-------FWSRWASRHHDWASIVVWID  133

Query  173  NPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEF  232
            NP LE   ++G+S        S+   + R    D V   Y     L     QL +  G+ 
Sbjct  134  NPALETPKMIGIS-------TSEGDNDYRTAGPDDV---YETTPRLRRVLAQLFKILGDT  183

Query  233  QDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283
            Q LI W++L+  AR +LN TD+ +        K+P+ D  F   L KAWPF
Sbjct  184  QPLIMWEQLTDEARITLNTTDFGKA-------KVPMSDANFQGKLEKAWPF  227

>HYAP_04977
Length=262

 Score = 165 bits (418),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 127/226 (56%), Gaps = 15/226 (7%)

Query  56   HNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  115
            H+Q++P+ +PE  T ++KAA +YKP L    GC+PYPAV  +G  +GGLK +G    +C 
Sbjct  30   HDQIKPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKATGGSRSKCG  89

Query  116  GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWIDNPE  175
               +G Q+YAR KW ++ + I++AWYFPK         +    GHRH+WE+A +W++NPE
Sbjct  90   QPYMGGQVYARGKWCDEQFGIIFAWYFPKDS-------VRDGVGHRHDWEWATIWLNNPE  142

Query  176  LENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGEFQDL  235
               S ILGV+   S         +    +GD+VKL Y  +       + L+   GE Q L
Sbjct  143  ANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDHGR--RHYIALSGNDGELQPL  200

Query  236  ITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAW  281
            I WD++++ +R +LN   W++         MPL D VFD  L  A+
Sbjct  201  IMWDQMTEASRCALNTVGWNKHRL------MPLADTVFDNNLATAY  240

Lambda      K        H        a         alpha
   0.316    0.135    0.427    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 16755208743

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40