Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_17123147532011769579e-133
PHYCA_537323449662001769013e-124
PITG_18452147538561769182e-118
PHYRA_81105534612011768467e-116
PHYSO_353401534611461467062e-95
HYAP_07096534612511766885e-91
PYVX_18173449665001736922e-88
PYU1_G001739932032661605368e-68
PHYKE_8390534611301084994e-64
PYU1_G001738534612261574929e-62
PYIW_18788932032441644662e-57
PYU1_G001740147522061594483e-55
PYIR_25089854042621674507e-55
PPTG_10635528561991604361e-53
PHYRA_85631109792281604355e-53
PHYRA_84190720132061604318e-53
PHYCA_14369109792481604332e-52
PYU1_G001742932042131594302e-52
PYU1_G001744568762131594292e-52
PHYSO_341599109791851654262e-52
PPTG_10636109792461604322e-52
PHYSO_536424606911971754272e-52
PHYSO_507031586531971754272e-52
PHYCA_102624720131951614231e-51
PPTG_10634720132081594231e-51
PYU1_G001741854041991624204e-51
PHYCA_102852242061951604204e-51
PHYCA_102550457052681604212e-50
PHYSO_477820568762021654126e-50
PPTG_15264231281941654117e-50
PPTG_17366239131941654117e-50
PHYKE_8388568762051624101e-49
PPTG_10048213141901644082e-49
PHYRA_82864231281931614073e-49
PHALS_00498109791991684031e-48
PHYKE_8389147522041624022e-48
PHYRA_81107568762021623995e-48
PPTG_10643457052501594028e-48
PPTG_17121568762021623989e-48
PHYCA_511409568762041623981e-47
PYIR_26626147522121693972e-47
PHYRA_81106147522021623935e-47
PHYCA_129425147522041623926e-47
PHYKE_7718109792201603912e-46
PHYKE_3446231281991613883e-46
PHYSO_284086147522041623883e-46
PPTG_17122147522041623804e-45
PYIW_18791854041941663778e-45
PHALS_03284309411881623769e-45
PYAP_22273932032681403681e-42
PYAR_24096932032271623608e-42
PYVX_18174854042041633589e-42
PYVX_18176568762011623561e-41
PITG_18450147522031623527e-41
PYIR_26546866052391703548e-41
PYAP_22279854042231643363e-38
PYAP_22278932042891713311e-36
PPTG_0882086622501653244e-36
PHALS_0648053461159693174e-36
PHYCA_510817445761881383195e-36
PHYSO_499978231281741383168e-36
PHYSO_501575820771741383168e-36
PPTG_14254445761881383133e-35
PPTG_14255469372681383142e-34
PITG_13520109791711283037e-34
PHYKE_9185445762811383082e-33
PHYSO_417649445761851382994e-33
PHYSO_343376532371721502967e-33
PITG_1049986623231613069e-33
PHYSO_254168462841701552923e-32
PHYCA_53693413059831383082e-31
PHYSO_262732469371881362864e-31
PHYSO_340369526762001402771e-29
PHYSO_527908600641741262644e-28
PHYSO_34159652856231962685e-28
PYAP_18131991722261192381e-23
PHYCA_14368528562191682371e-23
PHYSO_342364529831941262221e-21
PHYRA_74651699693441332292e-21
PHYRA_73607194343431332231e-20
PHYRA_7358442332871382166e-20
H310_0636217301971352091e-19
PPTG_04622696962731332131e-19
PHYCA_534473423310501332191e-19
PYAP_18711943562101242049e-19
PHYSO_533903604652081272031e-18
PYIR_1643542333041222071e-18
PYAP_246891014392521322051e-18
PHYSO_484051571982851302052e-18
PHYKE_2937571983661302082e-18
PYVX_14662510865401322093e-18
PITG_0494842342321232023e-18
PHYRA_73606571983661302073e-18
PPTG_04647194343271302053e-18
PHYCA_13036542352661272015e-18
PHYKE_2809752822911231992e-17
PHYCA_531163194343141331992e-17
PHYKE_600144782891281973e-17
PHYKE_10578778802391071953e-17
PPTG_0461942342761231973e-17
H257_1355017302661381963e-17
PHYCA_534296526713091321974e-17
PHYRA_77971705552301071935e-17
PHYRA_85794726192301071935e-17
PITG_0527144782781241955e-17
PHYSO_48395542353201271957e-17
PHYSO_340333526712841261931e-16
PHYRA_86016727462361061911e-16
PHYSO_48552442342781231912e-16
SPRG_199171339462411411902e-16
PHYRA_86752732363001061922e-16
PHYSO_34033244782951261912e-16
PPTG_0461842353261281922e-16
PHYRA_83499204334731121933e-16
SDRG_173181339462411351874e-16
PHYSO_533747604512061261854e-16
PYU1_G01469042342951241895e-16
PHYRA_7868968382961321895e-16
PITG_0494942353371281897e-16
PHYSO_533682604462781311861e-15
PYU1_G005323943552511191841e-15
PHYSO_438103557212381321841e-15
PHYKE_391342343211231861e-15
PHALS_0539242353671271871e-15
PHYCA_98479819502761061851e-15
PYAP_19707995792411041832e-15
PHYSO_246676457051871601802e-15
PHYRA_7358342346301231872e-15
PYIR_16375823732621201832e-15
PYU1_G007476539131951231802e-15
PHALS_03179308833721271853e-15
PPTG_07509718142991061833e-15
PHYCA_12727044782791321823e-15
PPTG_0750738072991061833e-15
PHYCA_12942213313531011843e-15
PYAP_18709943552351191804e-15
PYIR_24743851643571541834e-15
PHYCA_1865738072951071815e-15
PHYSO_459106194342231301785e-15
PYIW_27477823991801191766e-15
PYIW_2196497752651281797e-15
SDRG_081371363342821411798e-15
PHYCA_1961197755311281828e-15
SDRG_081291363312181411778e-15
SDRG_075651244122781261799e-15
PHYCA_97965401872881061791e-14
PHYCA_12943369712871061791e-14
PHYRA_78175764333191231791e-14
PYIR_1644442341821201731e-14
PYU1_G007364851643161041791e-14
PHYRA_7914038074241071802e-14
PYIR_16443823992751201772e-14
PYIW_19151831912481741762e-14
PYVX_16138786195591261802e-14
PPTG_07521450302811061772e-14
PYVX_20789539132901811772e-14
PHYRA_7358242353261271782e-14
SPRG_077951259793351221772e-14
PHYKE_2454751493741271783e-14
PHYKE_6077188563221291773e-14
PYVX_1817514752147401684e-14
SPRG_19916161733051421745e-14
PPTG_0313997753201231755e-14
PYAP_18138991732681181735e-14
PHYRA_84947539132651341735e-14
PPTG_0462042333421301756e-14
PYVX_1817953461147401676e-14
PYU1_G001524930993001671746e-14
PHALS_0317644782071261706e-14
PHYRA_83500718143941071757e-14
PHYKE_6079597733021251738e-14
CCA1717917291851261689e-14
SPRG_2216117303001351721e-13
PYAR_1816599579261991711e-13
PHYSO_524101597733081281721e-13
CCI4738117292111261691e-13
PYVX_24563161732541321701e-13
PITG_0889273983091211712e-13
PYVX_20783375052761271702e-13
PYAR_14256943551991211662e-13
PHYRA_83494464352241071682e-13
PYU1_G005324845341911231662e-13
PYU1_G005326463491911231662e-13
PYU1_G00532842331911231662e-13
PYAR_2481897821981451662e-13
PYVX_21297798802631061682e-13
PITG_1193697753331231702e-13
PHYRA_78174188562791381692e-13
PHYRA_78176597733121311693e-13
PPTG_0752038142941061693e-13
PHYCA_19598375713901231703e-13
PPTG_1422144782751321683e-13
SPRG_076271258855361351713e-13
SDRG_154261258855231351713e-13
PPTG_03153597733141271693e-13
PPTG_07516464352941061683e-13
PHYCA_112615308831961141643e-13
PHYRA_78161375713731251694e-13
PPTG_0315697874451221704e-13
PYAP_1971299581276971674e-13
PITG_0494742332981291684e-13
SPRG_077971259813181221684e-13
SDRG_0878217304501771695e-13
PYIW_1879293204125961595e-13
PHYSO_24648197753181281675e-13
PHYKE_6002526711971191636e-13
PYU1_G005325943562071201637e-13
H257_112641259792821831658e-13
PYIR_2213497753001491658e-13
PHYKE_1913732362801051641e-12
PHYRA_7862657895473581671e-12
HYAP_1192397766061071671e-12
PYIW_242881643022011461611e-12
PHYKE_574938073001051651e-12
PHYRA_7862554146434581661e-12
PYU1_G00152797792781271631e-12
PYU1_G00152397762781271631e-12
PHYKE_902473982991461641e-12
PHYSO_374518539131161001551e-12
PPTG_18166242064451071652e-12
PYIW_1552617302561281622e-12
PHALS_03177526712591371622e-12
H257_112651431862821831632e-12
PITG_1193797763051101632e-12
SDRG_1731716173122691552e-12
PHYRA_84732161732651271622e-12
PHYCA_69583463492241331602e-12
PYAP_18221944962261541602e-12
H310_054321431863011261622e-12
PPTG_0625673983181211623e-12
PYU1_G00152697803341291623e-12
PYIW_242891643031961611583e-12
PYAR_14260845342121201583e-12
SPRG_078251259983371461614e-12
PHYSO_255056463492691241604e-12
PHYCA_15125371743341321614e-12
PPTG_04803375052681271604e-12
PYAP_1871342341841261564e-12
PHYKE_2379539132851271604e-12
PYAP_24691101441145691545e-12
PHYRA_86751732351631011545e-12
PYAR_153911025081761171555e-12
PYIR_17978827562501261585e-12
PHYCA_12331697763161221605e-12
PHYSO_476077161732681331595e-12
PHYSO_472009159812681331595e-12
PHYRA_7816297874781231615e-12
PYU1_G00640382373252971586e-12
PYVX_2250897752981281596e-12
SDRG_165341259793201201606e-12
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17123

Length=201
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17123                                                            373        9e-133
PHYCA_537323                                                          351        3e-124
PITG_18452                                                            358        2e-118
PHYRA_81105                                                           330        7e-116
PHYSO_353401                                                          276        2e-95 
HYAP_07096                                                            269        5e-91 
PYVX_18173                                                            271        2e-88 
PYU1_G001739                                                          211        8e-68 
PHYKE_8390                                                            196        4e-64 
PYU1_G001738                                                          194        9e-62 
PYIW_18788                                                            184        2e-57 
PYU1_G001740                                                          177        3e-55 
PYIR_25089                                                            177        7e-55 
PPTG_10635                                                            172        1e-53 
PHYRA_85631                                                           172        5e-53 
PHYRA_84190                                                           170        8e-53 
PHYCA_14369                                                           171        2e-52 
PYU1_G001742                                                          170        2e-52 
PYU1_G001744                                                          169        2e-52 
PHYSO_341599                                                          168        2e-52 
PPTG_10636                                                            171        2e-52 
PHYSO_536424                                                          169        2e-52 
PHYSO_507031                                                          169        2e-52 
PHYCA_102624                                                          167        1e-51 
PPTG_10634                                                            167        1e-51 
PYU1_G001741                                                          166        4e-51 
PHYCA_102852                                                          166        4e-51 
PHYCA_102550                                                          166        2e-50 
PHYSO_477820                                                          163        6e-50 
PPTG_15264                                                            162        7e-50 
PPTG_17366                                                            162        7e-50 
PHYKE_8388                                                            162        1e-49 
PPTG_10048                                                            161        2e-49 
PHYRA_82864                                                           161        3e-49 
PHALS_00498                                                           159        1e-48 
PHYKE_8389                                                            159        2e-48 
PHYRA_81107                                                           158        5e-48 
PPTG_10643                                                            159        8e-48 
PPTG_17121                                                            157        9e-48 
PHYCA_511409                                                          157        1e-47 
PYIR_26626                                                            157        2e-47 
PHYRA_81106                                                           155        5e-47 
PHYCA_129425                                                          155        6e-47 
PHYKE_7718                                                            155        2e-46 
PHYKE_3446                                                            154        3e-46 
PHYSO_284086                                                          154        3e-46 
PPTG_17122                                                            150        4e-45 
PYIW_18791                                                            149        8e-45 
PHALS_03284                                                           149        9e-45 
PYAP_22273                                                            146        1e-42 
PYAR_24096                                                            143        8e-42 
PYVX_18174                                                            142        9e-42 
PYVX_18176                                                            141        1e-41 
PITG_18450                                                            140        7e-41 
PYIR_26546                                                            140        8e-41 
PYAP_22279                                                            134        3e-38 
PYAP_22278                                                            132        1e-36 
PPTG_08820                                                            129        4e-36 
PHALS_06480                                                           126        4e-36 
PHYCA_510817                                                          127        5e-36 
PHYSO_499978                                                          126        8e-36 
PHYSO_501575                                                          126        8e-36 
PPTG_14254                                                            125        3e-35 
PPTG_14255                                                            125        2e-34 
PITG_13520                                                            121        7e-34 
PHYKE_9185                                                            123        2e-33 
PHYSO_417649                                                          119        4e-33 
PHYSO_343376                                                          118        7e-33 
PITG_10499                                                            122        9e-33 
PHYSO_254168                                                          117        3e-32 
PHYCA_536934                                                          123        2e-31 
PHYSO_262732                                                          114        4e-31 
PHYSO_340369                                                          111        1e-29 
PHYSO_527908                                                          106        4e-28 
PHYSO_341596                                                          107        5e-28 
PYAP_18131                                                            96.3       1e-23 
PHYCA_14368                                                           95.9       1e-23 
PHYSO_342364                                                          90.1       1e-21 
PHYRA_74651                                                           92.8       2e-21 
PHYRA_73607                                                           90.5       1e-20 
PHYRA_73584                                                           87.8       6e-20 
H310_06362                                                            85.1       1e-19 
PPTG_04622                                                            86.7       1e-19 
PHYCA_534473                                                          89.0       1e-19 
PYAP_18711                                                            83.2       9e-19 
PHYSO_533903                                                          82.8       1e-18 
PYIR_16435                                                            84.3       1e-18 
PYAP_24689                                                            83.6       1e-18 
PHYSO_484051                                                          83.6       2e-18 
PHYKE_2937                                                            84.7       2e-18 
PYVX_14662                                                            85.1       3e-18 
PITG_04948                                                            82.4       3e-18 
PHYRA_73606                                                           84.3       3e-18 
PPTG_04647                                                            83.6       3e-18 
PHYCA_130365                                                          82.0       5e-18 
PHYKE_2809                                                            81.3       2e-17 
PHYCA_531163                                                          81.3       2e-17 
PHYKE_6001                                                            80.5       3e-17 
PHYKE_10578                                                           79.7       3e-17 
PPTG_04619                                                            80.5       3e-17 
H257_13550                                                            80.1       3e-17 
PHYCA_534296                                                          80.5       4e-17 
PHYRA_77971                                                           79.0       5e-17 
PHYRA_85794                                                           79.0       5e-17 
PITG_05271                                                            79.7       5e-17 
PHYSO_483955                                                          79.7       7e-17 
PHYSO_340333                                                          79.0       1e-16 
PHYRA_86016                                                           78.2       1e-16 
PHYSO_485524                                                          78.2       2e-16 
SPRG_19917                                                            77.8       2e-16 
PHYRA_86752                                                           78.6       2e-16 
PHYSO_340332                                                          78.2       2e-16 
PPTG_04618                                                            78.6       2e-16 
PHYRA_83499                                                           79.0       3e-16 
SDRG_17318                                                            76.6       4e-16 
PHYSO_533747                                                          75.9       4e-16 
PYU1_G014690                                                          77.4       5e-16 
PHYRA_78689                                                           77.4       5e-16 
PITG_04949                                                            77.4       7e-16 
PHYSO_533682                                                          76.3       1e-15 
PYU1_G005323                                                          75.5       1e-15 
PHYSO_438103                                                          75.5       1e-15 
PHYKE_3913                                                            76.3       1e-15 
PHALS_05392                                                           76.6       1e-15 
PHYCA_98479                                                           75.9       1e-15 
PYAP_19707                                                            75.1       2e-15 
PHYSO_246676                                                          73.9       2e-15 
PHYRA_73583                                                           76.6       2e-15 
PYIR_16375                                                            75.1       2e-15 
PYU1_G007476                                                          73.9       2e-15 
PHALS_03179                                                           75.9       3e-15 
PPTG_07509                                                            75.1       3e-15 
PHYCA_127270                                                          74.7       3e-15 
PPTG_07507                                                            75.1       3e-15 
PHYCA_12942                                                           75.5       3e-15 
PYAP_18709                                                            73.9       4e-15 
PYIR_24743                                                            75.1       4e-15 
PHYCA_18657                                                           74.3       5e-15 
PHYSO_459106                                                          73.2       5e-15 
PYIW_27477                                                            72.4       6e-15 
PYIW_21964                                                            73.6       7e-15 
SDRG_08137                                                            73.6       8e-15 
PHYCA_19611                                                           74.7       8e-15 
SDRG_08129                                                            72.8       8e-15 
SDRG_07565                                                            73.6       9e-15 
PHYCA_97965                                                           73.6       1e-14 
PHYCA_12943                                                           73.6       1e-14 
PHYRA_78175                                                           73.6       1e-14 
PYIR_16444                                                            71.2       1e-14 
PYU1_G007364                                                          73.6       1e-14 
PHYRA_79140                                                           73.9       2e-14 
PYIR_16443                                                            72.8       2e-14 
PYIW_19151                                                            72.4       2e-14 
PYVX_16138                                                            73.9       2e-14 
PPTG_07521                                                            72.8       2e-14 
PYVX_20789                                                            72.8       2e-14 
PHYRA_73582                                                           73.2       2e-14 
SPRG_07795                                                            72.8       2e-14 
PHYKE_2454                                                            73.2       3e-14 
PHYKE_6077                                                            72.8       3e-14 
PYVX_18175                                                            69.3       4e-14 
SPRG_19916                                                            71.6       5e-14 
PPTG_03139                                                            72.0       5e-14 
PYAP_18138                                                            71.2       5e-14 
PHYRA_84947                                                           71.2       5e-14 
PPTG_04620                                                            72.0       6e-14 
PYVX_18179                                                            68.9       6e-14 
PYU1_G001524                                                          71.6       6e-14 
PHALS_03176                                                           70.1       6e-14 
PHYRA_83500                                                           72.0       7e-14 
PHYKE_6079                                                            71.2       8e-14 
CCA17179                                                              69.3       9e-14 
SPRG_22161                                                            70.9       1e-13 
PYAR_18165                                                            70.5       1e-13 
PHYSO_524101                                                          70.9       1e-13 
CCI47381                                                              69.7       1e-13 
PYVX_24563                                                            70.1       1e-13 
PITG_08892                                                            70.5       2e-13 
PYVX_20783                                                            70.1       2e-13 
PYAR_14256                                                            68.6       2e-13 
PHYRA_83494                                                           69.3       2e-13 
PYU1_G005324                                                          68.6       2e-13 
PYU1_G005326                                                          68.6       2e-13 
PYU1_G005328                                                          68.6       2e-13 
PYAR_24818                                                            68.6       2e-13 
PYVX_21297                                                            69.3       2e-13 
PITG_11936                                                            70.1       2e-13 
PHYRA_78174                                                           69.7       2e-13 
PHYRA_78176                                                           69.7       3e-13 
PPTG_07520                                                            69.7       3e-13 
PHYCA_19598                                                           70.1       3e-13 
PPTG_14221                                                            69.3       3e-13 
SPRG_07627                                                            70.5       3e-13 
SDRG_15426                                                            70.5       3e-13 
PPTG_03153                                                            69.7       3e-13 
PPTG_07516                                                            69.3       3e-13 
PHYCA_112615                                                          67.8       3e-13 
PHYRA_78161                                                           69.7       4e-13 
PPTG_03156                                                            70.1       4e-13 
PYAP_19712                                                            68.9       4e-13 
PITG_04947                                                            69.3       4e-13 
SPRG_07797                                                            69.3       4e-13 
SDRG_08782                                                            69.7       5e-13 
PYIW_18792                                                            65.9       5e-13 
PHYSO_246481                                                          68.9       5e-13 
PHYKE_6002                                                            67.4       6e-13 
PYU1_G005325                                                          67.4       7e-13 
H257_11264                                                            68.2       8e-13 
PYIR_22134                                                            68.2       8e-13 
PHYKE_1913                                                            67.8       1e-12 
PHYRA_78626                                                           68.9       1e-12 
HYAP_11923                                                            68.9       1e-12 
PYIW_24288                                                            66.6       1e-12 
PHYKE_5749                                                            68.2       1e-12 
PHYRA_78625                                                           68.6       1e-12 
PYU1_G001527                                                          67.4       1e-12 
PYU1_G001523                                                          67.4       1e-12 
PHYKE_9024                                                            67.8       1e-12 
PHYSO_374518                                                          64.3       1e-12 
PPTG_18166                                                            68.2       2e-12 
PYIW_15526                                                            67.0       2e-12 
PHALS_03177                                                           67.0       2e-12 
H257_11265                                                            67.4       2e-12 
PITG_11937                                                            67.4       2e-12 
SDRG_17317                                                            64.3       2e-12 
PHYRA_84732                                                           67.0       2e-12 
PHYCA_69583                                                           66.2       2e-12 
PYAP_18221                                                            66.2       2e-12 
H310_05432                                                            67.0       2e-12 
PPTG_06256                                                            67.0       3e-12 
PYU1_G001526                                                          67.0       3e-12 
PYIW_24289                                                            65.5       3e-12 
PYAR_14260                                                            65.5       3e-12 
SPRG_07825                                                            66.6       4e-12 
PHYSO_255056                                                          66.2       4e-12 
PHYCA_15125                                                           66.6       4e-12 
PPTG_04803                                                            66.2       4e-12 
PYAP_18713                                                            64.7       4e-12 
PHYKE_2379                                                            66.2       4e-12 
PYAP_24691                                                            63.9       5e-12 
PHYRA_86751                                                           63.9       5e-12 
PYAR_15391                                                            64.3       5e-12 
PYIR_17978                                                            65.5       5e-12 
PHYCA_123316                                                          66.2       5e-12 
PHYSO_476077                                                          65.9       5e-12 
PHYSO_472009                                                          65.9       5e-12 
PHYRA_78162                                                           66.6       5e-12 
PYU1_G006403                                                          65.5       6e-12 
PYVX_22508                                                            65.9       6e-12 
SDRG_16534                                                            66.2       6e-12 
PYU1_G005868                                                          65.5       6e-12 
PYIR_23585                                                            65.5       6e-12 
PHYSO_525076                                                          66.2       6e-12 
PHYRA_80631                                                           65.9       6e-12 
PPTG_06253                                                            65.9       7e-12 
PHYKE_6078                                                            65.9       7e-12 
SPRG_07826                                                            65.5       1e-11 
SPRG_04679                                                            64.3       1e-11 
SDRG_00972                                                            65.5       1e-11 
PHYKE_10295                                                           65.1       1e-11 
PHYRA_80750                                                           64.7       1e-11 
PPTG_07511                                                            63.5       1e-11 
PPTG_10186                                                            64.7       1e-11 
PHYKE_7717                                                            65.9       1e-11 
PHYKE_2539                                                            64.7       1e-11 
PYIR_24867                                                            65.1       1e-11 
PHYRA_78172                                                           65.1       2e-11 
PYIW_19601                                                            63.9       2e-11 
PYAR_16493                                                            64.3       2e-11 
PHYCA_10471                                                           64.7       2e-11 
PHYCA_120062                                                          63.5       2e-11 
PYU1_G005866                                                          63.2       2e-11 
PYIR_24421                                                            63.5       2e-11 
PHYCA_19612                                                           65.1       2e-11 
PYIR_22634                                                            64.3       2e-11 
PYIR_26867                                                            62.4       2e-11 
PYAP_22257                                                            63.9       2e-11 
PHYCA_18729                                                           64.7       2e-11 
PITG_20631                                                            63.9       2e-11 
HYAP_14170                                                            63.9       2e-11 
PITG_20312                                                            63.9       2e-11 
PYU1_G006405                                                          64.3       2e-11 
PPTG_03138                                                            64.3       2e-11 
PYVX_22510                                                            64.7       2e-11 
PHYCA_132255                                                          61.2       3e-11 
PYAR_21940                                                            63.5       3e-11 
SDRG_17448                                                            63.5       3e-11 
PPTG_03144                                                            63.9       3e-11 
PHYCA_6388                                                            63.5       4e-11 
PPTG_10073                                                            62.0       4e-11 
PYAP_22462                                                            62.4       4e-11 
PYIR_14463                                                            63.9       5e-11 
PYU1_G006404                                                          63.2       5e-11 
PHYCA_122958                                                          62.8       5e-11 
PPTG_03140                                                            63.5       6e-11 
PYAR_20617                                                            62.4       8e-11 
PYIW_18794                                                            62.0       8e-11 
PYAP_20077                                                            62.0       9e-11 
PYU1_G005869                                                          62.4       9e-11 
PHYKE_7445                                                            62.8       9e-11 
PPTG_03160                                                            62.8       1e-10 
PYU1_G005867                                                          61.2       1e-10 
H310_05438                                                            62.4       1e-10 
PHYRA_86241                                                           60.8       1e-10 
PHYRA_78177                                                           62.4       1e-10 
SPRG_07799                                                            62.4       1e-10 
SDRG_00948                                                            62.4       1e-10 
PYIR_20481                                                            62.0       1e-10 
PHYKE_9023                                                            61.6       2e-10 
PITG_08895                                                            60.5       2e-10 
PYU1_G001514                                                          62.0       2e-10 
PHALS_10635                                                           61.6       2e-10 
PYAP_23672                                                            61.2       2e-10 
PHYKE_6076                                                            61.2       2e-10 
HYAP_01683                                                            61.6       2e-10 
PHYSO_426658                                                          60.5       2e-10 
H257_11258                                                            61.6       2e-10 
PYIW_18065                                                            61.2       3e-10 
PHYSO_318683                                                          61.6       3e-10 
PHYRA_78169                                                           61.6       3e-10 
PHYCA_15124                                                           61.2       3e-10 
PHYSO_488139                                                          60.8       3e-10 
PYAP_18226                                                            60.1       3e-10 
PHALS_04411                                                           60.5       4e-10 
PHYRA_73581                                                           60.8       4e-10 
PHYSO_375794                                                          58.2       4e-10 
PHALS_01293                                                           60.8       5e-10 
PYVX_19277                                                            60.5       5e-10 
PHYKE_3912                                                            60.1       5e-10 
PYIR_19612                                                            60.1       5e-10 
PPTG_06249                                                            60.5       5e-10 
PHYSO_337515                                                          60.5       6e-10 
PITG_08202                                                            58.9       6e-10 
PITG_11944                                                            60.1       7e-10 
PYAR_21271                                                            59.3       7e-10 
PHYCA_15126                                                           60.1       7e-10 
PHYSO_488921                                                          60.1       7e-10 
PHYRA_78167                                                           59.7       7e-10 
PYU1_G005871                                                          59.7       8e-10 
PHYSO_329293                                                          60.1       8e-10 
PYU1_G005873                                                          58.9       8e-10 
PYIR_20483                                                            59.7       9e-10 
PYU1_G005985                                                          58.5       9e-10 
PYVX_21174                                                            56.2       9e-10 
PPTG_03143                                                            60.1       9e-10 
PHYSO_262844                                                          59.7       9e-10 
PHYCA_562062                                                          58.9       1e-09 
PYU1_G005872                                                          59.7       1e-09 
SDRG_16535                                                            59.7       1e-09 
PHYSO_324715                                                          58.9       1e-09 
PYIR_16437                                                            58.9       1e-09 
SPRG_07796                                                            59.3       2e-09 
PHALS_02044                                                           58.5       2e-09 
PPTG_18176                                                            58.5       2e-09 
PYIR_15187                                                            57.8       2e-09 
PYU1_G001475                                                          58.5       2e-09 
PYIW_18790                                                            55.5       2e-09 
H257_11306                                                            58.9       2e-09 
PYU1_G001519                                                          58.5       2e-09 
PHYRA_93650                                                           58.2       2e-09 
PITG_01966                                                            58.5       2e-09 
PHYCA_103479                                                          58.5       2e-09 
PHYSO_374025                                                          58.5       3e-09 
PYU1_G001516                                                          58.5       3e-09 
PHYKE_7446                                                            58.5       3e-09 
H257_11271                                                            58.5       3e-09 
PHALS_05394                                                           58.2       3e-09 
PYAP_16994                                                            58.2       3e-09 
PHYCA_12944                                                           56.6       3e-09 
PYIR_25999                                                            58.5       3e-09 
PPTG_03145                                                            58.2       3e-09 
PHYRA_77293                                                           58.2       3e-09 
PPTG_01148                                                            57.8       4e-09 
PYU1_G001518                                                          58.2       4e-09 
PPTG_03161                                                            58.2       4e-09 
PYAP_14265                                                            57.8       4e-09 
PITG_11957                                                            57.8       4e-09 
PHYCA_552912                                                          58.2       4e-09 
PPTG_04801                                                            57.4       5e-09 
PHYRA_78168                                                           57.4       5e-09 
PYVX_22511                                                            57.4       5e-09 
PYAR_17163                                                            54.7       5e-09 
PHALS_02041                                                           57.4       6e-09 
PPTG_04617                                                            57.8       6e-09 
PYIR_23689                                                            56.6       6e-09 
PYAP_23673                                                            57.4       6e-09 
PYIW_24287                                                            57.4       7e-09 
PYIW_17867                                                            57.4       7e-09 
PHYCA_14560                                                           57.0       8e-09 
PHYSO_256017                                                          55.1       9e-09 
PHYCA_19608                                                           56.6       1e-08 
PYAR_17307                                                            55.8       1e-08 
PHYSO_525490                                                          56.6       1e-08 
PHYSO_255975                                                          55.5       1e-08 
PYIW_25463                                                            55.8       1e-08 
PPTG_01147                                                            56.2       1e-08 
PHYKE_6069                                                            56.2       1e-08 
PYIR_22135                                                            56.2       1e-08 
PHYRA_77291                                                           55.8       2e-08 
PHYRA_86201                                                           55.8       2e-08 
PHYRA_78164                                                           55.8       2e-08 
PPTG_01152                                                            55.5       2e-08 
PITG_21641                                                            55.8       2e-08 
PYVX_21643                                                            55.5       2e-08 
PHYSO_318693                                                          55.8       2e-08 
PPTG_20376                                                            54.3       3e-08 
PHYRA_79881                                                           55.1       3e-08 
PYIW_23030                                                            55.1       3e-08 
PHYRA_78165                                                           55.5       3e-08 
PYAP_16347                                                            54.3       3e-08 
PPTG_03147                                                            55.1       3e-08 
PITG_11942                                                            55.1       3e-08 
PHYRA_80632                                                           55.5       3e-08 
PYAR_17166                                                            52.8       3e-08 
PHYCA_123476                                                          55.1       4e-08 
PHYKE_10296                                                           55.5       4e-08 
PYIW_16810                                                            54.3       4e-08 
PYU1_G001528                                                          54.7       5e-08 
PYIW_16208                                                            54.3       5e-08 
PHYSO_525121                                                          53.9       5e-08 
PHYCA_559281                                                          52.8       5e-08 
PHYSO_454780                                                          53.5       6e-08 
PHYSO_489485                                                          52.8       6e-08 
PYVX_16673                                                            55.1       6e-08 
PHYCA_14559                                                           53.9       6e-08 
PYIW_26655                                                            53.9       7e-08 
PHALS_02295                                                           53.9       8e-08 
PHYRA_87941                                                           52.4       8e-08 
H310_05433                                                            54.3       9e-08 
PYAR_22058                                                            53.1       9e-08 
PYVX_23997                                                            52.8       1e-07 
PYIR_25334                                                            53.5       1e-07 
PYIR_22133                                                            53.9       1e-07 
PYIW_25573                                                            53.5       1e-07 
PHYCA_19599                                                           53.9       1e-07 
PHYSO_339832                                                          53.1       1e-07 
PPTG_06106                                                            53.1       1e-07 
PHYRA_86151                                                           52.4       1e-07 
PHYRA_77290                                                           53.5       1e-07 
PYAP_16338                                                            53.5       1e-07 
PYU1_G001525                                                          53.5       1e-07 
PYAP_16337                                                            52.8       2e-07 
PYAP_23455                                                            53.1       2e-07 
PHYSO_257305                                                          52.0       2e-07 
PYAR_25093                                                            52.0       2e-07 
PYU1_G007250                                                          51.6       2e-07 
PHYCA_10470                                                           52.8       2e-07 
PPTG_03148                                                            52.4       3e-07 
PPTG_01153                                                            52.8       3e-07 
PYIR_24935                                                            52.4       3e-07 
PYIW_14247                                                            52.0       3e-07 
PHALS_08575                                                           52.4       3e-07 
HYAP_01682                                                            52.0       5e-07 
PYAR_24113                                                            50.8       5e-07 
PYIW_21963                                                            51.6       6e-07 
PYU1_G005878                                                          48.1       7e-07 
PYAP_18584                                                            50.8       7e-07 
PHALS_02296                                                           51.2       7e-07 
PITG_01969                                                            51.2       7e-07 
PHYRA_95184                                                           51.6       7e-07 
PYU1_G001520                                                          51.2       8e-07 
PHYRA_75781                                                           50.8       8e-07 
PHALS_05110                                                           50.4       8e-07 
PHYCA_19606                                                           51.2       9e-07 
PYIR_20304                                                            50.4       9e-07 
PHYCA_558591                                                          48.5       1e-06 
PPTG_13879                                                            50.4       1e-06 
PYIW_14252                                                            50.1       1e-06 
PYIR_20850                                                            49.7       2e-06 
PYU1_G007242                                                          49.7       2e-06 
PYU1_G001517                                                          49.7       2e-06 
PPTG_22744                                                            48.5       2e-06 
PITG_04404                                                            49.3       3e-06 
PYAR_14261                                                            48.1       3e-06 
PYAR_23090                                                            48.1       3e-06 
PPTG_00483                                                            48.9       3e-06 
PITG_11943                                                            48.1       4e-06 
PITG_11951                                                            48.1       4e-06 
PYU1_G003057                                                          48.5       4e-06 
PHYKE_6066                                                            48.9       4e-06 
PYAR_15390                                                            48.1       5e-06 
PITG_11946                                                            48.5       5e-06 
PYU1_G007254                                                          48.1       5e-06 
PYU1_G005862                                                          48.1       5e-06 
PYAP_24338                                                            48.5       5e-06 
PYIR_25571                                                            48.5       6e-06 
PYU1_G006672                                                          45.1       6e-06 
PYVX_22509                                                            48.5       6e-06 
PHYKE_7443                                                            48.5       7e-06 
PYIR_22136                                                            48.1       9e-06 
PHALS_01460                                                           47.8       1e-05 
PYAP_16351                                                            47.4       2e-05 
PYIW_15528                                                            47.4       2e-05 
PYAR_15784                                                            46.6       2e-05 
PYVX_21644                                                            46.6       2e-05 
PYAR_22574                                                            44.7       2e-05 
PYIW_20715                                                            47.0       2e-05 
PYVX_24274                                                            46.6       2e-05 
PYIR_20482                                                            45.8       2e-05 
PHALS_02037                                                           47.0       2e-05 

>PPTG_17123
Length=201

 Score = 373 bits (957),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 176/176 (100%), Positives = 176/176 (100%), Gaps = 0/176 (0%)

Query  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85
            QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR
Sbjct  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85

Query  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145
            AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG
Sbjct  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145

Query  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA
Sbjct  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201

>PHYCA_537323
Length=200

 Score = 351 bits (901),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 172/176 (98%), Gaps = 0/176 (0%)

Query  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85
            QRRLDAGLGEGQVV HPPPFF+VDGLDFQGMALAYLQEQGVNTSIEAQSWM+QHGYTSLR
Sbjct  25   QRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLR  84

Query  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145
            AMLDDESLY+VTEEAIFECGLTSP+TETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVS+G
Sbjct  85   AMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAG  144

Query  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            RNCHTEFP GQH+VDYSSCG++CTLSWYWLGIKY+EGIYSWQVYKNCVGL TA TA
Sbjct  145  RNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200

>PITG_18452
Length=856

 Score = 358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 163/176 (93%), Positives = 171/176 (97%), Gaps = 0/176 (0%)

Query  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85
            QRRLDAGLGEGQ+VLHPPPFFVVDGLDFQGMALAYLQEQG+NTSIEAQSWMQQ GY+SLR
Sbjct  681  QRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLR  740

Query  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145
            AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCE+WLDDTKV+SG
Sbjct  741  AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASG  800

Query  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            RNCHTEFPHGQH+VDYSSCG +C LSWYWLGIKY+EGIYSWQVYKNCVGLS  PTA
Sbjct  801  RNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856

>PHYRA_81105
Length=201

 Score = 330 bits (846),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)

Query  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85
            QRRLDAGLGEGQ+VLHPPPFF+VDGLDFQGMALAYLQEQGVNTSIEAQ WMQQHGY SLR
Sbjct  26   QRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLR  85

Query  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145
            +MLDDESLY+VTEEAIF+CGLTSP+TETQ IPTN+SFQ+SGYTLDGPCEVWLDDTK ++G
Sbjct  86   SMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAG  145

Query  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            RNCHTEFPHGQH++DYS+CG AC L WYWLGIKY+EG YSWQVYKNC+ L    TA
Sbjct  146  RNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201

>PHYSO_353401
Length=146

 Score = 276 bits (706),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  56   MALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  115
            MALAYLQEQGVNTSIEAQSWMQ+HGY SLRAMLDDESLYKVTEEA+F+CGLTSP+TETQP
Sbjct  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60

Query  116  IPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWL  175
            IP+N+SFQTSGYTLDGPCEVWLDDTKV++GRNCHT+FPHGQHE+DYS+CG +CTL WYWL
Sbjct  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120

Query  176  GIKYIEGIYSWQVYKNCVGLSTAPTA  201
            GIKY+EG YSWQVYKNCV LS   TA
Sbjct  121  GIKYVEGAYSWQVYKNCVALSKTATA  146

>HYAP_07096
Length=251

 Score = 269 bits (688),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 148/176 (84%), Gaps = 1/176 (1%)

Query  27   RRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRA  86
            +RL + L EGQVVL+P P F+VD    QG ALAYLQEQG++TSIEAQSW Q+HGY SLRA
Sbjct  76   QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRA  135

Query  87   MLDDESLYKVTEEAIFECGLTSPRTET-QPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145
            MLDD+SLY V+++AIF+CG TS  +ET Q IPTN + ++SGYTLDGPCEVW DDT+V+SG
Sbjct  136  MLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSG  195

Query  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            RNC TEFPHGQH+VDYSSCG +CTL WYWLGI+Y++GIYSWQVYKNC+GL    TA
Sbjct  196  RNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251

>PYVX_18173
Length=500

 Score = 271 bits (692),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 147/173 (85%), Gaps = 0/173 (0%)

Query  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85
            QRRLD+GLGEGQVVL+PPPFFVVDG+D++G  +AYL++QGV+T+IEAQ+W+ + GY +LR
Sbjct  27   QRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLR  86

Query  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSG  145
            A++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCE+W+D+T   +G
Sbjct  87   ALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAG  146

Query  146  RNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            RNCHTEFP G H +DYS CG++C +SW+WLGIKY    YSWQV+KNC+ LS +
Sbjct  147  RNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199

 Score = 163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 106/160 (66%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +++DYS+C  +CTL WYWLG++Y++ +YSWQVYK CV +S
Sbjct  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

>PYU1_G001739
Length=266

 Score = 211 bits (536),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 0/160 (0%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +   +M+Q GY +LRA++DDE LY+V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
              +A+FECG T P  E+QPIPT  + +++GYT DGPCEVWLDD KV SG NCH +FP   
Sbjct  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
              +DYSSC  +CTL WYWLG++Y++  YSWQ+YK CV LS
Sbjct  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184

>PHYKE_8390
Length=130

 Score = 196 bits (499),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)

Query  26   QRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLR  85
            QRRL A LGEGQ+VL PPPFF+VDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SLR
Sbjct  20   QRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLR  79

Query  86   AMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  133
            AMLDDE+LYKVTEEA+F+CGLTSP+TETQ IPTN++FQTSGYT+DGPC
Sbjct  80   AMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PYU1_G001738
Length=226

 Score = 194 bits (492),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 0/157 (0%)

Query  39   VLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTE  98
            VL+P PF++VDG + Q   +A+L+EQG+ TS +   +M+Q GY +LRAMLDD+ LY V  
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  99   EAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHE  158
            +A+ ECG T P  E+QPIP  N+F ++GY L+GPCEVWLDD KV S  NCHT++P     
Sbjct  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144

Query  159  VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            +DYSSC  +C L WYWLGI+ +   YSWQVYK CV L
Sbjct  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PYIW_18788
Length=244

 Score = 184 bits (466),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 110/164 (67%), Gaps = 1/164 (1%)

Query  39   VLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTE  98
            V +P PFF++DG      ++A L++Q V TS +   +++Q GY SLRAMLDDE+LY V  
Sbjct  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89

Query  99   EAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHE  158
            ++IFECG T P  E+QPIPTN   + +GY  DGPCE+W+DD K+ S  NC  +FP    +
Sbjct  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149

Query  159  VDYSSCGKACTLSWYWLGI-KYIEGIYSWQVYKNCVGLSTAPTA  201
            +DYSSC   CTL WY L + K   G YSW+VYKNCV LS  PTA
Sbjct  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTA  193

>PYU1_G001740
Length=206

 Score = 177 bits (448),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+V+ P P F V   D +   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV
Sbjct  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A FECG T+     QPIP N  F+T+GYT DGPCEVWLD+TKV SG NCH +FP   
Sbjct  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            H + Y++C  +CTL WYW+GI++++G +SWQVYK CV L
Sbjct  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PYIR_25089
Length=262

 Score = 177 bits (450),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 110/167 (66%), Gaps = 0/167 (0%)

Query  30   DAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLD  89
            D  +   Q V+ P P F V     Q   LA+L+ QG  T+ +  ++ +  GY +LRA +D
Sbjct  22   DTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMD  81

Query  90   DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCH  149
            D+S YKV + A FECG T      QPIP+ ++ +++GYT DGPCEVWLD T+V  G NCH
Sbjct  82   DKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCH  141

Query  150  TEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +EFP    ++DYSSC  +C L WYW+GI++++G YSWQVYKNCV ++
Sbjct  142  SEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVT  188

>PPTG_10635
Length=199

 Score = 172 bits (436),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 106/160 (66%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  D +   LA+L+ QG  T  + +SW  ++GY SLR  +D  + Y+V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  70

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + VDYSSC  +CTL WYWLG+++++  YSWQVYK C+ L+
Sbjct  131  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLT  170

>PHYRA_85631
Length=228

 Score = 172 bits (435),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   LA+L+ +G  T  +  SW  ++GY SLR  +D+ + Y V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
             + A F CG T P+   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + VDYSSC   CTL WYWLGI++++  YSWQVYK C+ L+
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLT  187

>PHYRA_84190
Length=206

 Score = 170 bits (431),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 105/160 (66%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  D  D +   LA+L+ +G  T  +  +W  ++GY SLR  +D+ + Y V
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP +N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  130

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + VDYSSC   CTL WYW+G+++++  YSWQVYK C+ L+
Sbjct  131  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLT  170

>PHYCA_14369
Length=248

 Score = 171 bits (433),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 103/160 (64%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  D +   LA+L+ QG  T  +  +W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + VDYSSC   CTL WYWLG+++++  YSWQVYK C+ L+
Sbjct  148  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLA  187

>PYU1_G001742
Length=213

 Score = 170 bits (430),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 1/159 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V+ P P F V     Q   LA+L+ QG  T+++  ++ +  GY +LRA +DD   YKV
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A F+CG T    + QPIP   + +++GYT DGPCEVWLD T+V  G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
             ++DYSSC  +CTL WYW+GI++++G YSWQVYKNCV +
Sbjct  148  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PYU1_G001744
Length=213

 Score = 169 bits (429),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 1/159 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V+ P P F V     Q   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A F+CG T    + QPIP   + +++GYT DGPCEVWLD+T V  G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            H++ Y+SC  +CTL WYW+GI++++G YSWQVYKNCV +
Sbjct  148  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PHYSO_341599
Length=185

 Score = 168 bits (426),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 105/165 (64%), Gaps = 1/165 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  + +   LA+L+ QG  T  +  +W +++GY SLR  +D  + Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  70

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP  N  +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            + VDYSSC   CTL WYWLG+++++  YSWQVYK C+ L++   A
Sbjct  131  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  175

>PPTG_10636
Length=246

 Score = 171 bits (432),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  D +   LA+L+ QG  T  +  SW  ++ Y SLR  +D+ + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + VDYSSC   CTL WYWLGI++++  YSWQVYK C+ LS
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  187

>PHYSO_536424
Length=197

 Score = 169 bits (427),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 1/175 (1%)

Query  27   RRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRA  86
            RR    +   Q+VL P P +  +  + +   LA+L+ +G  T  +  +W +++GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  87   MLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGR  146
             +D  + Y VT  A F CG T P+   QPIP  N  +++GYT DGPCEVWLDDT V  G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  147  NCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            NCH +FP   + VDYSSC   CTL WYWLG+++++  YSWQVYK C+ L++   A
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYSO_507031
Length=197

 Score = 169 bits (427),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 108/175 (62%), Gaps = 1/175 (1%)

Query  27   RRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRA  86
            RR    +   Q+VL P P +  +  + +   LA+L+ +G  T  +  +W +++GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  87   MLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGR  146
             +D  + Y VT  A F CG T P+   QPIP  N  +++GYT DGPCEVWLDDT V  G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  147  NCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            NCH +FP   + VDYSSC   CTL WYWLG+++++  YSWQVYK C+ L++   A
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYCA_102624
Length=195

 Score = 167 bits (423),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 103/161 (64%), Gaps = 1/161 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D Q   L +L+  G  T  +  +W +++GY SLR  +D+   Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            +E A F+CG T P    QPIP  N+ +++GYT DGPCEVW+DDT V  G NCH +FP   
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197
            + +DYS C   CTL WYWLG+++++  YSWQVYK C+ L++
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTS  188

>PPTG_10634
Length=208

 Score = 167 bits (423),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 1/159 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  + +   LA+L+ +G  T  +  +W +++GY SLR  LD+   Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A F+CG T P+   QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            + VDYSSC   CTL WYWLG+++++  YSWQVYK C+ L
Sbjct  148  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PYU1_G001741
Length=199

 Score = 166 bits (420),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V+ P P F V     Q   LA+L+ QG  T+ +  ++ +  GY +LRA +DD+  Y V
Sbjct  28   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A FECG T      Q IP   + +++GYT DGPCEVWLD T+V  G NCHTEF    
Sbjct  88   ASGADFECGWTKLDGTRQSIPAG-TIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            H +DYSSC  +CTL WYW+GI++++G YSWQVYKNCV + ++
Sbjct  147  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSS  188

>PHYCA_102852
Length=195

 Score = 166 bits (420),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  D +   LA+L+ +G  T  +  +W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A F+CG T P    QPIP  N+ +++GYT DGPCEVWLDDT V  G NCH +FP   
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + +DYSSC   CTL W+WLG+++++  YSWQVYK C+ L+
Sbjct  148  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLT  187

>PHYCA_102550
Length=268

 Score = 166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 101/160 (63%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D Q   LA+L+ QG  T  +  +W  ++GY SLR  +D  + Y V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A F+CG T P    QPIP  N+ +++GYT DGPCEVW+DDT V  G NCH +FP   
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + +DYS C   CTL WYWLG+++++  YSWQVYK C+ L+
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLA  187

>PHYSO_477820
Length=202

 Score = 163 bits (412),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 102/165 (62%), Gaps = 1/165 (1%)

Query  34   GEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESL  93
            G  QVVL P P +  D    +   LA+L++QG  T  +  +W   +GY SLRA  D  S 
Sbjct  23   GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS-  81

Query  94   YKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFP  153
            Y V + A F CG T+   E QPIP +N+ +++GYT DGPCEVWLDDT V    NCH    
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  154  HGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
               + +DYSSC   CTL W+WLG++Y++  YSWQ+YK CV LST+
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTS  186

>PPTG_15264
Length=194

 Score = 162 bits (411),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 103/165 (62%), Gaps = 3/165 (2%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +  +W + +GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A + CG T P+   QPIP   + +++GYT DGPCEVWLDD +V  G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  157  HEVDYSSCGK--ACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAP  199
            + +DYSSC K   C L WYWLG+++++  YSWQVYK C+ L+T P
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTP  189

>PPTG_17366
Length=194

 Score = 162 bits (411),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 103/165 (62%), Gaps = 3/165 (2%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +  +W + +GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A + CG T P+   QPIP   + +++GYT DGPCEVWLDD +V  G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  157  HEVDYSSCGK--ACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAP  199
            + +DYSSC K   C L WYWLG+++++  YSWQVYK C+ L+T P
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTP  189

>PHYKE_8388
Length=205

 Score = 162 bits (410),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 101/162 (62%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D    +   LA+L++QG +T  +  +W   +GY SLRA  DD S Y V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            ++ A F CG T      QPIP +N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL W+W+G++Y++  YSWQVYK CV LS +
Sbjct  148  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSAS  189

>PPTG_10048
Length=190

 Score = 161 bits (408),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 104/164 (63%), Gaps = 1/164 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVLHP P ++ D  D Q   LA+L+ QG  T  + +SW  Q+GY +LR  ++  + Y V
Sbjct  26   QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A F CG T+P+   QPIP     +++GYT +GPCE+W+ DT+V    NCH   P  +
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  144

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPT  200
            + +DYS C   C L WYWLG+++++  YSWQVYK C+ L+T  T
Sbjct  145  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNST  188

>PHYRA_82864
Length=193

 Score = 161 bits (407),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 104/161 (65%), Gaps = 2/161 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   LA+L+ QG  T  +  +W + +GY +LR  +D  + Y V
Sbjct  29   QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A + CG T P    QPIP  N  +++GYT DGPCEVWLD+T+V  G NCH +FP   
Sbjct  88   TEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKD  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197
            + +DYSSC   CTL WYW+G+++++  YSWQVYK C+ L++
Sbjct  147  YPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTS  187

>PHALS_00498
Length=199

 Score = 159 bits (403),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 106/168 (63%), Gaps = 1/168 (1%)

Query  29   LDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAML  88
            L   +   Q+VL P P +  +  D +   LA+L+ Q   T+ +AQ++ +Q+ + +LR  +
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  89   DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNC  148
            D+   Y V + A   CG T P    QPIP NN+ +++GYT DGPCEVWL++T+V S  NC
Sbjct  81   DNAK-YTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  139

Query  149  HTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            H +FP   + +DYSSC   C L WYWLG+++++  YSWQVYK C+ LS
Sbjct  140  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLS  187

>PHYKE_8389
Length=204

 Score = 159 bits (402),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 101/162 (62%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   LA+L+ QG  T  +  +W + +GY +LRA +D    Y V
Sbjct  28   QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTV  86

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A + CG T+     Q IP+ N+ +++GYT DGPCEVWLD T+V +  NCH       
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL WYWLG+++++  YSWQVYK CV LS +
Sbjct  147  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSAS  188

>PHYRA_81107
Length=202

 Score = 158 bits (399),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D    +   LA+L++QG +T  +  +W +++GY SLRA  DD + Y V
Sbjct  26   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            ++ A F CG T    + Q IP  N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  144

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL W+W+G++Y+   YSWQVYK CV LS +
Sbjct  145  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSAS  186

>PPTG_10643
Length=250

 Score = 159 bits (402),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  D +   LA+L+ QG     +  +W +++GY SLR  +D  + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T+P+   QPIP     +++GYT DGPCEV+LDDT V  G NCH +FP   
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
              +DYSSC   CTL WYWLGI++++  YSWQVYK C+ L
Sbjct  148  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PPTG_17121
Length=202

 Score = 157 bits (398),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 101/162 (62%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL   P +  D  D +   LA+L++QG  T  +  +W + +GY SLRA  D  S Y V
Sbjct  26   QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-YTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            ++ A   CG T+   + QPIP  N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  144

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL W+WLG++Y++  YSWQ+YK CV LST+
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTS  186

>PHYCA_511409
Length=204

 Score = 157 bits (398),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D    +   LA+L++QG  T  +  +W Q +GY SLRA  +D + Y V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  86

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            ++ A F CG T+   + Q IP  N+ +++GYT DGPCEVWLDDT V    NCH       
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL W+WLG++Y++  YSWQ+YK CV LS +
Sbjct  147  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSAS  188

>PYIR_26626
Length=212

 Score = 157 bits (397),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 107/169 (63%), Gaps = 2/169 (1%)

Query  30   DAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLD  89
            D+ +   Q V+ P P F     +     LA+L+ QG  T+ +   +++  GY +LRA +D
Sbjct  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81

Query  90   DESLYKVTEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNC  148
            D+  YKV    A FECG T+   + QPIP   + +++GYT DGPCEVWLD+TKV SG NC
Sbjct  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNC  140

Query  149  HTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197
            + +FP   H + Y+SC  +CTL WYW+G+++++  +SWQVYK CV + +
Sbjct  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189

>PHYRA_81106
Length=202

 Score = 155 bits (393),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   LA+L+ QG  T  +  +W + +GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
             + A + CG T+     Q IP  N+ +++GYT DGPCEVWLD T+V +  NCH       
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL WYW+G++Y++  YSWQVYK CV LS +
Sbjct  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189

>PHYCA_129425
Length=204

 Score = 155 bits (392),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 102/162 (63%), Gaps = 2/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A + CG T+ +   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC  +C L WYWLG ++++  +SWQVYK C+ LS++
Sbjct  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188

>PHYKE_7718
Length=220

 Score = 155 bits (391),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  D  D +   LA+L+ +G     +  +W  ++GY SLR  +D+ + Y V
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  91

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A   CG T P    QPIP  N+ +++GYT DGPCEVW+DDT      NCH  FP   
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  151

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            + +DYS+C   CTL WYWLG+++++  YSWQVYK C+ L+
Sbjct  152  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  191

>PHYKE_3446
Length=199

 Score = 154 bits (388),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 102/161 (63%), Gaps = 1/161 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  D  + +   LA+L+ QG  T  +A +W + +GY +LRA +D  + Y+V
Sbjct  29   QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A + CG T P    QPIP   + +++GYT DGPCEVW+D+T+V    NCH       
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  147

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197
            + +DYS+C   C L WYWLG+++++  YSWQVYK C+ L++
Sbjct  148  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTS  188

>PHYSO_284086
Length=204

 Score = 154 bits (388),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 102/162 (63%), Gaps = 2/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D    +   LA+L+ QG  T  +  +W +  GY +LRA +D  S Y V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
             + A + CG T  +   QPIP + + +++GYT DGPCEVWLD T+V    NCH  F    
Sbjct  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            +++DYSSC  +CTL WYWLG+++++  YSWQVYK CV LST+
Sbjct  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTS  188

>PPTG_17122
Length=204

 Score = 150 bits (380),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 98/162 (60%), Gaps = 2/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR  +D  + Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A + CG T+     QPIP + + +++GYT DGPCEVWLD  +V    NCH       
Sbjct  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL WYWLG++Y++  YSWQ+YK C+ LS +
Sbjct  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSAS  188

>PYIW_18791
Length=194

 Score = 149 bits (377),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 103/166 (62%), Gaps = 2/166 (1%)

Query  32   GLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDE  91
            G    Q V  P P + V         L++L++ GV TS     +M+  GY++LRA++DD 
Sbjct  18   GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  77

Query  92   SLYKVTEEAI-FECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHT  150
             LYK    A  F CG T P   +Q IP +++ +T+GYT  GPCEVW+DD +V +G NCH 
Sbjct  78   KLYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHE  137

Query  151  EFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +  +   +VDYS+C   CT+ WYWLG++Y++  +SWQVYKNC+ L+
Sbjct  138  QVSN-TTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PHALS_03284
Length=188

 Score = 149 bits (376),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 99/162 (61%), Gaps = 1/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q++L P P +  +  D +   LA+L+ Q   TS +   +++++ Y SLR  L   + Y V
Sbjct  15   QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANYTV  73

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            TE A  +CG T P    QPIP  N+ + +GYT DG CE+WLDDTKV SG NCH +FP   
Sbjct  74   TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  133

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
              VDYSSC   C + WYWL ++ ++  YSWQVYK C+ L+ +
Sbjct  134  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRS  175

>PYAP_22273
Length=268

 Score = 146 bits (368),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 2/140 (1%)

Query  59   AYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPT  118
            A L+ QG  T+ +  +++  +GY +LR  +D    YK  + A  ECG T P    QPIPT
Sbjct  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108

Query  119  NNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ--HEVDYSSCGKACTLSWYWLG  176
            N  F+TSGYT +GPCE+W+DD  V SG+NCH +        ++DYS+C   C L WYWLG
Sbjct  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168

Query  177  IKYIEGIYSWQVYKNCVGLS  196
            I+ +   YSWQ+YK C+ L+
Sbjct  169  IRPMGKKYSWQIYKACIPLA  188

>PYAR_24096
Length=227

 Score = 143 bits (360),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 2/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V  P   + V   +      A L++QG  T+ +  ++++ + Y +LR  +D    YK 
Sbjct  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
               A FECG T P+   QPIP + +F+TSGYT +GPCE+W+DD +V  G NCH +     
Sbjct  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147

Query  157  --HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
               ++DYS+C   C L WYWLGI+     YSWQ+YK C+ LS
Sbjct  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PYVX_18174
Length=204

 Score = 142 bits (358),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 96/163 (59%), Gaps = 4/163 (2%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V+ P P +     D     LA+L++QG  T  +  +W + +GY +LRA +D  S Y V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A   CG T      QPIP N  F+++GYT DGPCE+WLD T+V +  NCH       
Sbjct  88   TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKD  145

Query  157  HEVDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
              +DYS      CTL WYW+G++Y+   YSWQVYKNCV LST+
Sbjct  146  TAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTS  188

>PYVX_18176
Length=201

 Score = 141 bits (356),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 97/162 (60%), Gaps = 2/162 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V+ P P +  D  D     LA+L++QG +T  +  +W   +GY SLRA +D  S Y V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A   CG T+     Q +P +   +++GYT  GPCEVWLDDT V    NCH       
Sbjct  85   TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKT  143

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            +++DYSSC   CTL W+W+G++Y+   YSWQVYKNCV LS +
Sbjct  144  YDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSAS  185

>PITG_18450
Length=203

 Score = 140 bits (352),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 95/162 (59%), Gaps = 5/162 (3%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            QVVL P P +  D  D +   L +L+ QG  T  +   W + +GY +LR  ++    Y V
Sbjct  29   QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
             + A + CG T+     QP P + + +++GYT DGPCEVWLD T+V    NCH       
Sbjct  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            + +DYSSC   CTL WYWLG+++++  YSWQ+YK C+ LS +
Sbjct  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSAS  185

>PYIR_26546
Length=239

 Score = 140 bits (354),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 104/170 (61%), Gaps = 3/170 (2%)

Query  29   LDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQ-GVNTSIEAQSWMQQHGYTSLRAM  87
            LD+     Q+V+ P P + ++G   Q   +AYL+ Q G + + +   ++   G+ ++R  
Sbjct  21   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  80

Query  88   LDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRN  147
            +D++ LY+   +A F+CG T    E QPIP N+  +T+GYT +GPCE+WLDD KV  G+N
Sbjct  81   MDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  140

Query  148  CHTEFPHGQH--EVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            CH +   G +  ++D+SSC   CT+ WYW+GI+      SWQ+YK C+ L
Sbjct  141  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PYAP_22279
Length=223

 Score = 134 bits (336),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 6/164 (4%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q +  P P    D  +     LA+L+ QGV  + +   +++Q G  +LR  +D+++ YKV
Sbjct  23   QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  97   TEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV--SSGRNCHTEFP  153
                A FECG T P    QPIP+N   +++GYT DGPCEVWLD+T+V  S+  +CH +  
Sbjct  82   EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIG  141

Query  154  HG--QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
             G   +++D+S C   C L WYWL  + I   +SWQVYK CV L
Sbjct  142  QGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PYAP_22278
Length=289

 Score = 132 bits (331),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 99/171 (58%), Gaps = 6/171 (4%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V  P P F  +  +     LA+L+ QGV    +   +++  G  +LR  +D+++ YK+
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  97   TEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV--SSGRNCHTEFP  153
                A FECG T+P    QPIP N   +++GYT DGPCEVWLD+T+V  S   NCH +  
Sbjct  86   EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVG  145

Query  154  HG--QHEVDYSSCGKACTLSWYWLGIKYIEG-IYSWQVYKNCVGLSTAPTA  201
            +    +++D+S C   C L WYWLG + I G  +SWQ+YK CV L  + TA
Sbjct  146  NKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTA  196

>PPTG_08820
Length=250

 Score = 129 bits (324),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (58%), Gaps = 5/165 (3%)

Query  37   QVVLHPPPFFV--VDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLY  94
            Q++L P P +   ++  D +   LA+L+ QG     +   W  Q GY +LR  +D     
Sbjct  29   QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYT  88

Query  95   -KVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFP  153
              VT  A   CGLT  +   +PIP +   +++GYT DGPC V+LDD  V    NCH + P
Sbjct  89   TSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLP  148

Query  154  HGQHEVDYSSCGK--ACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
               +++DYSSC K   CTL W+WLGI++++  +SWQVYK CV L+
Sbjct  149  GKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLT  193

>PHALS_06480
Length=159

 Score = 126 bits (317),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)

Query  27  RRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRA  86
           RRL+AGLGEGQVVL+P PF+VVDGLDFQGMALAYL+EQG+NTSIE QSWM+ H Y SLRA
Sbjct  25  RRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRA  84

Query  87  MLDDESLYK  95
           MLDD+ LYK
Sbjct  85  MLDDDMLYK  93

>PHYCA_510817
Length=188

 Score = 127 bits (319),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 87/138 (63%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            L++L+++G  T      +   +GY SLR  ++ ++ YKV++ A   CG + P+   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
            ++ + +TSGYT DGPCE+W+ D    S  NCH   P    ++DYS CG +C L WYWLG+
Sbjct  109  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  178  KYIEGIYSWQVYKNCVGL  195
            + ++G YSWQVYK C+ L
Sbjct  169  RKLKGKYSWQVYKECIPL  186

>PHYSO_499978
Length=174

 Score = 126 bits (316),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  + +   LA+L+ QG  T  + + W  ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A F CG T P+   QPIP  ++ +++GYT DGPCEVW+D+T+V  G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  157  HEVDYSSCGKACTLSWYW  174
            + +DYS+C   CTL WYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 126 bits (316),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +  + +   LA+L+ QG  T  + + W  ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T+ A F CG T P+   QPIP  ++ +++GYT DGPCEVW+D+T+V  G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  157  HEVDYSSCGKACTLSWYW  174
            + +DYS+C   CTL WYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PPTG_14254
Length=188

 Score = 125 bits (313),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            L++L+++G  T      +   +GY SLR  +D  + YKVTE A   CG T P+   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
             + + +T+GYT DGPCE+++ +    S  NCH   P    ++DYS CG +C L WYWLG+
Sbjct  109  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  178  KYIEGIYSWQVYKNCVGL  195
            + ++G YSWQVYK C+ +
Sbjct  169  RKLKGKYSWQVYKECIPI  186

>PPTG_14255
Length=268

 Score = 125 bits (314),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            L++L+++G  T      +   +GY SLR  +D+ + Y VT+ A   CG T P+   Q IP
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  107

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
             + + +TSGYT DGPCE+++ DT   S  NCH        ++DYS+CG +C L WYWLG+
Sbjct  108  EDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV  167

Query  178  KYIEGIYSWQVYKNCVGL  195
            +Y++  YSWQVYK C+ L
Sbjct  168  RYLKKKYSWQVYKECIPL  185

>PITG_13520
Length=171

 Score = 121 bits (303),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%), Gaps = 1/128 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +     D +   LA+L+ QG  T  + ++W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  87

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP   + +++GYT DGPCEVWLDD  V  G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKD  147

Query  157  HEVDYSSC  164
            + VDYSSC
Sbjct  148  YTVDYSSC  155

>PHYKE_9185
Length=281

 Score = 123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 86/138 (62%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            L++L+++G+ T      +   + Y SLR  +D ++ YKV++ A   CG T P+   Q IP
Sbjct  52   LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  110

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
             + + +TSGYT DGPCE+++ D    S  NCH        ++DYS+CG +C L WYWLG+
Sbjct  111  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGV  170

Query  178  KYIEGIYSWQVYKNCVGL  195
            + ++G YSWQ+YK C+ L
Sbjct  171  RKLKGSYSWQIYKECIPL  188

>PHYSO_417649
Length=185

 Score = 119 bits (299),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            L++L+++G  T      +   +GY SLR  ++  + YK+T+ A   CG T P+   Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
             + + +TSGYT DGPCE+++ D    S  NCH        ++DYS CG +C L WYWLG+
Sbjct  107  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  166

Query  178  KYIEGIYSWQVYKNCVGL  195
            + ++G +SWQVYK C+ L
Sbjct  167  RKLKGKFSWQVYKECIPL  184

>PHYSO_343376
Length=172

 Score = 118 bits (296),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (57%), Gaps = 4/150 (3%)

Query  28   RLDAGLGEGQVVLHPPPF---FVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSL  84
            R  A L   +  L   P    +  +  + +   LA+L+ QG  T  + ++W  ++GY +L
Sbjct  15   RKQASLAAVRAALRGRPVAAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTL  74

Query  85   RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSS  144
            R  +D    Y VT+ A F CG T P+   QPIP  ++ +++GYT DGPCEVW+D+T+V  
Sbjct  75   RDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQ  133

Query  145  GRNCHTEFPHGQHEVDYSSCGKACTLSWYW  174
            G NCH +     + +DYS+C   CTL WYW
Sbjct  134  GDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PITG_10499
Length=323

 Score = 122 bits (306),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 92/161 (57%), Gaps = 5/161 (3%)

Query  41   HPPPFFV--VDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDES-LYKVT  97
             P P +   ++  D +   LA+L+ QG     +   W  ++GY  LR  +D    +  VT
Sbjct  3    QPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVT  62

Query  98   EEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQH  157
              A   CGLT  +   +PIP + + +++GYT DGPC ++LDD  V    NCH   P   +
Sbjct  63   PGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTY  122

Query  158  EVDYSSCGK--ACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            ++D+SSC K   CTL W+WLGI++++  +SWQVYK C+ L+
Sbjct  123  KIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PHYSO_254168
Length=170

 Score = 117 bits (292),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 89/155 (57%), Gaps = 18/155 (12%)

Query  47   VVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGL  106
             V+  D +   LA+L+ QG  T     +  + +GY +LR  +D    Y VT+ A + CG 
Sbjct  27   AVEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGW  85

Query  107  TSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGK  166
            T+P+   QPIP     +++GYT DGPCE+WLDD +V                +DYSSC K
Sbjct  86   TNPKGTPQPIP-----RSTGYTHDGPCEIWLDDVRVL----------ERSPTIDYSSCEK  130

Query  167  --ACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAP  199
               CT+ WYWLG+++++  YSWQVYK C+ L+ AP
Sbjct  131  KGGCTMHWYWLGVRFLKNSYSWQVYKECIPLTAAP  165

>PHYCA_536934
Length=983

 Score = 123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 82/138 (59%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            L++L+++G  T      +   +GY +LR  +D+   Y VT+ A   CG + P    Q IP
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIP  124

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
             + + +TSGYT DGPCE+W+ D    S  NCH        ++DYS CG +C L WYWLG+
Sbjct  125  EDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  184

Query  178  KYIEGIYSWQVYKNCVGL  195
            +Y++  YSWQVYK C+ L
Sbjct  185  RYLKKKYSWQVYKECIPL  202

>PHYSO_262732
Length=188

 Score = 114 bits (286),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 77/136 (57%), Gaps = 15/136 (11%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            LA+L+ QG  T               LR  +D+   Y VTE A   CG T P+   Q IP
Sbjct  49   LAFLENQGFQTH--------------LRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIP  93

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
            ++ + +TSGYT DGPCE+++ D    S  NCH        ++DYS CG +CTL WYWLG+
Sbjct  94   SDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGV  153

Query  178  KYIEGIYSWQVYKNCV  193
            +++   YSWQVYK C+
Sbjct  154  RFLNNKYSWQVYKECI  169

>PHYSO_340369
Length=200

 Score = 111 bits (277),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 15/140 (11%)

Query  56   MALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  115
            M LAY ++QG NTS     W   +G+ +LR  +D+ +             +TSP    Q 
Sbjct  50   MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNY-----------SVTSP----QQ  94

Query  116  IPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWL  175
            IP +N  +T GYT DGPCE+WLD+T   S  +C    P+  + +DYS CG +C + WY L
Sbjct  95   IPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTL  154

Query  176  GIKYIEGIYSWQVYKNCVGL  195
            G+   + +YSW+VYK C+ L
Sbjct  155  GVAKPDRVYSWEVYKECIPL  174

>PHYSO_527908
Length=174

 Score = 106 bits (264),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 75/126 (60%), Gaps = 1/126 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            LA+L+ QG  T      +M  +GY SLR  +D+ + Y VT+ A   CG T P    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  107

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGI  177
             + + +TSG+T D PCE+++ D    S  NCH        ++DYS+CG +C L WYWLG+
Sbjct  108  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  167

Query  178  KYIEGI  183
            ++I+GI
Sbjct  168  RFIKGI  173

>PHYSO_341596
Length=231

 Score = 107 bits (268),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 1/96 (1%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            LA+L+ QG  T  +  SW  ++GY SLR  +D ++ Y VT  A F CG T P+   QPIP
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  100

Query  118  TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFP  153
              ++ +++GYT DGPCEVWLDDTKV  G NCH +FP
Sbjct  101  AGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFP  136

>PYAP_18131
Length=226

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 71/119 (60%), Gaps = 7/119 (6%)

Query  88   LDDESLYKVTEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGR  146
            +DD++ YKV    A FECG T P    QPIP N   +++G+T DG   VW+D+T+V   +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  147  --NCHTEFPHG--QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
              NCH     G   +++D+S C   C + WYWLG++ +   +SWQVYK C+ +  + TA
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PHYCA_14368
Length=219

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 76/168 (45%), Gaps = 46/168 (27%)

Query  29   LDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAML  88
            LD+     Q+VL P P +  +  D +   LA+L+ QG  T  +  SW  ++ Y SLR  +
Sbjct  21   LDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM  80

Query  89   DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNC  148
            D+ + Y VT+ A F CG T P+                                      
Sbjct  81   DN-AKYTVTDGADFSCGFTDPK--------------------------------------  101

Query  149  HTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
                    + VDYSSC   CTL WYWLGI++++  YSWQVYK C+ LS
Sbjct  102  -------DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  142

>PHYSO_342364
Length=194

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 15/126 (12%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN-NSFQTSGYTLDGPCEVWL  137
            H Y  LR +LD+ ++Y         CG T+P    QPIPTN  +  + G    GPCE+WL
Sbjct  73   HNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWL  126

Query  138  DDTKVSSGRNCHTEFPHG------QHEVDYSSCGK--ACTLSWYWLGIKYIEGIYSWQVY  189
            DD KV +  +C++++ H       +  VDYS C     C + +YWLG + +     WQ Y
Sbjct  127  DDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTY  186

Query  190  KNCVGL  195
            KNC+ L
Sbjct  187  KNCIPL  192

>PHYRA_74651
Length=344

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 71/133 (53%), Gaps = 16/133 (12%)

Query  74   SWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDG  131
            S  + +GY+ +R +LD D SLY        +CG T P  T   P  T ++  + G    G
Sbjct  71   SLKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATFSRGMVHAG  124

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSC-GKACTLSWYWLGIKYIEGI  183
            PCE+WLDDTKV S  NC   +  G  E       VDYSSC    CTL +YWL  + ++  
Sbjct  125  PCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSS  184

Query  184  YSWQVYKNCVGLS  196
              WQVYKNCV L+
Sbjct  185  TVWQVYKNCVPLT  197

>PHYRA_73607
Length=343

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 71/133 (53%), Gaps = 16/133 (12%)

Query  74   SWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDG  131
            S    +GY+ +R +LD D SLY        +CG T+P  T   P  T ++  + G    G
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGI  183
            PCE+WLDDTKV S  NC   +  G  +       VDYSSC  + C L +YWL  + ++  
Sbjct  125  PCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSS  184

Query  184  YSWQVYKNCVGLS  196
              WQVYKNCV L+
Sbjct  185  MVWQVYKNCVPLT  197

>PHYRA_73584
Length=287

 Score = 87.8 bits (216),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 17/138 (12%)

Query  74   SWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDG  131
            S  + +GY+ +R +LD D +LY         CG T+P  T   P  T ++  + G    G
Sbjct  68   SLKKSNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHAG  121

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGI  183
            PCE+WLDDT V S  +C T +  G  E       VDYSSC  + C L +YWL  + ++  
Sbjct  122  PCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSK  181

Query  184  YSWQVYKNCVGLSTAPTA  201
              WQVYK+CV L T P A
Sbjct  182  TVWQVYKDCVPL-TGPAA  198

>H310_06362
Length=197

 Score = 85.1 bits (209),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 70/135 (52%), Gaps = 27/135 (20%)

Query  80   GYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGYTLD--G  131
            G+ +LRAMLD             +CG T      +PIPT+      N     G+     G
Sbjct  51   GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  132  PCEVWLDDTKVSSGRNCHTEFPH---GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQV  188
            PCE+WLD+T+V    NC   FP     Q  VD+SSC  +CT+ +YWL +   E +  WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH--EDL--WQV  157

Query  189  YKNC---VGLSTAPT  200
            YKNC   VGL+ +PT
Sbjct  158  YKNCAPLVGLAASPT  172

>PPTG_04622
Length=273

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 69/133 (52%), Gaps = 16/133 (12%)

Query  74   SWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDG  131
            S  + +GY+ +RA+LD D  LY         CG T P  T   P  T ++  + G    G
Sbjct  71   SLKESNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGK-ACTLSWYWLGIKYIEGI  183
            PCE+WLDDT V S  +C T +  G  +       VDYSSC    C L +YWL  + ++  
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  184  YSWQVYKNCVGLS  196
              WQVYK+CV L+
Sbjct  185  MVWQVYKDCVPLT  197

>PHYCA_534473
Length=1050

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 70/133 (53%), Gaps = 16/133 (12%)

Query  74   SWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDG  131
            S  + +GY+ +R +LD D  LY         CG T P  T   P  T ++  + G    G
Sbjct  843  SLKESNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATFSRGMVHAG  896

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGI  183
            PCE+WLDDTKV S  +C T +  G  E       VDYSSC  + C L +YWL  + ++  
Sbjct  897  PCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  956

Query  184  YSWQVYKNCVGLS  196
              WQVYK+CV L+
Sbjct  957  IVWQVYKDCVPLT  969

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 63/130 (48%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPRTETQ-PIPTNNSFQTSGYTLDGPCE  134
            + +    +R M+D D  LY        +CG T P+ + + P  T ++  + G    GPCE
Sbjct  541  KSNNVKDIRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCE  594

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSW  186
            +WLDD  V    +C + +  G          VDYSSC    C   +YWL ++  +    W
Sbjct  595  IWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLW  654

Query  187  QVYKNCVGLS  196
            QVYKNC+ L+
Sbjct  655  QVYKNCIPLT  664

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVW  136
            ++ Y  +R ++D   +Y        +CG T P+      PT+ +   S G    GPCE+W
Sbjct  73   KNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  126

Query  137  LDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGK-ACTLSWYWLGIKYIEG  182
            LDD  V    +C   +  G  E       VDYSSC    C L +YWL ++ ++G
Sbjct  127  LDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG  180

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 54/109 (50%), Gaps = 16/109 (15%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  141
            +R +LD D  LY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  285  IRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  338

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGK-ACTLSWYWLGIKYIEG  182
            V S  +C + +  G  E       VDYSSC    C   +YWL ++ ++G
Sbjct  339  VLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDG  387

>PYAP_18711
Length=210

 Score = 83.2 bits (204),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 13/124 (10%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEV  135
            ++ G  +LRA L+ +           ECG T+P  + +PIP++   +  S     GPCEV
Sbjct  66   KKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEV  116

Query  136  WLDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVG  194
            W D+T V S  +C   F    Q ++DYS C   C L +YWLG++  +G   WQ YKNCV 
Sbjct  117  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  195  LSTA  198
            + +A
Sbjct  175  IGSA  178

>PHYSO_533903
Length=208

 Score = 82.8 bits (203),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 68/127 (54%), Gaps = 16/127 (13%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN-NSFQTSGYTLDGPCEVWL  137
            + +  L+ MLDD SLY        +CG T P    QPIPT+  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  138  DDTKVSSGRNCHTEFPHG------QHEVDYSSC--GKACTLSWYWLGIKYIEGIYS-WQV  188
            DD KV    +C++E+ H       +  +DYSSC  G    + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  189  YKNCVGL  195
            YK+C+ L
Sbjct  188  YKDCIPL  194

>PYIR_16435
Length=304

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (57%), Gaps = 14/122 (11%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEV  135
            ++ GY++LR+ ++D+            CG T+P    + IP++N+ + S   +  GPCE+
Sbjct  72   KEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPCEL  122

Query  136  WLDDTKVSSGRNCHTEFPHG--QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            WLDD +V    NC   F       ++D+SSC  +C L W+WLG++  +    WQVYKNCV
Sbjct  123  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCV  180

Query  194  GL  195
             L
Sbjct  181  PL  182

>PYAP_24689
Length=252

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 13/132 (10%)

Query  66   VNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-T  124
            + T  +  +  ++HG  +LRA L+ +            CG T+P  + +PIP +   +  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  125  SGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGI  183
            S     GPCE+W D+T+V    +C+  F    Q ++DYS C   C L +YWLG++  +G 
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGG  166

Query  184  YSWQVYKNCVGL  195
              WQ YKNCV L
Sbjct  167  KRWQSYKNCVPL  178

>PHYSO_484051
Length=285

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDG-PCE  134
            + +GY+ +R +LD D SLY        +CG T+P    +  PT      S   +   PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSW  186
            +WLDDT V S  +C T +  G  E       VDYSSC  + C L +YWL  + ++    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  187  QVYKNCVGLS  196
            QVYK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PHYKE_2937
Length=366

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 70/130 (54%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  134
              +GY+ +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  78   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  131

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSW  186
            +WLDDT V S  +C T +  G  +       VDYSSC  + C L +YWL  + ++    W
Sbjct  132  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  191

Query  187  QVYKNCVGLS  196
            QVYK+CV L+
Sbjct  192  QVYKDCVPLT  201

>PYVX_14662
Length=540

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDG  131
            +S   + G T +R++LDD S+Y        +CG T P    Q IPT+     S G    G
Sbjct  68   KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATFSRGMVHVG  121

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHEV------DYSSC--GKACTLSWYWLGIKYIEGI  183
            PCE+WLDDT V    +C++ +     +V      DYSSC  G    + +YWL  + ++G 
Sbjct  122  PCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGD  181

Query  184  YSWQVYKNCVGL  195
              WQVYKNC+ L
Sbjct  182  TVWQVYKNCIPL  193

>PITG_04948
Length=232

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 65/123 (53%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  141
            +R +LD D SLY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G  E       VDYSSC    C L +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  192

Query  194  GLS  196
             LS
Sbjct  193  PLS  195

>PHYRA_73606
Length=366

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 70/130 (54%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  134
              +GY+ +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSW  186
            +WLDDT V S  +C T +  G  +       VDYSSC  + C L +YWL  + ++    W
Sbjct  128  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  187

Query  187  QVYKNCVGLS  196
            QVYK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PPTG_04647
Length=327

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 69/130 (53%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  134
              +GY+ +R +LD D  LY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  73   SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  126

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSW  186
            +WLDDT V S  NC T +  G  +       VDYSSC  + C L +YWL  + ++    W
Sbjct  127  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  186

Query  187  QVYKNCVGLS  196
            QVYK+CV L+
Sbjct  187  QVYKDCVPLT  196

>PHYCA_130365
Length=266

 Score = 82.0 bits (201),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 15/127 (12%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWL  137
            + Y  +R+M+D  S+Y        +CG T P       PT+ +   S G    GPCE+WL
Sbjct  73   NNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWL  126

Query  138  DDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVY  189
            DD  V    +C + +  G  +       VDYSSC    C L +YWLG++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAY  186

Query  190  KNCVGLS  196
            KNC+ L+
Sbjct  187  KNCIPLT  193

>PHYKE_2809
Length=291

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  141
            +R MLD D  LY        +CG T P+   +  PT+ +   S G    GPCE+WLDD  
Sbjct  66   IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G  E       VDYSSC    C   +YWL ++ ++G   WQVYKNCV
Sbjct  120  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  179

Query  194  GLS  196
             LS
Sbjct  180  PLS  182

>PHYCA_531163
Length=314

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 70/133 (53%), Gaps = 16/133 (12%)

Query  74   SWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDG  131
            S    +GY+ +R +LD D SLY        +CG T+   T   P  T ++  + G    G
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVG  124

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGI  183
            PCE+WLDDT V S  +C T +  G  +       VDYSSC  + C L +YWL  + ++  
Sbjct  125  PCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSA  184

Query  184  YSWQVYKNCVGLS  196
              WQVYK+CV L+
Sbjct  185  IVWQVYKDCVPLT  197

>PHYKE_6001
Length=289

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 15/128 (12%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEV  135
            + + Y  L+ ++DD S+Y        +CG T P    QPIP++     S      GPCE+
Sbjct  71   KANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEI  124

Query  136  WLDDTKVSSGRNCHTEFPHGQHE------VDYSSC-GKACT-LSWYWLGIKYIEGIYSWQ  187
            WLDD  V S  +C+ ++ +   +      VDYSSC G  C  + +YWL  + ++G   WQ
Sbjct  125  WLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQ  184

Query  188  VYKNCVGL  195
             YKNC+ L
Sbjct  185  SYKNCIPL  192

>PHYKE_10578
Length=239

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQH  157
            +CG T    + QP+P++          +G+T  GPCEV++DD  V  G NC  E+P G  
Sbjct  85   KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPD  144

Query  158  E--------VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            E        +DYSSC   C LS+YWLG +  +    WQ Y NCV L+
Sbjct  145  ESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLT  187

>PPTG_04619
Length=276

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 64/123 (52%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  141
            +R +LD D SLY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G  E       VDYSSC    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  194  GLS  196
             LS
Sbjct  193  PLS  195

>H257_13550
Length=266

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 69/138 (50%), Gaps = 27/138 (20%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGYTLD  130
            Q  G+ +LRAMLD +           +CG +      +PIP++      N     G+   
Sbjct  103  QATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPS  153

Query  131  --GPCEVWLDDTKVSSGRNCHTEFPH---GQHEVDYSSCGKACTLSWYWLGIKYIEGIYS  185
              GPCE+WLD+T+V    +C T FP        VD++SC  +CT+ +YW+ +        
Sbjct  154  HTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALHQDL----  209

Query  186  WQVYKNC---VGLSTAPT  200
            WQVYKNC   VGLS  PT
Sbjct  210  WQVYKNCAPLVGLSATPT  227

>PHYCA_534296
Length=309

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 15/132 (11%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-G  131
            +S    + +  L+ ++DD S+Y        +CG T+P    QPIPT+     S   +  G
Sbjct  41   KSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVG  94

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGI  183
            PCE+WLDDTKV    +C++++ +   +      VDYSSC  G    + +YWL  + ++G 
Sbjct  95   PCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGK  154

Query  184  YSWQVYKNCVGL  195
              WQ YK+C+ L
Sbjct  155  TVWQSYKDCIPL  166

>PHYRA_77971
Length=230

 Score = 79.0 bits (193),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 55/107 (51%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQH  157
            +CG T    + QP+PTN           GYT  GPCE+++DD  V    NC  ++P G +
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  158  E--------VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +        VDYSSC   CT S YWLG +  +    WQ Y NCV LS
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLS  188

>PHYRA_85794
Length=230

 Score = 79.0 bits (193),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 55/107 (51%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQH  157
            +CG T    + QP+PTN           GYT  GPCE+++DD  V    NC  ++P G +
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  158  E--------VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +        VDYSSC   CT S YWLG +  +    WQ Y NCV LS
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLS  188

>PITG_05271
Length=278

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 15/124 (12%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEVWLDD  139
            +  L+ ++DD S+Y        +CG T P  + QPIP +     S   +  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  140  TKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGIYSWQVYKN  191
            TKV    +C +++ +   +      VDYSSC  G    + +YWL  + ++G   WQ YK+
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  192  CVGL  195
            C+ L
Sbjct  189  CIPL  192

>PHYSO_483955
Length=320

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 15/127 (12%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWL  137
            + Y  +R+++D   +Y        +CG T P+ +    PT+ +   S G    GPCE+WL
Sbjct  74   NNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWL  127

Query  138  DDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVY  189
            DD  V    +C + +  G  E       VDYSSC    C L +YWL ++ ++G   WQ Y
Sbjct  128  DDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAY  187

Query  190  KNCVGLS  196
            KNC+ L+
Sbjct  188  KNCIPLT  194

>PHYSO_340333
Length=284

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEVWL  137
            + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGIYSWQVY  189
            DD KV    +C +++ +   +      VDYSSC  G    + +YWL  + ++G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  190  KNCVGL  195
            K+C+ L
Sbjct  187  KDCIPL  192

>PHYRA_86016
Length=236

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + QPIPT+   +       G+T  GPCE+++DDT V  G +C  E+P G  
Sbjct  21   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  80

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                  +  VDYSSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  81   GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PHYSO_485524
Length=278

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  141
            +R +LD D  LY         CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G  E       VDYSSC    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  194  GLS  196
             LS
Sbjct  193  PLS  195

>SPRG_19917
Length=241

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 69/141 (49%), Gaps = 25/141 (18%)

Query  67   NTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN--SFQT  124
            N +   +++  Q  Y +LRA+LD             +CG T      + IP+N   +FQ 
Sbjct  59   NAANFNKAFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQN  109

Query  125  ----SGYTLD--GPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDYSSCG-KACTLSWYW  174
                 G+ L   GPCEVWLD+ +V    +C T F   P     VDYSSCG K C L +YW
Sbjct  110  PDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYW  169

Query  175  LGIKYIEGIYSWQVYKNCVGL  195
            + +        WQVYKNCV L
Sbjct  170  IALHSPR----WQVYKNCVPL  186

>PHYRA_86752
Length=300

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 56/106 (53%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + QPIPT+   +       G+T  GPCE+++DDT V  G +C  E+P G  
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                  +  VDYSSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  186

>PHYSO_340332
Length=295

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEVWL  137
            + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGIYSWQVY  189
            DD KV    +C +++ +   +      VDYSSC  G    + +YWL  + ++G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  190  KNCVGL  195
            K+C+ L
Sbjct  187  KDCIPL  192

>PPTG_04618
Length=326

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 15/128 (12%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDGPCEVW  136
            ++ Y  +R+++D   +Y        +CG T P+ T ++P     +  + G    GPCE+W
Sbjct  73   KNNYKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  137  LDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQV  188
            LDD  V    +C + +  G  +       VDYSSC    C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  186

Query  189  YKNCVGLS  196
            YKNC+ L+
Sbjct  187  YKNCIPLT  194

>PHYRA_83499
Length=473

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 17/112 (15%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + QPIPT+   +       G+T  GPCE+++DDT V  G +C  E+P G  
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
                  +  VDYSSC   CTL+ YWL  +  +    WQ Y NCV L  + +A
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSA  192

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 40/72 (56%), Gaps = 12/72 (17%)

Query  126  GYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHE--------VDYSSCGKACTLSWYWLGI  177
            G  + GPCE++LDDT +  G NC  E+  G  +        +DYSSC  ACTL+ YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  178  KYIEGIYSWQVY  189
            +  +    WQ Y
Sbjct  406  QNEQ----WQAY  413

>SDRG_17318
Length=241

 Score = 76.6 bits (187),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 67/135 (50%), Gaps = 25/135 (19%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN--SFQT----SG  126
            +++  Q  Y +LRAMLD             +CG T      + IP+N   +FQ      G
Sbjct  65   KAFKAQSKYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEG  115

Query  127  Y--TLDGPCEVWLDDTKVSSGRNCHTEFPH---GQHEVDYSSCG-KACTLSWYWLGIKYI  180
            +  +  GPCEVWLD+ +V    +C T FP        VDYSSCG K C L +YW+ +   
Sbjct  116  FIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALHSP  175

Query  181  EGIYSWQVYKNCVGL  195
                 WQVYKNCV L
Sbjct  176  R----WQVYKNCVPL  186

>PHYSO_533747
Length=206

 Score = 75.9 bits (185),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 16/126 (13%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN-NSFQTSGYTLDGPCEVWL  137
            + +  L+ MLDD SLY        +CG T P    QPIPT+  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  138  DDTKVSSGRNCHTEFPHG------QHEVDYSSC--GKACTLSWYWLGIKYIEGIYS-WQV  188
            DD KV    +C++E+ H       +  +DYSSC  G    + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  189  YKNCVG  194
            Y   +G
Sbjct  188  YSTLLG  193

>PYU1_G014690
Length=295

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 18/124 (15%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEV  135
            ++ G+ +LR+ ++D+            CG T P    + IP++N    S   +  GPCE+
Sbjct  68   KEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEI  118

Query  136  WLDDTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKN  191
            WLDD +V    +C   F  G       +D+SSC   C L ++WLG++  +    WQVYKN
Sbjct  119  WLDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKN  174

Query  192  CVGL  195
            CV L
Sbjct  175  CVPL  178

>PHYRA_78689
Length=296

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-G  131
            +S    + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  67   KSLKTANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVG  120

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGI  183
            PCE+WLDDTKV    +C +++ +   +      VDYSSC  G    + +YWL  + ++  
Sbjct  121  PCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSK  180

Query  184  YSWQVYKNCVGL  195
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>PITG_04949
Length=337

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (52%), Gaps = 15/128 (12%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVW  136
            ++ +  +R+++D   ++        ECG T P+ +    P++ +   S G    GPCE+W
Sbjct  73   KNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  137  LDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQV  188
            LDD  V    +C + +  G  +       VDYSSC    C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQA  186

Query  189  YKNCVGLS  196
            YKNC+ L+
Sbjct  187  YKNCIPLT  194

>PHYSO_533682
Length=278

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 15/131 (11%)

Query  74   SWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGP  132
            S+   + +  L+ ++DD S+Y        +CG T P    QPIPT+     S G    GP
Sbjct  68   SFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGP  121

Query  133  CEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGIY  184
            CE+WLDD KV S  +C++++ +   +      VDYSSC  G    +  Y LG + +    
Sbjct  122  CEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKT  181

Query  185  SWQVYKNCVGL  195
             WQ YKNC+ L
Sbjct  182  VWQSYKNCIPL  192

>PYU1_G005323
Length=251

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 13/119 (11%)

Query  80   GYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEVWLD  138
            GY  L++ L+D+            CG + P  + +PIP++   +  S     GPCEVW D
Sbjct  68   GYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWFD  118

Query  139  DTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            D +     +C   F      +VD+S+C  +C L +YWLG++  +G   WQ YKNC+ L+
Sbjct  119  DVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLT  175

>PHYSO_438103
Length=238

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-G  131
            +S    + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  66   KSLKSANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  119

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGI  183
            PCE+WLD+TKV    +C +++ +   +      VDYSSC  G    + +YWL  + ++  
Sbjct  120  PCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSK  179

Query  184  YSWQVYKNCVGL  195
              WQ YK+C+ L
Sbjct  180  TVWQSYKDCIPL  191

>PHYKE_3913
Length=321

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTK  141
            +R + D D SLY         CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  106  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G  E       VDYSSC    C   +YW+ ++ ++G   WQVYKNCV
Sbjct  160  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  219

Query  194  GLS  196
             L+
Sbjct  220  PLT  222

>PHALS_05392
Length=367

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 15/127 (12%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWL  137
            + +  +R+++D   +Y        +CG T P       P+N     S G    GPCE+WL
Sbjct  157  NNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWL  210

Query  138  DDTKVSSGRNCHTEFPHGQHE-------VDYSSCG-KACTLSWYWLGIKYIEGIYSWQVY  189
            DD  V    +C   +  G  E       VDYSSC    C L +YWL ++ ++G   WQ Y
Sbjct  211  DDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAY  270

Query  190  KNCVGLS  196
            KNC+ L+
Sbjct  271  KNCIPLN  277

>PHYCA_98479
Length=276

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            ECG T      QP+PT+   +       G+T  GPCE+++DDT V  G NC  E+P G  
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                     VDYSSC   CTL+ YWLG +  +    WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PYAP_19707
Length=241

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 8/104 (8%)

Query  93   LYKVTEEAIFECGLTSPRTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSSGRNCHT  150
            +  + E A  +CG T      QPIPT+   +F  S   + GPCEVWLD+TKV+S + C  
Sbjct  58   IKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWK  116

Query  151  EFPHGQHEVDYSSCGK-ACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            EFP+ + +VD++ C   +C L W W+          W+ + NCV
Sbjct  117  EFPNKRIKVDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCV  156

>PHYSO_246676
Length=187

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 39/160 (24%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q+VL P P +  +    +   LA+L+ QG  T  +  +W +++GY +LR  +D ++ Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDV  70

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            T  A F CG T P+   QPIP  N  +++GYT DG                         
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG-------------------------  105

Query  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
                         L    L +  ++  YSW+VYK C+ LS
Sbjct  106  -------------LVHASLVLDGMKNSYSWKVYKACIPLS  132

>PHYRA_73583
Length=630

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPRTETQ-PIPTNNSFQTSGYTLDGPCEVWLDDTK  141
            +R +LD D +LY         CG T+P    + P  T ++  + G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWLDDKM  132

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G  E       VDYSSC    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNCI  192

Query  194  GLS  196
             LS
Sbjct  193  PLS  195

 Score = 72.4 bits (176),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 16/123 (13%)

Query  84   LRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDGPCEVWLDDTK  141
            +R M+D D  LY        +CG T P+ T   P  T ++  + G    GPCEVWLDD  
Sbjct  380  IRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWLDDEM  433

Query  142  VSSGRNCHTEFPHGQHE-------VDYSSC-GKACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            V    +C + +  G          +DYSSC    C   ++WL ++  +    WQVYKNCV
Sbjct  434  VLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNCV  493

Query  194  GLS  196
             LS
Sbjct  494  PLS  496

>PYIR_16375
Length=262

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 12/120 (10%)

Query  80   GYTSLRAM-LDDESLYKVTEEAIFECGLTS---PRTETQPIPTNNSFQTSGYTLDGPCEV  135
            GYTSLR + L ++ +Y   E    ECGLT+    +  T P   N +F  SG+T  GPCE+
Sbjct  77   GYTSLRDLILANQDMYD--ESTDKECGLTTLDEAKRTTMPASGNITF--SGFTHPGPCEL  132

Query  136  WLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            W DD K++   NC   +P G+   D + C  A     +W+G+        WQVY NCV L
Sbjct  133  WCDDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVHGSP----WQVYTNCVYL  188

>PYU1_G007476
Length=195

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 58/123 (47%), Gaps = 17/123 (14%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN----SFQTSGYTLDGP  132
            +Q GY +LR+ L+++            CG T P T  + IP +     +    G+   GP
Sbjct  71   KQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGP  121

Query  133  CEVWLDDTKVSSGRNCHTEFP--HGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYK  190
            CE+WLD+  +    NC   FP       VD+SSC   C L  YWLG +  +    WQ YK
Sbjct  122  CELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQRWQTYK  179

Query  191  NCV  193
             CV
Sbjct  180  YCV  182

>PHALS_03179
Length=372

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 11/127 (9%)

Query  80   GYTSLRAMLDDESLYKVTEEAIF--ECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEVW  136
             Y SL+A  + + L  + E      ECG + P+ + QPIP +     S   +  GPCE+W
Sbjct  106  AYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  165

Query  137  LDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGIYSWQV  188
            LD+ KV    +C+ ++ +   +      VDYSSC  G    + +YWL  + I+GI  WQ 
Sbjct  166  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  225

Query  189  YKNCVGL  195
            YKNC+ L
Sbjct  226  YKNCIPL  232

>PPTG_07509
Length=299

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + +PIP +   +       G+T  GPCE+++DD  V  G NC  +FP G  
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                  +  VD+SSC   CTL+ YWLG +  +    WQ Y NCV L
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPL  185

>PHYCA_127270
Length=279

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-G  131
            +S    + +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  120

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGI  183
            PCE+WLDD KV    +C +++ +   +      VDYSSC  G    + +YWL  + +   
Sbjct  121  PCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKK  180

Query  184  YSWQVYKNCVGL  195
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>PPTG_07507
Length=299

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + +PIP +   +       G+T  GPCE+++DD  V  G NC  +FP G  
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                  +  VD+SSC   CTL+ YWLG +  +    WQ Y NCV L
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPL  185

>PHYCA_12942
Length=353

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 12/101 (12%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T      QPIP++   +       G+T  GPCE+++DD  V  G NC  EF  G  
Sbjct  83   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDT  142

Query  156  -QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
               ++DYSSC   C L+ YWLG +  +    WQ Y NCV L
Sbjct  143  SDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PYAP_18709
Length=235

 Score = 73.9 bits (180),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 63/119 (53%), Gaps = 13/119 (11%)

Query  80   GYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEVWLD  138
            G+  LR+ L+D+            CG + P    +PIP++ + +  S     GPCEVWLD
Sbjct  68   GFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLD  118

Query  139  DTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +T+     +C   F      ++D+ +C  +C L +YWLG++  +G   WQ YKNC+ L+
Sbjct  119  NTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PYIR_24743
Length=357

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 70/154 (45%), Gaps = 27/154 (18%)

Query  53   FQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTE  112
            FQG    +      N     +++  Q  + +LR +L D            +CG + P   
Sbjct  62   FQG---KFNDNPQANVDTFTKAFQGQSEFKTLRDLLKDHGA---------DCGDSKPDAS  109

Query  113  TQPIPTN------NSFQTSGY--TLDGPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDY  161
             + IP +      N     G+  +  GPCE+WLDD +V S  NC   F   P  +  VD+
Sbjct  110  RKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDF  169

Query  162  SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            SSC + C L +YWL +       +WQVYKNCV L
Sbjct  170  SSCKENCMLRFYWLALHEP----TWQVYKNCVPL  199

>PHYCA_18657
Length=295

 Score = 74.3 bits (181),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQH  157
            +CG T    + +P+PTN           G+T  GPCE+++DD  V    +C  ++P G +
Sbjct  171  KCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPN  230

Query  158  E--------VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            +        VDYSSC   CT S YWLG +  +    WQ Y NCV LS
Sbjct  231  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLS  273

>PHYSO_459106
Length=223

 Score = 73.2 bits (178),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 61/130 (47%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCE  134
            + +    +R M+D D  LY        +CG T P+ + Q  PT      S G    GPCE
Sbjct  72   KANNVKDIRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCE  125

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSW  186
            +WLDD  V    +C + +  G          VDYSSC    C   +YWL ++  +    W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYW  185

Query  187  QVYKNCVGLS  196
            QVYKNC+ L+
Sbjct  186  QVYKNCIPLT  195

>PYIW_27477
Length=180

 Score = 72.4 bits (176),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query  74   SWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GP  132
            SW     +  +      E+L    E+   +CG T P  + + IP++N  + S   +  GP
Sbjct  34   SWKDPANFAKVSKEKGFETLRSYIEDKGAKCGKTDPNAKAKAIPSDNVVKFSRAIVHPGP  93

Query  133  CEVWLDDTKVSSGRNCHTEFPHG--QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
            CE+W+DDT+V    NC   F       ++D+S+C   C L W+WLG++  +    WQVY
Sbjct  94   CELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PYIW_21964
Length=265

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 14/128 (11%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTLD-  130
            ++   Y S+RA++DD++++   +EA  ECG+TSP    QP+P      +   + G+T   
Sbjct  77   LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  134

Query  131  -GPCEVWLDDTKVSSGRNCHTEFPHGQHE--VDYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
             GPCEVW DD    +  NC  ++     E  +D++ C  A  L   WL +       +WQ
Sbjct  135  QGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALHS----STWQ  190

Query  188  VYKNCVGL  195
            +Y NC  L
Sbjct  191  IYINCAPL  198

>SDRG_08137
Length=282

 Score = 73.6 bits (179),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 66/141 (47%), Gaps = 25/141 (18%)

Query  67   NTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------N  120
            N +    ++  Q  + +LR ML+ +            CG + P    + IP++      N
Sbjct  121  NVAAFTSAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWRN  171

Query  121  SFQTSGY--TLDGPCEVWLDDTKVSSGRNCHTEFPH---GQHEVDYSSC-GKACTLSWYW  174
                 G+  +  GPCEVWLDD +V    +C T FP        VDYSSC G  C L +YW
Sbjct  172  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  231

Query  175  LGIKYIEGIYSWQVYKNCVGL  195
            L +   +    WQVYKNCV L
Sbjct  232  LALHQPQ----WQVYKNCVPL  248

>PHYCA_19611
Length=531

 Score = 74.7 bits (182),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--  129
            M    YTSL+  ++D+ +  V +E   ECG T+P+   QP+P      +     G+T   
Sbjct  280  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  338

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
            +GPCEVW DDT+V    NC   FP    +   D  +C  +  L+ YW+ +       SWQ
Sbjct  339  EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALHSP----SWQ  394

Query  188  VYKNCVGL  195
            VY NC  L
Sbjct  395  VYINCAAL  402

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 46/108 (43%), Gaps = 17/108 (16%)

Query  90   DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCH  149
            + S YK  +E I + G T  R         N FQ    T +GP  V      ++   NC 
Sbjct  48   EASKYKSLKEVINDLGKTKLR---------NRFQR--RTSNGPTVVAKALPPLTKDDNCA  96

Query  150  TEFPHGQHEVDYS--SCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
              +P    +V Y   +C  A  L++YWL +       +WQVY NC  L
Sbjct  97   ANYPTAPAKVPYDRDACLGASRLTFYWLALHS----STWQVYTNCAAL  140

>SDRG_08129
Length=218

 Score = 72.8 bits (177),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 66/141 (47%), Gaps = 25/141 (18%)

Query  67   NTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------N  120
            N +    ++  Q  + +LR ML+ +            CG + P    + IP++      N
Sbjct  57   NVAAFTSAFKVQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGAMTWRN  107

Query  121  SFQTSGY--TLDGPCEVWLDDTKVSSGRNCHTEFPH---GQHEVDYSSC-GKACTLSWYW  174
                 G+  +  GPCEVWLDD +V    +C T FP        VDYSSC G  C L +YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  167

Query  175  LGIKYIEGIYSWQVYKNCVGL  195
            L +   +    WQVYKNCV L
Sbjct  168  LALHQPQ----WQVYKNCVPL  184

>SDRG_07565
Length=278

 Score = 73.6 bits (179),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 62/126 (49%), Gaps = 16/126 (13%)

Query  82   TSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGY--TLDGPC  133
            T+ +A    ++L  + E     CG + P    + IP++      N     G+  +  GPC
Sbjct  125  TAFKAQSQFKTLRDMLEPQGPACGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTGPC  184

Query  134  EVWLDDTKVSSGRNCHTEFPH---GQHEVDYSSC-GKACTLSWYWLGIKYIEGIYSWQVY  189
            EVWLDD +V    +C T FP        VDYSSC G  C L +YWL +   +    WQVY
Sbjct  185  EVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLALHQPQ----WQVY  240

Query  190  KNCVGL  195
            KNCV L
Sbjct  241  KNCVPL  246

>PHYCA_97965
Length=288

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + QPIP++   +       G+T  GPCE+++DD  V  G +C  EFP G  
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAK  146

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                  +  VD+SSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PHYCA_12943
Length=287

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T    + QPIP++   +       G+T  GPCE+++DD  V  G +C  EFP G  
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPD  146

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                  +  VD+SSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PHYRA_78175
Length=319

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 13/123 (11%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  134
            Y+SL+  + D+ L  V +E   ECG T+P    QP+P      +     G+T   +GPCE
Sbjct  78   YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  136

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DDT+V    NC   FP    ++ Y   +C  +  LS YW+ +       SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALHSA----SWQVYINC  192

Query  193  VGL  195
              L
Sbjct  193  AAL  195

>PYIR_16444
Length=182

 Score = 71.2 bits (173),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 14/120 (12%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEV  135
            +Q G+ +LR+ ++++            CG T+ +   +PIP++     S   +  GPCE+
Sbjct  69   KQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCEL  119

Query  136  WLDDTKVSSGRNCHTEFPHGQH--EVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            WLD+ +V    NC   F       ++D+SSC   C L ++WLG++  +    WQVYKNCV
Sbjct  120  WLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCV  177

>PYU1_G007364
Length=316

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 14/104 (13%)

Query  103  ECGLTSPRTETQPIPTN------NSFQTSGYTLD--GPCEVWLDDTKVSSGRNCHTEFP-  153
            +CG T      +PIP++      N     G+     GPCE+WLDDT V    NC   FP 
Sbjct  102  DCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGPCEIWLDDTPVLKEENCAGRFPG  161

Query  154  -HGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
               Q +VD+SSC   C + +YWL ++      +WQ+YKNC+ L+
Sbjct  162  NPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIYKNCIPLA  201

>PHYRA_79140
Length=424

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T      QPIP++   +       G+T  GPCE++LDDT V    NC  ++P G  
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
                     VDYSSC   CTL+ YWL  +  +    WQ Y NCV LS
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLS  187

>PYIR_16443
Length=275

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 15/120 (13%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEV  135
            +Q G+ +LR+ ++D+            CG T+P    + IP+++  + S   +  GPCE+
Sbjct  69   KQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEI  119

Query  136  WLDDTKVSSGRNCHTEFPHG--QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVY-KNC  192
            WLDD +V    NC   F       ++D+SSC  +C L W+WLG++  +    WQVY K+C
Sbjct  120  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PYIW_19151
Length=248

 Score = 72.4 bits (176),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 83/174 (48%), Gaps = 31/174 (18%)

Query  32   GLGE-GQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDD  90
            G+G  G  V+  PP +  D  D +  A A                 ++ G+++LR+ L+D
Sbjct  36   GVGHPGTFVIEYPPPWTGDWKDPKNFAAA----------------AKEKGFSTLRSYLED  79

Query  91   ESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWLDDTKVSSGRNCH  149
            +            CG T P+   + IP + + + S      GPCE+++DDT+V    +C 
Sbjct  80   KGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCELYIDDTRVYQNDDCE  130

Query  150  TEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201
            + F       +VD+S C   C + +YWLG++       WQVYK+CV +S++  A
Sbjct  131  SAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQVYKSCVPVSSSAVA  182

>PYVX_16138
Length=559

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 15/126 (12%)

Query  74   SWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGP  132
            S  ++ G T +R++LDD S+Y        +CG T P    Q IPT+++   S G    GP
Sbjct  69   SLAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGP  122

Query  133  CEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSCGKA-CT-LSWYWLGIKYIEGIY  184
            CE+WLDDT V    +C++ +     +      VDYSSC  + C+ + +YWL  + ++   
Sbjct  123  CEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDET  182

Query  185  SWQVYK  190
             WQVY 
Sbjct  183  VWQVYS  188

>PPTG_07521
Length=281

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 54/106 (51%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            ECG T      QPIP++   +       G+T  GPCE++LDD  V  G NC  E+P G  
Sbjct  85   ECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDV  144

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                     VDYSSC + CTL+ YWL  +      +WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCTEDCTLTIYWLAFQNA----NWQAYINCVPL  186

>PYVX_20789
Length=290

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 78/181 (43%), Gaps = 36/181 (20%)

Query  33   LGEGQVVLHPP------------PFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHG  80
            LG G ++L  P            P   +D  +  G ++     QGV        W  ++G
Sbjct  21   LGHGNIILPKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQGV------ADWFTENG  74

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN--SFQTSGYTLDGPCEVWLD  138
             +SL+        Y      I ECG T      QP+P++      T G +  GPCE+W D
Sbjct  75   ISSLKE-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGPCEIWCD  127

Query  139  DTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVG  194
            DT+V +  NC T+F  GQ      +D ++C  +    +YWL +        WQVY NCV 
Sbjct  128  DTRVFNSTNCVTDF-SGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQVYINCVA  182

Query  195  L  195
            L
Sbjct  183  L  183

>PHYRA_73582
Length=326

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 16/127 (13%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEVWL  137
            + Y  L+ ++D     +       +CG T P       PT+ +   S G    GPCE+WL
Sbjct  74   NNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWL  126

Query  138  DDTKVSSGRNCHTEFPHGQHE-------VDYSSCGKA-CTLSWYWLGIKYIEGIYSWQVY  189
            DD  V    +C + +  G  E       VDYS C    C L +YWL ++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSY  186

Query  190  KNCVGLS  196
            KNC+ L+
Sbjct  187  KNCIPLT  193

>SPRG_07795
Length=335

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 60/122 (49%), Gaps = 15/122 (12%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS--GY--TLDGPCEVW  136
            + +L+A LD             +CG+T P    QP+P+   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELW  128

Query  137  LDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
             D+T+V    NC   +P G   +D S C  A  L+  WL +   E    WQVYKNCV LS
Sbjct  129  CDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

Query  197  TA  198
             A
Sbjct  185  GA  186

>PHYKE_2454
Length=374

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 12/127 (9%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN---NSFQTSGYTL--D  130
             +   Y SL+A++DD++   V+  A   CG   P    QP+P+    +   + G+T   +
Sbjct  71   FKASSYKSLKALIDDKAKITVSG-ATLTCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHE  129

Query  131  GPCEVWLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQV  188
            GPCE W DD +V    NC   FP    E+ Y  SS   A  L +YW+ +       SWQV
Sbjct  130  GPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP----SWQV  185

Query  189  YKNCVGL  195
            Y NC  L
Sbjct  186  YVNCAAL  192

>PHYKE_6077
Length=322

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 65/129 (50%), Gaps = 15/129 (12%)

Query  76   MQQHGYTSLRAMLDDESLYKVTE-EAIFECGLTSPRTETQPIP------TNNSFQTSGYT  128
            M    YTSL+  +  ++  KVT  E   ECG T+P+   QP+P      ++ S +    +
Sbjct  73   MAASKYTSLKEFMAAKA--KVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSS  130

Query  129  LDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYS--SCGKACTLSWYWLGIKYIEGIYSW  186
             +GPCEVW DDT+V    NC   FP    ++ Y   +C  +  L+ YW+ +       SW
Sbjct  131  HEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALHSP----SW  186

Query  187  QVYKNCVGL  195
            QVY NC  L
Sbjct  187  QVYINCAAL  195

>PYVX_18175
Length=147

 Score = 69.3 bits (168),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)

Query  159  VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            +DYSSC  +CTL WYW+G++Y++G YSWQVYKNCV LST+
Sbjct  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129

 Score = 38.9 bits (89),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (51%), Gaps = 3/65 (5%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V+ P P +     D     LA+L+ QG  T  +  +W + +GY +LR+ +D     K 
Sbjct  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG---KY  85

Query  97   TEEAI  101
            T+ AI
Sbjct  86   TDTAI  90

>SPRG_19916
Length=305

 Score = 71.6 bits (174),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 65/142 (46%), Gaps = 25/142 (18%)

Query  66   VNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------  119
             N +   +++  Q  + +LR MLD +           +CG T      + IPTN      
Sbjct  58   TNVANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQ  108

Query  120  NSFQTSGYTLD--GPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDYSSC-GKACTLSWY  173
            N     G+     GPCEVW+DD +V    +C T F   P     +DYSSC G  C L +Y
Sbjct  109  NPDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFY  168

Query  174  WLGIKYIEGIYSWQVYKNCVGL  195
            WL +        WQVYKNCV L
Sbjct  169  WLALHEP----MWQVYKNCVPL  186

>PPTG_03139
Length=320

 Score = 72.0 bits (175),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 13/123 (11%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  134
            Y+SL+  + D+ +  V+++   ECG T+P    QP+P      +     G+T   +GPCE
Sbjct  78   YSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCE  136

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DDT+V    NC   FP    ++  D+ +C  +  LS YW+ +       SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALHSP----SWQVYINC  192

Query  193  VGL  195
              L
Sbjct  193  AAL  195

>PYAP_18138
Length=268

 Score = 71.2 bits (173),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 16/118 (14%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEV  135
            +QHG   LR+ +D +         I ECG +      +PIP  N+       T  GPCE 
Sbjct  80   KQHGVKDLRSYIDAK---------ITECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEF  130

Query  136  WLDDTKVSSGRNCHTEFPHGQH-EVDYSSC-GKACTLSWYWLGIKYIEGIYSWQVYKN  191
            W+DDT+V    +C   F       +DYS C GK C L +YWLG++  +    WQVY+N
Sbjct  131  WIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQNSD----WQVYRN  184

>PHYRA_84947
Length=265

 Score = 71.2 bits (173),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 65/134 (49%), Gaps = 17/134 (13%)

Query  74   SWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS--GYTLDG  131
            SW  ++   SL+  +   + Y      I ECG+T      QP+P++   Q    G +  G
Sbjct  68   SWFTKNNIASLKEYI---TTYGTD---ISECGVTKKNGAPQPVPSDGYAQHDNLGNSHPG  121

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
            PCE+W DDT+V    NC  +F  GQ      +D S+C  +  L +YWL +     I  WQ
Sbjct  122  PCEIWCDDTRVFHDSNCVAKF-SGQSPAKIPIDVSTCKSSSELVFYWLALH----IQPWQ  176

Query  188  VYKNCVGLSTAPTA  201
            VY NCV L  A  A
Sbjct  177  VYINCVALDGAGAA  190

>PPTG_04620
Length=342

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 63/130 (48%), Gaps = 16/130 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDGPCE  134
            + +    +R M+D D  LY        +CG T P+ T   P  T ++  + G    GPCE
Sbjct  74   KSNNVKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATFSRGIVHAGPCE  127

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGK-ACTLSWYWLGIKYIEGIYSW  186
            +WLDD  V    +C + +  G  +       +DYSSC    C   +YWL ++  +    W
Sbjct  128  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLW  187

Query  187  QVYKNCVGLS  196
            QVYKNC+ LS
Sbjct  188  QVYKNCIPLS  197

>PYVX_18179
Length=147

 Score = 68.9 bits (167),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)

Query  159  VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
            VDYSSC  +CTL W+W+G++Y++G YSWQVYKNCV LST+
Sbjct  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  37  QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLD  89
           Q V+ P P +  +  D     LA+L++QG  T  +  SW   +GY +LRA +D
Sbjct  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81

>PYU1_G001524
Length=300

 Score = 71.6 bits (174),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 73/167 (44%), Gaps = 20/167 (12%)

Query  31   AGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDD  90
            +G  +G  VL PP      G+ F         +   NT     ++  Q  YTS++ M+D 
Sbjct  42   SGTIDGPSVLTPP-----SGMSFS-------TDPASNTKAYTAAFKAQTKYTSMKQMVD-  88

Query  91   ESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHT  150
             +  K+   A  ECG +      QP+P    +     + +GPCEVW DD    S  NC  
Sbjct  89   -ATQKLESGASKECGFSLVNGAAQPLPDQVEWDQLPASHEGPCEVWCDDKLAFSDENCAI  147

Query  151  EFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
             +P    ++ Y  S C  A  L+  WL +     + +WQVY NC  L
Sbjct  148  NYPDSPAKLPYDKSKCTGAKMLTSVWLALH----VPTWQVYYNCAPL  190

>PHALS_03176
Length=207

 Score = 70.1 bits (170),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 11/126 (9%)

Query  81   YTSLRAMLDDESLYKVTEEAIF--ECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEVWL  137
            +  L+A    + L  + + + F  +CG + P+ + QPIP +     S   +  GPCE+WL
Sbjct  66   FQKLKAANKFKDLKTLMDTSAFGAKCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWL  125

Query  138  DDTKVSSGRNCHTEFPH------GQHEVDYSSC--GKACTLSWYWLGIKYIEGIYSWQVY  189
            D+ KV    +C++++ +          VDYSSC  G    + +YWL  + + G   WQ Y
Sbjct  126  DNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSY  185

Query  190  KNCVGL  195
            KNC+ L
Sbjct  186  KNCIPL  191

>PHYRA_83500
Length=394

 Score = 72.0 bits (175),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 53/107 (50%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T      QPIP++   +       G+T  GPCE++LDDT V    NC  ++P G  
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
                     VDYSSC   CTL+ YWL  +  +    WQ Y NC  LS
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLS  187

>PHYKE_6079
Length=302

 Score = 71.2 bits (173),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 13/125 (10%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  134
            YTSL+ +++D +   VT+ A   CG   P    QP+P      +   + G+T   +GPCE
Sbjct  79   YTSLKELINDLATITVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  137

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DD +V   ++C  ++     E+  D+ +C    TL++YWL +       +WQVY NC
Sbjct  138  VWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALHS----STWQVYVNC  193

Query  193  VGLST  197
              L T
Sbjct  194  APLET  198

>CCA17179
Length=185

 Score = 69.3 bits (168),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGYTLD--GP  132
            + +LR  L D+  Y         CG T+P  + +PIP +      N     G+     GP
Sbjct  46   FQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGP  96

Query  133  CEVWLDDTKVSSGRNCHTEF--PHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYK  190
            CEVWL++ +V    NC   F     +  +D+S+C   C L ++WL +   +    WQVYK
Sbjct  97   CEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQVYK  152

Query  191  NCVGLS  196
            NC+ ++
Sbjct  153  NCIPIA  158

>SPRG_22161
Length=300

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 64/135 (47%), Gaps = 25/135 (19%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSG  126
            +++  Q  + +LR MLD +           +CG T      + IPTN      N     G
Sbjct  65   KAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPDTGEG  115

Query  127  Y--TLDGPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDYSSCG-KACTLSWYWLGIKYI  180
            +  +  GPCEVW+D+ +V    +C T F   P     VDYSSCG   C L +YWL +   
Sbjct  116  FIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLALHEP  175

Query  181  EGIYSWQVYKNCVGL  195
                 WQVYKNCV L
Sbjct  176  ----MWQVYKNCVPL  186

>PYAR_18165
Length=261

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 9/99 (9%)

Query  103  ECGLTSPRTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVD  160
            +CG T+     QP P++   +F  S   + GPCE+WLDDTKV S  +C  +FP  +  VD
Sbjct  68   KCGKTNANAAVQPAPSDGVVAFAISAQHI-GPCEIWLDDTKVVSATDCWKQFPDKRIPVD  126

Query  161  YSSCGK--ACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197
            +S C    +C L W W+          W+ Y NCV + T
Sbjct  127  FSKCANKASCELRWIWMATH----TSPWEFYDNCVRVGT  161

>PHYSO_524101
Length=308

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 13/128 (10%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--  129
             +   Y+SL+ +++D++   VT+ A   CG+  P    QP+P          + G+T   
Sbjct  73   FESSSYSSLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQ  187
            +GPCEVW DD +V    +C  ++     E+ Y   +C  + TL++YWL +       +WQ
Sbjct  132  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQ  187

Query  188  VYKNCVGL  195
            VY NC  L
Sbjct  188  VYVNCAPL  195

>CCI47381
Length=211

 Score = 69.7 bits (169),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSF------QTSGYTLD--GP  132
            + +LR  L D+  Y         CG T+P    +PIP +N+          G+     GP
Sbjct  72   FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  122

Query  133  CEVWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYK  190
            CEVWL +T+V    NC   F     +  +++SSC   C L ++WL +   +    WQVYK
Sbjct  123  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYK  178

Query  191  NCVGLS  196
            NC+ ++
Sbjct  179  NCIPIA  184

>PYVX_24563
Length=254

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (51%), Gaps = 29/132 (22%)

Query  80   GYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN--------NSFQTSGYTLD-  130
            GYTSLRAM+D         E++ +CG T  RT+  P+           N  +  G+    
Sbjct  77   GYTSLRAMID---------ESVSDCGNT--RTDVSPVDMTGKKVLHWQNDQEGVGFVSSH  125

Query  131  -GPCEVWLDDTKVSSGRNC---HTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSW  186
             GPCEVW+DD  V+   +C   +T +P    + D+S C  +CTL +YWL +       +W
Sbjct  126  HGPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLRFYWLALHEP----NW  180

Query  187  QVYKNCVGLSTA  198
            Q+YK C  ++ +
Sbjct  181  QIYKQCAPITNS  192

>PITG_08892
Length=309

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 65/121 (54%), Gaps = 9/121 (7%)

Query  76   MQQHGYTSLRAML-DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCE  134
            +   G  SL A++  ++ LY  + E   +CGLT+ +   +     +  + +G+T  GPCE
Sbjct  74   LATKGGGSLGALIAKNQKLY--SSEVDPDCGLTTFKDSARSKLPASQLEYTGFTHPGPCE  131

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DDTKV    +C T+FP    ++  D S C KA  L+ YWL +   +    WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVHGEQ----WQVYSDC  187

Query  193  V  193
            V
Sbjct  188  V  188

>PYVX_20783
Length=276

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 62/127 (49%), Gaps = 18/127 (14%)

Query  75   WMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ--TSGYTLDGP  132
            W   +G +SL+        Y  T  +  ECG T      QP+P++   Q  T G +  GP
Sbjct  69   WFTANGISSLKE-------YITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGP  121

Query  133  CEVWLDDTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQV  188
            CE+W DDT+V +  NC TEF  GQ      +D ++C  +    +YWL +        WQV
Sbjct  122  CEIWCDDTRVFTSTNCVTEF-SGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQV  176

Query  189  YKNCVGL  195
            Y NCV L
Sbjct  177  YINCVAL  183

>PYAR_14256
Length=199

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 12/121 (10%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLD  138
             G+ +LRA L+D+            CG T P  + +P         S     GPCE+WLD
Sbjct  64   KGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWLD  114

Query  139  DTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197
            D+      +C  +F      +VD+S+C  +C L +YWLG++       WQ YKNC+ L  
Sbjct  115  DSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPLGG  172

Query  198  A  198
            A
Sbjct  173  A  173

>PHYRA_83494
Length=224

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 52/107 (49%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG--  155
            +CG T      Q +PT+   +       G+T  GPCE+++DD  V  G NC  ++P G  
Sbjct  22   KCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDV  81

Query  156  ------QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
                     VDYSSC   CT + YWL  +  +    WQ Y NCV L+
Sbjct  82   GSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLT  124

>PYU1_G005324
Length=191

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 13/123 (11%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEVW  136
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            L +T+     +C   F      ++D+S+C   C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

Query  196  STA  198
             ++
Sbjct  176  KSS  178

>PYU1_G005326
Length=191

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 13/123 (11%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEVW  136
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            L +T+     +C   F      ++D+S+C   C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

Query  196  STA  198
             ++
Sbjct  176  KSS  178

>PYU1_G005328
Length=191

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 60/123 (49%), Gaps = 13/123 (11%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEVW  136
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            L +T+     +C   F      ++D+S+C   C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

Query  196  STA  198
             ++
Sbjct  176  KSS  178

>PYAR_24818
Length=198

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 71/145 (49%), Gaps = 11/145 (8%)

Query  55   GMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQ  114
            GM+  Y  EQ  NT+   +++  Q  YTS+R M+ D+  ++    A  ECG ++     Q
Sbjct  54   GMSFGYGHEQ--NTAAFLKAYKSQSKYTSIRQMIYDK--FRPDGGATKECGRSAMTGPPQ  109

Query  115  PIPTNNSFQTS-GYTLDGPCEVWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLS  171
             +P    ++T    T  GPCEVW DD +V    NC  ++P   G+   D + C  A  L 
Sbjct  110  DLPDFVEYETGFDSTHWGPCEVWCDDKRVFYEDNCAVKYPQKPGKLPYDKAQCRGAKRLQ  169

Query  172  WYWLGIKYIEGIYSWQVYKNCVGLS  196
             +WL +     +  WQ Y +C  LS
Sbjct  170  SFWLALH----VPDWQAYISCATLS  190

>PYVX_21297
Length=263

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 8/106 (8%)

Query  93   LYKVTEEAIFECGLTSPRTETQPIPTNN--SFQTSGYTLDGPCEVWLDDTKVSSGRNCHT  150
            +  +   A   CG T      QP+P++   +F  S   + GPCEVWLDDTKV+S  +C +
Sbjct  56   IRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDCWS  114

Query  151  EFPHGQHEVDYSSC-GKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
             +      +DYS C G +C L W WL          W+++ NCV +
Sbjct  115  TYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  156

>PITG_11936
Length=333

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 13/123 (11%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  134
            Y SL+  ++D ++  V E+   ECG T+P    QP+P      +     G+TL  +GPCE
Sbjct  78   YKSLKEFMND-NMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCE  136

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            V+ D+T+V    NC   FP    ++  D+ +C  +  LS YW+ +       SWQVY NC
Sbjct  137  VYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALHSP----SWQVYINC  192

Query  193  VGL  195
              L
Sbjct  193  APL  195

>PHYRA_78174
Length=279

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (51%), Gaps = 16/138 (12%)

Query  67   NTSIEAQSWMQQHGYTSLRAMLDDESLYKVTE-EAIFECGLTSPRTETQPIP------TN  119
            NT+  A+ + +   YTSL+ M+ D  L KVT  +   ECG T+P    QP+P       +
Sbjct  64   NTAAFAKGF-EASKYTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAH  120

Query  120  NSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGI  177
             S +    + +GPCEVW DD +V    +C   +     +V  D+ +C  A  L++YWL +
Sbjct  121  GSGEGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLAL  180

Query  178  KYIEGIYSWQVYKNCVGL  195
                   +WQVY NC  L
Sbjct  181  H----SSTWQVYTNCAAL  194

>PHYRA_78176
Length=312

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 65/131 (50%), Gaps = 13/131 (10%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--  129
             +   Y+SL+  +DD++   VT+ A   CG   P    QP+P          + G+T   
Sbjct  74   FESSSYSSLKEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASH  132

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
            +GPCEVW DD +V    +C  +F     ++  D+ +C  +  L++YWL +       +WQ
Sbjct  133  EGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALHS----STWQ  188

Query  188  VYKNCVGLSTA  198
            VY NC  L ++
Sbjct  189  VYVNCAPLESS  199

>PPTG_07520
Length=294

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 54/106 (51%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEF---PH  154
            +CG T    + QPIP +        +  G+T  GPCE++LDD  V  G +C  EF   P+
Sbjct  83   KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPN  142

Query  155  GQHE-----VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            G  +     VD+SSC   C L+ YWL  +  +    WQ Y NCV L
Sbjct  143  GSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYCA_19598
Length=390

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 13/123 (11%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  134
            Y SL+ +  D++   V+  A   CG   P+ E QP+P +    +   + G+T   +GPCE
Sbjct  76   YKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCE  134

Query  135  VWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DD +     NC T FP    +   D  +C  A TL++YW+ +       +WQVY NC
Sbjct  135  VWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMHSD----TWQVYVNC  190

Query  193  VGL  195
              L
Sbjct  191  APL  193

>PPTG_14221
Length=275

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 63/132 (48%), Gaps = 15/132 (11%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDG  131
            +S    + +  L+ ++DD S+Y        +CG T+P    QPIPT+     S      G
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHG  120

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHE------VDYSSC--GKACTLSWYWLGIKYIEGI  183
            PC +WLDD  V    +C  ++ +   +      VDYSSC  G    + +YWL  + +   
Sbjct  121  PCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKK  180

Query  184  YSWQVYKNCVGL  195
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>SPRG_07627
Length=536

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 65/135 (48%), Gaps = 25/135 (19%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSG  126
            +++  Q  Y +LR +LD             +CG T P    + IP++      N     G
Sbjct  62   KAFAAQTQYKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEG  112

Query  127  Y--TLDGPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDYSSCG-KACTLSWYWLGIKYI  180
            +  +  GPCE+WLD T+V    +C T F   P  +  VDY+ CG   C L +YWL +   
Sbjct  113  FIPSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQP  172

Query  181  EGIYSWQVYKNCVGL  195
            +    WQVYKNCV L
Sbjct  173  Q----WQVYKNCVPL  183

>SDRG_15426
Length=523

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 65/135 (48%), Gaps = 25/135 (19%)

Query  73   QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSG  126
            +++  Q  Y +LR +LD             +CG T      +PIP++      N     G
Sbjct  38   KAFAAQSQYKTLRDLLDLSGP---------DCGNTRTNVAPKPIPSDGMMTWQNPDTGEG  88

Query  127  Y--TLDGPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDYSSCG-KACTLSWYWLGIKYI  180
            +  +  GPCE+WLD+ +V    NC T F   P  +  VDY+ CG   C L +YWL +   
Sbjct  89   FIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLALHQP  148

Query  181  EGIYSWQVYKNCVGL  195
            +    WQVYKNCV L
Sbjct  149  Q----WQVYKNCVPL  159

>PPTG_03153
Length=314

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 12/127 (9%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSF---QTSGYTL--D  130
             +   Y SL+A++DD++   +   A   CG+  P+   QP+P    +   ++ G+T   +
Sbjct  70   FESSKYKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHE  128

Query  131  GPCEVWLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQV  188
            GPCEVW D  +V    NC   +     E+ Y  S C  A  L+ YW+ +       SWQV
Sbjct  129  GPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMHGP----SWQV  184

Query  189  YKNCVGL  195
            Y NC  L
Sbjct  185  YVNCAPL  191

>PPTG_07516
Length=294

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 54/106 (51%), Gaps = 17/106 (16%)

Query  103  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEF---PH  154
            +CG T    + QPIP +        +  G+T  GPCE++LDD  V  G +C  EF   P+
Sbjct  83   KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPN  142

Query  155  GQHE-----VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            G  +     VD+SSC   C L+ YWL  +  +    WQ Y NCV L
Sbjct  143  GSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYCA_112615
Length=196

 Score = 67.8 bits (164),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (52%), Gaps = 19/114 (17%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEVWL  137
            + +  L+ ++DD S+Y        +CG T P  + QPIP++     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKVSSGRNCHTEFPHGQHEVDYSSC--GKACTLSWYWLGIKYIEGIYSWQVY  189
            DDTK     +  + FP     VDYSSC  G    + +YWL  + ++G   WQ Y
Sbjct  127  DDTK-----DIKSIFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  170

>PHYRA_78161
Length=373

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 13/125 (10%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  134
            Y+SL+  ++D++   VT  A   CG   P+ E QP+P +    +   + G+T   +GPCE
Sbjct  76   YSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  134

Query  135  VWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DD +     +C   +P    Q   D  +C  + TL++YW+ +       +WQVY NC
Sbjct  135  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMHS----STWQVYVNC  190

Query  193  VGLST  197
              L++
Sbjct  191  APLAS  195

>PPTG_03156
Length=445

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 60/122 (49%), Gaps = 12/122 (10%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSF---QTSGYTL--DGPCEV  135
            Y SL+A +DD++   VT  A   CG   P    QP+P    +   ++ G+T   +GPCE 
Sbjct  76   YKSLKAFIDDKAKITVTG-ATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEA  134

Query  136  WLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            W D  +V    NC   F     E+ Y  S C  A TL++YW+ +       +WQVY NC 
Sbjct  135  WCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGP----TWQVYVNCA  190

Query  194  GL  195
             L
Sbjct  191  PL  192

>PYAP_19712
Length=276

 Score = 68.9 bits (167),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (53%), Gaps = 10/97 (10%)

Query  103  ECGLTSPRTETQPIPTNNSFQ---TSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEV  159
            +CG T P    QPIP +   Q   T+ +   GPCE+WLD   V+S + C  E+P  + +V
Sbjct  71   KCGKTDPNGAVQPIPADGYVQLQITAAHI--GPCELWLDGEMVASAKQCVKEYPDRKIKV  128

Query  160  DYSSCGKA-CTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            D+S C  + C L W WL          W++Y NCV +
Sbjct  129  DFSKCKSSKCQLRWVWLATHN----SPWEIYDNCVTV  161

>PITG_04947
Length=298

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 62/129 (48%), Gaps = 16/129 (12%)

Query  77   QQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDGPCE  134
            + +    +R M+D D  LY        +CG T P+ T   P  T ++  + G    GPCE
Sbjct  47   KSNNIKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCE  100

Query  135  VWLDDTKVSSGRNCHTEFPHGQHE-------VDYSSCGK-ACTLSWYWLGIKYIEGIYSW  186
            +WLDD  V    +C + +  G  +       +DYSSC    C   +YWL ++  +    W
Sbjct  101  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLW  160

Query  187  QVYKNCVGL  195
            QVYKNC+ L
Sbjct  161  QVYKNCIPL  169

>SPRG_07797
Length=318

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 60/122 (49%), Gaps = 15/122 (12%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS--GY--TLDGPCEVW  136
            + +L+A LD          +  +CG+T      QP+P+   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQGPCELW  128

Query  137  LDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
             D+ +V    NC   +P+G   +D S C  A  L+  WL +   +    WQVYKNCV LS
Sbjct  129  CDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ----WQVYKNCVNLS  184

Query  197  TA  198
             A
Sbjct  185  GA  186

>SDRG_08782
Length=450

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 77/177 (44%), Gaps = 32/177 (18%)

Query  38   VVLHPPPFFVVDGLDFQGMALAYLQEQG-------VNTSIEAQSWMQQHGYTSLRAMLDD  90
            +V +PP  F  D +  + +A       G        N +   +++  Q  + +LR MLD 
Sbjct  22   IVSNPPAEFRSDVMRTKYVATIQANFPGKFDDSPQTNVANFNKAFKAQSQFKTLRDMLDP  81

Query  91   ESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGY--TLDGPCEVWLDDTKV  142
                        +CG T    + + IP N      N     G+  +  GPCEVW+D+ +V
Sbjct  82   HGP---------DCGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEVWIDNERV  132

Query  143  SSGRNCHTEFPHGQH---EVDYSSCG-KACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                +C T FP        VDYSSCG   C L +YWL +        WQVYKNCV L
Sbjct  133  FQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALHEPM----WQVYKNCVPL  185

>PYIW_18792
Length=125

 Score = 65.9 bits (159),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96
            Q V  P P + V     Q   LA+L+ QG   + +  ++ +  GY +LR  +DD+  YKV
Sbjct  25   QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV  84

Query  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGP  132
             +   FECG +S +   QPIP   + +++GYT DGP
Sbjct  85   -DGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  119

>PHYSO_246481
Length=318

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTLD-  130
             +   YTSL+ +++D++   VT+ A   CG   P    QP+P      +   T G++   
Sbjct  74   FEASSYTSLKELINDKATITVTD-ATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSH  132

Query  131  -GPCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
             GPCEVW DD +V    +C  ++     E+  D  +C    TL++YWL +       +WQ
Sbjct  133  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHS----STWQ  188

Query  188  VYKNCVGL  195
            VY NC  L
Sbjct  189  VYINCAPL  196

>PHYKE_6002
Length=197

 Score = 67.4 bits (163),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 16/119 (13%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEV  135
            + + +  L+ ++DD S+Y        +CG T P    QPIP++     S      GPCE+
Sbjct  71   KANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEI  124

Query  136  WLDDTKVSSGRNCHT--EFPHGQHEVDYSSC--GKACTLSWYWLGIKYIEGIYSWQVYK  190
            WLD TK  S  NC     FP     VDYSSC  G    + +YWL  + ++    WQ Y+
Sbjct  125  WLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PYU1_G005325
Length=207

 Score = 67.4 bits (163),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 13/120 (11%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEVW  136
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            L +T+     +C   F      ++D+S+C   C L +YWLG++  +G   WQ YKNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIPL  175

>H257_11264
Length=282

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 82/183 (45%), Gaps = 27/183 (15%)

Query  31   AGLGEGQVVLHPPPFFVVDGLD---FQGMALAYLQEQGVN-------TSIEAQSWMQQHG  80
            A L  G +V  P P FV  G D   + G     +   G N        +IE    +++  
Sbjct  20   ATLAHGYLV-DPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSS  78

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ----TSGYTL--DGPCE  134
            + SLRA +D +           ECGLT      + +P+++  +    + G+ L  +GPCE
Sbjct  79   FASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVG  194
            +W D T+V    NC    P G   ++ S C  +  L   WL +   +    WQVYKNCV 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVR  188

Query  195  LST  197
            L++
Sbjct  189  LTS  191

>PYIR_22134
Length=300

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 68/149 (46%), Gaps = 17/149 (11%)

Query  55   GMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQ  114
            GM+     E   N    A   ++   Y S+RA+++ + ++     A  ECG+TS     Q
Sbjct  63   GMSFTTDPESNTNAFTAA---LKASTYDSVRALVEAKGVF--ISGATKECGITSATGTAQ  117

Query  115  PIPTN----NSFQTSGYTLD--GPCEVWLDDTKVSSGRNCHTEFPHGQHE--VDYSSCGK  166
            P+P      +   + G+T    GPCEVW D+ KV S  NC   +P    E  +D++ C  
Sbjct  118  PLPAKYVEWSHSSSEGFTPSHQGPCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVG  177

Query  167  ACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
               L   WL +       +WQ+Y NC  L
Sbjct  178  TSLLKIVWLALHS----STWQIYINCAPL  202

>PHYKE_1913
Length=280

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 17/105 (16%)

Query  104  CGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG---  155
            CG T    + +P+P++           G+T  GPCEV+++D  V  G +C  E+P G   
Sbjct  86   CGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHGDDCEDEYPGGPDG  145

Query  156  -----QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                 +  +DYSSC   CTL+ YWL  +  +    WQ Y NCV L
Sbjct  146  SNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PHYRA_78626
Length=473

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 3/58 (5%)

Query  147  NCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL---STAPTA  201
            NCH        ++DYS CG +C L WYWLG +Y++G YSWQVYK C+ L   S AP A
Sbjct  350  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGSGAPEA  407

>HYAP_11923
Length=606

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 52/107 (49%), Gaps = 11/107 (10%)

Query  96   VTEEAIFECGLTSPRTETQPIPTN---NSFQTSGYTL--DGPCEVWLDDTKVSSGRNCHT  150
            V + A  ECGLT P    QPIP     +   T G+T   +GPCE W DDT+V    NC  
Sbjct  93   VAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCDDTQVFQDENCAA  152

Query  151  EFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
             F     ++  D + C  A   ++YWL +       +WQVY NC  L
Sbjct  153  HFTTAPAKMPYDKAKCSGASRFTFYWLALHS----STWQVYVNCAAL  195

>PYIW_24288
Length=201

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 64/146 (44%), Gaps = 14/146 (10%)

Query  58   LAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  117
            + Y      N  +  +++  Q+ Y +LR ++D  +++    +   ECG TS     QP+P
Sbjct  62   MTYSSNGANNARVYERAFGNQNRYRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPLP  119

Query  118  ------TNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACT  169
                   N   Q    T +GPCEVW D        NC   F     ++ Y  S C  A  
Sbjct  120  AQYVEWNNRVNQGLAPTHEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKM  179

Query  170  LSWYWLGIKYIEGIYSWQVYKNCVGL  195
            L +YWL +   E    W+VY NCV L
Sbjct  180  LKFYWLSLDSRE----WEVYINCVPL  201

>PHYKE_5749
Length=300

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 50/105 (48%), Gaps = 17/105 (16%)

Query  104  CGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHG---  155
            CG T P  + QPIP++        +  G+T  GPCE++LDD  V    +C  EF  G   
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  156  -----QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
                    VDYSSC   C  + YWL  +  +    WQ Y NCV L
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PHYRA_78625
Length=434

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 3/58 (5%)

Query  147  NCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL---STAPTA  201
            NCH        ++DYS CG +C L WYWLG +Y++G YSWQVYK C+ L   S AP A
Sbjct  311  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGSGAPEA  368

>PYU1_G001527
Length=278

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 14/127 (11%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTLD--G  131
            Q  Y S+RA++D + +++       ECG+TSP  E QP+P          + G+T    G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
            PCEVW D+    S  NC T +P    ++  D S C     L +YWL +       +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQAY  193

Query  190  KNCVGLS  196
              C  L+
Sbjct  194  IACAPLA  200

>PYU1_G001523
Length=278

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 14/127 (11%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTLD--G  131
            Q  Y S+RA++D + +++       ECG+TSP  E QP+P          + G+T    G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  132  PCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
            PCEVW D+    S  NC T +P    ++  D S C     L +YWL +       +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQAY  193

Query  190  KNCVGLS  196
              C  L+
Sbjct  194  IACAPLA  200

>PHYKE_9024
Length=299

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 70/146 (48%), Gaps = 16/146 (11%)

Query  65   GVNTSIEA-QSWMQQHGYTSLRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSF  122
            GVN ++   +      GY SL A +  ++ LY    +A  +CGLT  +   +     +  
Sbjct  62   GVNGTLNFFKDTFPSKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKL  119

Query  123  QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYI  180
              SG+T  GPCEVW DDTKV    +C T++P        D S C  A  L+ YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLHGD  179

Query  181  EGIYSWQVYKNCV------GLSTAPT  200
                 WQVY +CV      G  +APT
Sbjct  180  P----WQVYTDCVWLEGGSGSGSAPT  201

>PHYSO_374518
Length=116

 Score = 64.3 bits (155),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query  101  IFECGLTSPRTETQPIPTNNSFQ--TSGYTLDGPCEVWLDDTKVSSGRNCHTEFP---HG  155
            I ECG T  +   QP+P++   Q  T G +  GPCE+W DDT+V    NC  E+      
Sbjct  5    ISECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPT  64

Query  156  QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            +  +D S+C  +    +YWL +        WQVY NCV L
Sbjct  65   KLPIDVSTCKASSEFVFYWLALH----AQPWQVYINCVAL  100

>PPTG_18166
Length=445

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 17/107 (16%)

Query  103  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEVWLDDTKVSSGRNCHTEFP----  153
            +CG T      +PIP++   +       G+T  GPCE++LDD  V  G +C  E+P    
Sbjct  83   KCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSD  142

Query  154  ----HGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
                  +  VD+SSC   CTL+ YWL  +  +    WQ Y NCV LS
Sbjct  143  GSSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ----WQTYVNCVPLS  185

>PYIW_15526
Length=256

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 62/128 (48%), Gaps = 23/128 (18%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNS--FQTSGY------TL  129
            + GYTSL+ MLD         +++  CG T+P      +    S  +Q + Y      + 
Sbjct  74   KTGYTSLKEMLD---------KSVSGCGYTNPNAAPVDVSGLKSMKYQNNEYKEGFLGSH  124

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
             GPCE W+D+TK+    +C   +P       VDYS C   C L++YWL +   +    WQ
Sbjct  125  RGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQ  180

Query  188  VYKNCVGL  195
            VYK CV +
Sbjct  181  VYKGCVAI  188

>PHALS_03177
Length=259

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query  69   SIEA-QSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGY  127
            S++A QS    + +  L+ ++D+  L +       +CG + P  + QPIP +     S  
Sbjct  62   SVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRA  114

Query  128  TL-DGPCEVWLDDTKVSSGRNCHTEFPH------GQHEVDYSSC--GKACTLSWYWLGIK  178
             +  GPCE+WLD+ KV    +C++++ +          VDYSSC  G    + +YWL  +
Sbjct  115  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  174

Query  179  YIEGIYSWQVYKNCVGL  195
             I G   WQ YK C+ L
Sbjct  175  GINGKTFWQSYKMCIPL  191

>H257_11265
Length=282

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 82/183 (45%), Gaps = 27/183 (15%)

Query  31   AGLGEGQVVLHPPPFFVVDGLD---FQGMALAYLQEQGVNTSIEAQS-------WMQQHG  80
            A L  G +V  P P FV  G D   + G     +   G N ++  Q         +++  
Sbjct  20   ATLAHGYLV-DPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKSS  78

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ----TSGYTL--DGPCE  134
            + SLRA +D +           ECGLT      + +P+++  +    + G+ L  +GPCE
Sbjct  79   FASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVG  194
            +W D T+V    NC    P G   ++ S C  +  L   WL +   +    WQVYKNCV 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVR  188

Query  195  LST  197
            L++
Sbjct  189  LTS  191

>PITG_11937
Length=305

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 11/110 (10%)

Query  96   VTEEAIFECGLTSPRTETQPIPTNNSF---QTSGYTL--DGPCEVWLDDTKVSSGRNCHT  150
            V   A  +CGLT P    QP+P    +    T G+T   +GPCE W DDT+V    NC  
Sbjct  86   VATGANLQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCDDTQVFQDTNCAA  145

Query  151  EFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198
             F     ++ Y  ++C  A  L++YWL +       +WQVY NC  L  A
Sbjct  146  HFTTAPAKLPYNKAACSGASRLAFYWLALHS----STWQVYANCAALEGA  191

>SDRG_17317
Length=122

 Score = 64.3 bits (155),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 39/69 (57%), Gaps = 8/69 (12%)

Query  131  GPCEVWLDDTKVSSGRNCHTEF---PHGQHEVDYSSC-GKACTLSWYWLGIKYIEGIYSW  186
            GPCEVWLDD +V    +C T F   P     +DYSSC G  C L +YWL +        W
Sbjct  44   GPCEVWLDDKRVFQNDDCATNFPAKPAAHLPIDYSSCSGDGCMLRFYWLALHEP----MW  99

Query  187  QVYKNCVGL  195
            QVYKNCV L
Sbjct  100  QVYKNCVPL  108

>PHYRA_84732
Length=265

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 61/127 (48%), Gaps = 28/127 (22%)

Query  80   GYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN--------NSFQTSGY--TL  129
            GY+SLR MLD +         + +C  T  RT+  P+  +        N  +  G+  + 
Sbjct  80   GYSSLRDMLDQQ---------VTDCANT--RTDVSPVDVSGLTVLNWQNDQEQKGFIDSH  128

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPHG---QHEVDYSSCGKACTLSWYWLGIKYIEGIYSW  186
             GPCEVW+DDTKV    +C   +  G       D+S C   CTL +YWL +       +W
Sbjct  129  HGPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLALHEP----NW  184

Query  187  QVYKNCV  193
            QVYK CV
Sbjct  185  QVYKQCV  191

>PHYCA_69583
Length=224

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 65/133 (49%), Gaps = 19/133 (14%)

Query  77   QQHGYTS-LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPC  133
            ++ GY + +R +LD D +LY         CG ++P  + +  P++ +     G    GPC
Sbjct  73   KEAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFERGLAHHGPC  126

Query  134  EVWLDDTKVSSGRNCHTEFPHGQH--------EVDYSSCGKA-CTLSWYWLGIK-YIEGI  183
            E+WLDD  V    +C   F    +         +DYSSC  + C   +YWL  +    G 
Sbjct  127  EIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  184  YSWQVYKNCVGLS  196
            Y WQ+YK+C+ L+
Sbjct  187  YVWQIYKDCIPLT  199

>PYAP_18221
Length=226

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 69/154 (45%), Gaps = 28/154 (18%)

Query  53   FQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTE  112
            FQG       EQ      +A    +Q G  SLR ++D         + +  CG T+P T 
Sbjct  56   FQGKPFNRSPEQNTQVFTDA---FKQSGLKSLRELMD---------KYVPGCGNTNPNTT  103

Query  113  TQPIPT-------NNSFQTSGY--TLDGPCEVWLDDTKVSSGRNCHTEFPH--GQHEVDY  161
             + +         NN ++  G+  +  GPCEVW+D+T+V    +C   +        VDY
Sbjct  104  PRDVTKLKTMTYQNNEYK-EGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAALPVDY  162

Query  162  SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            S C   C L++YWL +   +    WQ YK CV +
Sbjct  163  SKCKGTCRLTFYWLALHSQK----WQAYKQCVPI  192

>H310_05432
Length=301

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 16/126 (13%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ----TSGY--TL  129
             ++  +TSL+A++  +           ECG+T      QP+P +   +      GY  + 
Sbjct  71   FKKSSFTSLKALVHSQ------PTTCGECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSH  124

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
            +GPCEVW D T+V S  NC    P+G   ++ ++C  A  L + WL +       SWQVY
Sbjct  125  EGPCEVWCDATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAMH----TSSWQVY  180

Query  190  KNCVGL  195
             NCV L
Sbjct  181  INCVPL  186

>PPTG_06256
Length=318

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 9/121 (7%)

Query  76   MQQHGYTSLRAML-DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCE  134
            +   G  SL A++  ++ LY  + +   +CGLT+ +   +     +  + +G+T  GPCE
Sbjct  74   LPTKGGGSLGALIAKNQKLY--SSDVDPDCGLTTFKESARSKLPASQLEYTGFTHPGPCE  131

Query  135  VWLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNC  192
            VW DDTKV    +C T+FP    ++ Y  S C  A  L+ YWL +   +    WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVHGEQ----WQVYSDC  187

Query  193  V  193
            V
Sbjct  188  V  188

>PYU1_G001526
Length=334

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (49%), Gaps = 18/129 (14%)

Query  78   QHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP--------TNNSFQTSGYTL  129
            Q  Y S+RA++D + +++       ECG+TSP  E QP+P        +N+   T  +T 
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT-  136

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
             GPCEVW D+    S  NC T +P    ++  D S C     L +YWL +       +WQ
Sbjct  137  -GPCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHS----STWQ  191

Query  188  VYKNCVGLS  196
             Y  C  L+
Sbjct  192  AYIACAPLA  200

>PYIW_24289
Length=196

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (46%), Gaps = 17/161 (11%)

Query  39   VLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTE  98
            +L P    V +G+ + G     +      T+  +Q+      Y +LR ++D ++++    
Sbjct  49   MLGPEVLPVPEGMSYSGSP--EMNALAFKTAFSSQT--DSIKYRNLRDLIDTKAVFSAGT  104

Query  99   EAIFECGLTSPRTETQPIPTNNSFQTSGYTL--DGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            +   ECG T+  +  QP+   ++  T G+T    GPCE+W D   V    NC   +P   
Sbjct  105  DK--ECGFTNVTSAKQPL---SAHATGGFTPTHQGPCEIWCDRVLVFQNDNCAKNYPAAP  159

Query  157  HEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
             ++ Y  S C  A  L +YWL +  I+    W+ Y NC  L
Sbjct  160  AQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

>PYAR_14260
Length=212

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 64/120 (53%), Gaps = 15/120 (13%)

Query  79   HGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD--GPCEVW  136
             G+ +LR+ L+ +            CG +    + +PIP++   + +  TL+  GPCE+W
Sbjct  44   KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFAS-TLEHPGPCEIW  93

Query  137  LDDTKVSSGRNCHTEFPHGQH-EVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            LD+T      +C  +F      +V++S+C  +C L +YWLG++  +    WQ YKNCV L
Sbjct  94   LDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  151

>SPRG_07825
Length=337

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 71/146 (49%), Gaps = 15/146 (10%)

Query  59   AYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTS-PRTETQPIP  117
            AY Q+ G N +  A ++ +   Y +L+A LD       T     +CG+T       QP+P
Sbjct  54   AYNQDPGYNAAQFAANF-KTSKYKTLKAFLDAWD----TSAQCGQCGITKVDAANPQPLP  108

Query  118  TNNSFQ---TSGYTL--DGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSW  172
            +   ++     G+T   +GPCE+W D+T+V    +C    P G   +D S C  A  L+ 
Sbjct  109  SIVKWRHGDNEGFTPSHEGPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTM  168

Query  173  YWLGIKYIEGIYSWQVYKNCVGLSTA  198
             W+ +   +    WQ YKNCV + +A
Sbjct  169  LWMALHTPQ----WQAYKNCVAIGSA  190

>PHYSO_255056
Length=269

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 15/124 (12%)

Query  77   QQHGY-TSLRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPC  133
            ++ GY  ++R +LD D +LY        +CG ++P  + +  PT+ +     G    GPC
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFERGLAHHGPC  127

Query  134  EVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIK-YIEGIYSWQVYKNC  192
            E+WLDDT V    +C   F       DY S    C   +YWL  +    G Y WQ+YKNC
Sbjct  128  EIWLDDTMVLHNDDCAKAF----SVEDYMSI-NGCMFRFYWLAFQGSTSGKYVWQIYKNC  182

Query  193  VGLS  196
            + L+
Sbjct  183  IPLT  186

>PHYCA_15125
Length=334

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  79   HGYTSLRAML-DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWL  137
             GY SL A +  ++ LY    +   +CGLT  +   +     +  + SG+T  GPCEVW 
Sbjct  114  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPCEVWC  171

Query  138  DDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV--  193
            DDTKV    +C T++P    ++ Y  S C  A  L+ YW+G+        WQVY +CV  
Sbjct  172  DDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLHGD----PWQVYTDCVWL  227

Query  194  ----GLSTAPTA  201
                G   AP+A
Sbjct  228  EGGSGSGEAPSA  239

>PPTG_04803
Length=268

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 60/127 (47%), Gaps = 17/127 (13%)

Query  75   WMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ--TSGYTLDGP  132
            W  ++   SL+  +   + Y      I ECG T  +   QP+P++   Q  T G +  GP
Sbjct  69   WFTKNNVASLKEFI---TTYGTD---ISECGNTEKKGTAQPVPSDGYAQHDTLGNSHPGP  122

Query  133  CEVWLDDTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQV  188
            CE+W DDT+V    NC   F  GQ      +D S+C  +    +YWL +        WQV
Sbjct  123  CEIWCDDTRVFHDTNCVVTF-SGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQV  177

Query  189  YKNCVGL  195
            Y NCV L
Sbjct  178  YINCVAL  184

>PYAP_18713
Length=184

 Score = 64.7 bits (156),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 18/126 (14%)

Query  77   QQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEV  135
            +  G+  LR+ L+D+            CG T+P  + + +P+++    S   +  GPCE+
Sbjct  68   KDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCEL  118

Query  136  WLDDTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKN  191
            W+DDT V    +C  EF  G+      VD+SSC   C L +YWLG++  +    WQ Y  
Sbjct  119  WIDDTMVYHNDDCELEF--GKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSYST  174

Query  192  CVGLST  197
             +  S+
Sbjct  175  YIAESS  180

>PHYKE_2379
Length=285

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 17/127 (13%)

Query  75   WMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN--SFQTSGYTLDGP  132
            W  ++G +SL+  +   + Y      I ECG T      + IP++      T G +  GP
Sbjct  70   WFTKNGISSLKEYI---TTYGTN---ISECGNTLKDGTAEAIPSDGYAEHDTLGNSHPGP  123

Query  133  CEVWLDDTKVSSGRNCHTEFPHGQH----EVDYSSCGKACTLSWYWLGIKYIEGIYSWQV  188
            CE+W DDT+V +  NC TEF  GQ      +D S+C  +    +YWL +        WQV
Sbjct  124  CEIWCDDTRVFNNTNCVTEF-SGQSPAKIPIDVSTCKASSEFVFYWLALH----AQPWQV  178

Query  189  YKNCVGL  195
            Y NCV L
Sbjct  179  YINCVAL  185

>PYAP_24691
Length=145

 Score = 63.9 bits (154),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 3/69 (4%)

Query  131  GPCEVWLDDTKVSSGRNCHTEFPHG-QHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
            GPCE+W D+T+V    +C   F    Q ++DYS C   C L +YWLG++  +G   WQ Y
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSY  62

Query  190  KNCVGLSTA  198
            KNCV +   
Sbjct  63   KNCVPIGNG  71

>PHYRA_86751
Length=163

 Score = 63.9 bits (154),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 50/101 (50%), Gaps = 17/101 (17%)

Query  102  FECGLTSPRTETQPIPTNN-----SFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156
            + CG T    + + I T+           G+T  GPCE++LDDT +  G NC  E+  G 
Sbjct  7    YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  66

Query  157  HE--------VDYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
             +        +DYSSC  ACTL+ YWLG +  +    WQ Y
Sbjct  67   DDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ----WQAY  103

>PYAR_15391
Length=176

 Score = 64.3 bits (155),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 12/117 (10%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDT  140
            +TSLR +++ +S       +   CG+T P    QP+P +  +     +  GPCEVW D  
Sbjct  60   FTSLRDLIEKKS------PSTPACGITPPGGAPQPVPDHVEWSAFADSHVGPCEVWCDQK  113

Query  141  KVSSGRNCHTEFPH--GQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195
            +V    NC  ++P    +  ++ + C  A  L +YWL +   +    WQ+Y NC  L
Sbjct  114  RVFQEDNCAGKYPARPAKLPINAADCANAKELKFYWLALHSQD----WQIYINCAPL  166

>PYIR_17978
Length=250

 Score = 65.5 bits (158),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 55/126 (44%), Gaps = 11/126 (9%)

Query  76   MQQHGYTSLRAML----DDESLYKVTEEAIFECGLTSPRTET-QPIPTNNSFQTSGYTLD  130
             ++  Y SLR       D     K    +  ECG T+P  +T QP+P N  +   G    
Sbjct  77   FKKSKYKSLREFFMKNQDMSQGVKSGNPSTAECGFTAPDKQTAQPLPDNIEWYGGGQNHP  136

Query  131  GPCEVWLDDTKV-SSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVY  189
            GPCE W D+  V     NC   FP G    D + C     LS+YW+       +  WQVY
Sbjct  137  GPCEAWCDNEIVLPFTANCQAAFPKGIMAYDKAKCVGKNRLSFYWMAT-----LNQWQVY  191

Query  190  KNCVGL  195
             +CV +
Sbjct  192  IDCVKI  197

>PHYCA_123316
Length=316

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 58/122 (48%), Gaps = 12/122 (10%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN---NSFQTSGYTL--DGPCEV  135
            Y+S++  + D+    V   A  ECGLT P    Q +P         T G+T   +GPCE 
Sbjct  78   YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  136

Query  136  WLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            W DDT+V    NC   F     ++  D + C  +  L++YWL +       +WQ+Y NC 
Sbjct  137  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALHS----STWQIYVNCA  192

Query  194  GL  195
             L
Sbjct  193  AL  194

>PHYSO_476077
Length=268

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 64/133 (48%), Gaps = 28/133 (21%)

Query  74   SWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN--------NSFQTS  125
            S   + GY+SLR MLD +         + +C  T  RT+  P+  +        N  +  
Sbjct  74   SSFAKAGYSSLRDMLDQQ---------VTDCANT--RTDVSPVDVSGLTTMSWQNDQEQK  122

Query  126  GY--TLDGPCEVWLDDTKVSSGRNCHTEFPHG---QHEVDYSSCGKACTLSWYWLGIKYI  180
            G+  +  GPCEVW+DDT V    +C  ++  G   +   D+S C   CTL +YWL +   
Sbjct  123  GFIDSHHGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHEP  182

Query  181  EGIYSWQVYKNCV  193
                +WQ+YK CV
Sbjct  183  ----NWQIYKQCV  191

>PHYSO_472009
Length=268

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 64/133 (48%), Gaps = 28/133 (21%)

Query  74   SWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN--------NSFQTS  125
            S   + GY+SLR MLD +         + +C  T  RT+  P+  +        N  +  
Sbjct  74   SSFAKAGYSSLRDMLDQQ---------VTDCANT--RTDVSPVDVSGLTTMSWQNDQEQK  122

Query  126  GY--TLDGPCEVWLDDTKVSSGRNCHTEFPHG---QHEVDYSSCGKACTLSWYWLGIKYI  180
            G+  +  GPCEVW+DDT V    +C  ++  G   +   D+S C   CTL +YWL +   
Sbjct  123  GFIDSHHGPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHEP  182

Query  181  EGIYSWQVYKNCV  193
                +WQ+YK CV
Sbjct  183  ----NWQIYKQCV  191

>PHYRA_78162
Length=478

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 61/123 (50%), Gaps = 12/123 (10%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN---NSFQTSGYTL--DGPCEV  135
            Y SL+A++DD++   VT  A   CG   P    Q +P     +  ++ G+T   +GPCEV
Sbjct  76   YKSLKALIDDKAKVTVTG-ATLTCGTADPAAAAQALPKTVEWSHSESEGFTASHEGPCEV  134

Query  136  WLDDTKVSSGRNCHTEFPHGQHEVDY--SSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV  193
            W DD +     NC   F     E+ Y  S C  A  L++YW+ +       SWQVY NC 
Sbjct  135  WCDDVRAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWMAMHGP----SWQVYVNCA  190

Query  194  GLS  196
             LS
Sbjct  191  NLS  193

>PYU1_G006403
Length=252

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 48/97 (49%), Gaps = 8/97 (8%)

Query  104  CGLTS-PRTETQPIPTNNSF---QTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEV  159
            CG T     +   +PT   F      G+T  GPCE+W DDTK+S   +C  ++P G   +
Sbjct  103  CGYTKLDEAKRSELPTEMKFGNGDVGGFTHPGPCELWCDDTKLSYDNDCAAKYPSGLVPI  162

Query  160  DYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
            D S C  A   + YWL +        WQVY NCV L+
Sbjct  163  DTSKCANANQFTVYWLAVH----ASMWQVYTNCVYLT  195

>PYVX_22508
Length=298

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query  76   MQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--  129
             +   YTSL+ M+ D      T      CGLT P    Q +P          T G+T   
Sbjct  58   FEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASH  117

Query  130  DGPCEVWLDDTKVSSGRNCHTEFPHGQHEV--DYSSCGKACTLSWYWLGIKYIEGIYSWQ  187
            +GPCE+W DDT+V    +C   +     ++  D  +C  A  L++YWL +       +WQ
Sbjct  118  EGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALHS----STWQ  173

Query  188  VYKNCVGL  195
            VY NC  L
Sbjct  174  VYINCAAL  181

>SDRG_16534
Length=320

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 56/120 (47%), Gaps = 15/120 (13%)

Query  81   YTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTLDGPCEVW  136
            + +L+A LD             +CG+T      QP+P+     N  +    +  GPCE+W
Sbjct  76   FKTLKAFLD-------AYPTGGDCGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELW  128

Query  137  LDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196
             D+T+V    NC    P G   +D S C  A  L+  WL +   E    WQVYKNCV LS
Sbjct  129  CDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

Lambda      K        H        a         alpha
   0.318    0.134    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9138472161

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40