Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_17122147522041819013e-124
PHYCA_129425147522041807903e-107
PITG_18450147522031617878e-107
PHYSO_284086147522041807695e-104
PHYKE_8389147522041817642e-103
PHYRA_81106147522021617426e-100
PHYRA_82864231281931606862e-91
PHYCA_14369109792481626815e-90
PPTG_17121568762021616741e-89
PHYSO_341599109791851626633e-88
PHYKE_3446231281991616628e-88
PPTG_15264231281941646611e-87
PPTG_17366239131941646611e-87
PHYKE_8388568762051616611e-87
PPTG_10635528561991616602e-87
PHYSO_477820568762021616592e-87
PHYRA_81107568762021616574e-87
PHYRA_85631109792281626544e-86
PHYCA_511409568762041616514e-86
PHYCA_102852242061951626505e-86
PPTG_10643457052501626521e-85
PHYRA_84190720132061626462e-85
PHYSO_536424606911971586443e-85
PHYSO_507031586531971586443e-85
PHYKE_7718109792201616448e-85
PPTG_10634720132081626412e-84
PPTG_10636109792461616442e-84
PHYCA_102550457052681626435e-84
PYVX_18176568762011606272e-82
PYVX_18174854042041616176e-81
PHYCA_102624720131951626151e-80
PPTG_10048213141901616028e-79
PYVX_18173449665001596201e-77
PHALS_00498109791991595837e-76
PYU1_G001741854041991625742e-74
PYU1_G001742932042131625673e-73
PYIR_25089854042621615611e-71
PYIR_26626147522121615552e-71
PHYSO_499978231281741425512e-71
PHYSO_501575820771741425512e-71
PYU1_G001744568762131625464e-70
PYU1_G001740147522061625403e-69
PHALS_03284309411881595359e-69
PPTG_0882086622501685349e-68
PITG_13520109791711325122e-65
PPTG_14254445761881665132e-65
PHYCA_510817445761881675107e-65
PHYSO_343376532371721315087e-65
PPTG_14255469372681665123e-64
PYU1_G001739932032661605107e-64
PHYSO_417649445761851654975e-63
PHYKE_9185445762811675048e-63
PITG_1049986623231575079e-63
PHYSO_254168462841701464931e-62
PHYCA_53693413059831665222e-60
PYAR_24096932032271634739e-59
PYAP_22278932042891674744e-58
PYAP_22273932032681624716e-58
PHYSO_262732469371881664561e-56
PYAP_22279854042231644572e-56
PHYSO_341596528562311254563e-56
PYIW_18791854041941624517e-56
PHYCA_14368528562191614406e-54
PYIR_26546866052391664401e-53
PHYSO_527908600641741524237e-52
PHYSO_246676457051871624012e-48
PHYRA_81105534612011573752e-44
PPTG_17123147532011573711e-43
PYU1_G001738534612261603703e-43
PHYSO_340369526762001663659e-43
PHYCA_537323449662001573632e-42
HYAP_07096534612511583645e-42
PITG_18452147538561573796e-41
PHYSO_353401534611461363356e-39
PYIW_18788932032441603183e-35
PYAP_18131991722261102877e-31
PYVX_18179534611471612801e-30
PHYRA_78625541464341642934e-30
PYIW_18792932041251012745e-30
PHYRA_78626578954731642935e-30
PYIR_16443823992751672593e-26
PYIR_1643542333041262604e-26
PHYSO_342364529831941362526e-26
PHYKE_81047713586622411e-25
PYIR_1644442341821652482e-25
PYU1_G007476539131951312473e-25
PITG_1981815643147602365e-24
PYVX_1817514752147652339e-24
PHYRA_7358242353261772413e-23
PHYCA_13036542352661422365e-23
PHYRA_8615172836170742297e-23
PHYSO_533903604652081372328e-23
PYIW_187905687686782228e-23
PHYRA_8794174106157742271e-22
PHYRA_74651699693441322381e-22
PYAR_2411397811921722291e-22
PYAP_18709943552351162312e-22
PHYCA_12727044782791362314e-22
PYU1_G01469042342951262315e-22
PHYKE_10578778802391772261e-21
PHYCA_12942213313531742311e-21
PITG_0494942353371752301e-21
PITG_0494842342321272251e-21
PPTG_0461842353261782292e-21
PYAP_246891014392521242252e-21
PYIW_27477823991801632175e-21
PYU1_G005324845341911182186e-21
PYU1_G005326463491911182186e-21
PYU1_G00532842331911182186e-21
PYU1_G005325943562071182196e-21
PYAP_18711943562101302197e-21
PHYSO_533682604462781352227e-21
PHYSO_438103557212381352208e-21
PYIW_19151831912481272209e-21
PHYSO_340333526712841352211e-20
PPTG_1422144782751362201e-20
PHYSO_34033244782951352211e-20
PHYSO_48395542353201422221e-20
PHYKE_6002526711971652151e-20
PPTG_0461942342761282202e-20
PHALS_0317644782071362162e-20
PHYSO_48552442342781272182e-20
PYU1_G007364851643161772203e-20
PHYKE_600144782891362193e-20
PHYRA_7868968382961362193e-20
PYIW_242891643031961772133e-20
PPTG_04622696962731322174e-20
PHYRA_73607194343431322194e-20
PYAR_14260845342121162135e-20
CCI4738117292111242126e-20
H310_0636217301971252091e-19
PHALS_03177526712591362121e-19
PYU1_G005323943552511182121e-19
SDRG_165351259803131752142e-19
PYIR_19612831912601332112e-19
PHYKE_391342343211002142e-19
PYIW_1552617302561842093e-19
PHYSO_533747604512061362073e-19
CCA1717917291851242054e-19
PYAR_14256943551991172054e-19
PPTG_07509718142991422096e-19
PPTG_03153597733141772106e-19
PPTG_0750738072991422097e-19
PHYKE_2809752822911282098e-19
PHYRA_77971705552301092068e-19
PHYRA_85794726192301092058e-19
PHYRA_7358342346301282139e-19
PHYCA_534296526713091352091e-18
PHYKE_771752856568412121e-18
PYIR_23585845342401642051e-18
PITG_1193697753331792091e-18
PYU1_G00151997822651772061e-18
PHYSO_459106194342231282041e-18
PHYCA_531163194343141282081e-18
PHYKE_607897753171802072e-18
PITG_0527144782781352052e-18
PHALS_03179308833721362073e-18
PHYCA_97965401872881792034e-18
PHALS_0539242353671242054e-18
PHYRA_7358442332871322035e-18
SDRG_154261258855231382075e-18
H257_1355017302661412025e-18
SDRG_081371363342821782025e-18
PHYSO_484051571982851282026e-18
PHYRA_73606571983661322046e-18
SPRG_19916161733051382036e-18
PHYCA_12943369712871792026e-18
SDRG_075651244122781792018e-18
SDRG_081291363312181791971e-17
PPTG_04647194343271302021e-17
PHYCA_19598375713901812031e-17
PHYRA_86016727462361071981e-17
PHYRA_83494464352241091971e-17
PHYRA_78176597733121782002e-17
PHYSO_524101597733081802002e-17
PYIR_24421899032131331952e-17
PPTG_0316097913791812012e-17
PHYCA_534473423310501272032e-17
PYVX_14662510865401402022e-17
PHYKE_2937571983661282003e-17
SPRG_2216117303001381973e-17
PHYRA_86752732363001071973e-17
PYIW_242881643022011231924e-17
PHYRA_7914038074241851994e-17
PITG_0494742332981291965e-17
PYU1_G00152597813121771966e-17
PPTG_0462042333421291976e-17
PPTG_0752038142941421956e-17
PPTG_07516464352941421957e-17
PPTG_0313997753201291967e-17
PPTG_03138188562941791957e-17
PHYRA_78161375713731811968e-17
PPTG_0315697874451791978e-17
PYU1_G005871944962841791949e-17
PHALS_04411944962621771921e-16
PYIW_254631650392161791901e-16
PHYCA_69583463492241021901e-16
PYU1_G005872161732971791931e-16
SDRG_173181339462411761911e-16
PYAR_206171040482541301902e-16
PPTG_18166242064451071952e-16
PHALS_0539442342881231912e-16
SPRG_199171339462411761892e-16
PHYRA_83500718143941041932e-16
PHYSO_31868397763521761923e-16
PYAP_1871342341841191844e-16
PHYSO_324715696932741721894e-16
PHYKE_839053461130971814e-16
PHYCA_1865738072951091894e-16
PYU1_G005873510322141821864e-16
PHYKE_1913732362801791894e-16
PITG_0820268381911251844e-16
PHYCA_19612188566101811925e-16
PYVX_20783375052761751885e-16
PHYRA_8075044782751301885e-16
PYAP_18221944962261371865e-16
PHYSO_25505646349269981876e-16
PYAP_18138991732681161876e-16
SPRG_077961259803221761897e-16
SDRG_17317161731221031797e-16
PYU1_G005985820772001801837e-16
HYAP_1192397766061761917e-16
H257_112711259803721751898e-16
PYIR_25999861323441771898e-16
PYAP_222571003612471291859e-16
PYIR_2213497753001801879e-16
SPRG_078251259983371751889e-16
PHYKE_6077188563221291871e-15
PYIR_2533497822721551861e-15
PHYRA_83499204334731061891e-15
SPRG_0782697753711751881e-15
PHALS_02044930992371151841e-15
PYU1_G001514188574691811891e-15
PYAR_2481897821981711821e-15
PYU1_G007254950001861281811e-15
PPTG_07521450302811091851e-15
PPTG_04617696934961171882e-15
PYAR_153911025081761621802e-15
PYIR_24743851643571311862e-15
PHYSO_24648197753181811852e-15
SDRG_0878217304501791872e-15
PYIR_2048117292771321842e-15
SDRG_009721259983331751852e-15
PHYRA_84732161732651271832e-15
PHYKE_2539161732581331832e-15
PYAR_250931061291981781802e-15
HYAP_14170161732661331833e-15
PITG_1193797763051761843e-15
PHYCA_1961197755311291863e-15
SDRG_165341259793201721843e-15
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_17122

Length=204
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_17122                                                            351        3e-124
PHYCA_129425                                                          308        3e-107
PITG_18450                                                            307        8e-107
PHYSO_284086                                                          300        5e-104
PHYKE_8389                                                            298        2e-103
PHYRA_81106                                                           290        6e-100
PHYRA_82864                                                           268        2e-91 
PHYCA_14369                                                           266        5e-90 
PPTG_17121                                                            264        1e-89 
PHYSO_341599                                                          259        3e-88 
PHYKE_3446                                                            259        8e-88 
PPTG_15264                                                            259        1e-87 
PPTG_17366                                                            259        1e-87 
PHYKE_8388                                                            259        1e-87 
PPTG_10635                                                            258        2e-87 
PHYSO_477820                                                          258        2e-87 
PHYRA_81107                                                           257        4e-87 
PHYRA_85631                                                           256        4e-86 
PHYCA_511409                                                          255        4e-86 
PHYCA_102852                                                          254        5e-86 
PPTG_10643                                                            255        1e-85 
PHYRA_84190                                                           253        2e-85 
PHYSO_536424                                                          252        3e-85 
PHYSO_507031                                                          252        3e-85 
PHYKE_7718                                                            252        8e-85 
PPTG_10634                                                            251        2e-84 
PPTG_10636                                                            252        2e-84 
PHYCA_102550                                                          252        5e-84 
PYVX_18176                                                            246        2e-82 
PYVX_18174                                                            242        6e-81 
PHYCA_102624                                                          241        1e-80 
PPTG_10048                                                            236        8e-79 
PYVX_18173                                                            243        1e-77 
PHALS_00498                                                           229        7e-76 
PYU1_G001741                                                          225        2e-74 
PYU1_G001742                                                          223        3e-73 
PYIR_25089                                                            220        1e-71 
PYIR_26626                                                            218        2e-71 
PHYSO_499978                                                          216        2e-71 
PHYSO_501575                                                          216        2e-71 
PYU1_G001744                                                          214        4e-70 
PYU1_G001740                                                          212        3e-69 
PHALS_03284                                                           210        9e-69 
PPTG_08820                                                            210        9e-68 
PITG_13520                                                            201        2e-65 
PPTG_14254                                                            202        2e-65 
PHYCA_510817                                                          201        7e-65 
PHYSO_343376                                                          200        7e-65 
PPTG_14255                                                            201        3e-64 
PYU1_G001739                                                          201        7e-64 
PHYSO_417649                                                          196        5e-63 
PHYKE_9185                                                            198        8e-63 
PITG_10499                                                            199        9e-63 
PHYSO_254168                                                          194        1e-62 
PHYCA_536934                                                          205        2e-60 
PYAR_24096                                                            186        9e-59 
PYAP_22278                                                            187        4e-58 
PYAP_22273                                                            186        6e-58 
PHYSO_262732                                                          180        1e-56 
PYAP_22279                                                            180        2e-56 
PHYSO_341596                                                          180        3e-56 
PYIW_18791                                                            178        7e-56 
PHYCA_14368                                                           174        6e-54 
PYIR_26546                                                            174        1e-53 
PHYSO_527908                                                          167        7e-52 
PHYSO_246676                                                          159        2e-48 
PHYRA_81105                                                           149        2e-44 
PPTG_17123                                                            147        1e-43 
PYU1_G001738                                                          147        3e-43 
PHYSO_340369                                                          145        9e-43 
PHYCA_537323                                                          144        2e-42 
HYAP_07096                                                            144        5e-42 
PITG_18452                                                            150        6e-41 
PHYSO_353401                                                          133        6e-39 
PYIW_18788                                                            127        3e-35 
PYAP_18131                                                            115        7e-31 
PYVX_18179                                                            112        1e-30 
PHYRA_78625                                                           117        4e-30 
PYIW_18792                                                            110        5e-30 
PHYRA_78626                                                           117        5e-30 
PYIR_16443                                                            104        3e-26 
PYIR_16435                                                            104        4e-26 
PHYSO_342364                                                          101        6e-26 
PHYKE_8104                                                            97.4       1e-25 
PYIR_16444                                                            100        2e-25 
PYU1_G007476                                                          99.8       3e-25 
PITG_19818                                                            95.5       5e-24 
PYVX_18175                                                            94.4       9e-24 
PHYRA_73582                                                           97.4       3e-23 
PHYCA_130365                                                          95.5       5e-23 
PHYRA_86151                                                           92.8       7e-23 
PHYSO_533903                                                          94.0       8e-23 
PYIW_18790                                                            90.1       8e-23 
PHYRA_87941                                                           92.0       1e-22 
PHYRA_74651                                                           96.3       1e-22 
PYAR_24113                                                            92.8       1e-22 
PYAP_18709                                                            93.6       2e-22 
PHYCA_127270                                                          93.6       4e-22 
PYU1_G014690                                                          93.6       5e-22 
PHYKE_10578                                                           91.7       1e-21 
PHYCA_12942                                                           93.6       1e-21 
PITG_04949                                                            93.2       1e-21 
PITG_04948                                                            91.3       1e-21 
PPTG_04618                                                            92.8       2e-21 
PYAP_24689                                                            91.3       2e-21 
PYIW_27477                                                            88.2       5e-21 
PYU1_G005324                                                          88.6       6e-21 
PYU1_G005326                                                          88.6       6e-21 
PYU1_G005328                                                          88.6       6e-21 
PYU1_G005325                                                          89.0       6e-21 
PYAP_18711                                                            89.0       7e-21 
PHYSO_533682                                                          90.1       7e-21 
PHYSO_438103                                                          89.4       8e-21 
PYIW_19151                                                            89.4       9e-21 
PHYSO_340333                                                          89.7       1e-20 
PPTG_14221                                                            89.4       1e-20 
PHYSO_340332                                                          89.7       1e-20 
PHYSO_483955                                                          90.1       1e-20 
PHYKE_6002                                                            87.4       1e-20 
PPTG_04619                                                            89.4       2e-20 
PHALS_03176                                                           87.8       2e-20 
PHYSO_485524                                                          88.6       2e-20 
PYU1_G007364                                                          89.4       3e-20 
PHYKE_6001                                                            89.0       3e-20 
PHYRA_78689                                                           89.0       3e-20 
PYIW_24289                                                            86.7       3e-20 
PPTG_04622                                                            88.2       4e-20 
PHYRA_73607                                                           89.0       4e-20 
PYAR_14260                                                            86.7       5e-20 
CCI47381                                                              86.3       6e-20 
H310_06362                                                            85.1       1e-19 
PHALS_03177                                                           86.3       1e-19 
PYU1_G005323                                                          86.3       1e-19 
SDRG_16535                                                            87.0       2e-19 
PYIR_19612                                                            85.9       2e-19 
PHYKE_3913                                                            87.0       2e-19 
PYIW_15526                                                            85.1       3e-19 
PHYSO_533747                                                          84.3       3e-19 
CCA17179                                                              83.6       4e-19 
PYAR_14256                                                            83.6       4e-19 
PPTG_07509                                                            85.1       6e-19 
PPTG_03153                                                            85.5       6e-19 
PPTG_07507                                                            85.1       7e-19 
PHYKE_2809                                                            85.1       8e-19 
PHYRA_77971                                                           84.0       8e-19 
PHYRA_85794                                                           83.6       8e-19 
PHYRA_73583                                                           86.7       9e-19 
PHYCA_534296                                                          85.1       1e-18 
PHYKE_7717                                                            86.3       1e-18 
PYIR_23585                                                            83.6       1e-18 
PITG_11936                                                            85.1       1e-18 
PYU1_G001519                                                          84.0       1e-18 
PHYSO_459106                                                          83.2       1e-18 
PHYCA_531163                                                          84.7       1e-18 
PHYKE_6078                                                            84.3       2e-18 
PITG_05271                                                            83.6       2e-18 
PHALS_03179                                                           84.3       3e-18 
PHYCA_97965                                                           82.8       4e-18 
PHALS_05392                                                           83.6       4e-18 
PHYRA_73584                                                           82.8       5e-18 
SDRG_15426                                                            84.3       5e-18 
H257_13550                                                            82.4       5e-18 
SDRG_08137                                                            82.4       5e-18 
PHYSO_484051                                                          82.4       6e-18 
PHYRA_73606                                                           83.2       6e-18 
SPRG_19916                                                            82.8       6e-18 
PHYCA_12943                                                           82.4       6e-18 
SDRG_07565                                                            82.0       8e-18 
SDRG_08129                                                            80.5       1e-17 
PPTG_04647                                                            82.4       1e-17 
PHYCA_19598                                                           82.8       1e-17 
PHYRA_86016                                                           80.9       1e-17 
PHYRA_83494                                                           80.5       1e-17 
PHYRA_78176                                                           81.6       2e-17 
PHYSO_524101                                                          81.6       2e-17 
PYIR_24421                                                            79.7       2e-17 
PPTG_03160                                                            82.0       2e-17 
PHYCA_534473                                                          82.8       2e-17 
PYVX_14662                                                            82.4       2e-17 
PHYKE_2937                                                            81.6       3e-17 
SPRG_22161                                                            80.5       3e-17 
PHYRA_86752                                                           80.5       3e-17 
PYIW_24288                                                            78.6       4e-17 
PHYRA_79140                                                           81.3       4e-17 
PITG_04947                                                            80.1       5e-17 
PYU1_G001525                                                          80.1       6e-17 
PPTG_04620                                                            80.5       6e-17 
PPTG_07520                                                            79.7       6e-17 
PPTG_07516                                                            79.7       7e-17 
PPTG_03139                                                            80.1       7e-17 
PPTG_03138                                                            79.7       7e-17 
PHYRA_78161                                                           80.1       8e-17 
PPTG_03156                                                            80.5       8e-17 
PYU1_G005871                                                          79.3       9e-17 
PHALS_04411                                                           78.6       1e-16 
PYIW_25463                                                            77.8       1e-16 
PHYCA_69583                                                           77.8       1e-16 
PYU1_G005872                                                          79.0       1e-16 
SDRG_17318                                                            78.2       1e-16 
PYAR_20617                                                            77.8       2e-16 
PPTG_18166                                                            79.7       2e-16 
PHALS_05394                                                           78.2       2e-16 
SPRG_19917                                                            77.4       2e-16 
PHYRA_83500                                                           79.0       2e-16 
PHYSO_318683                                                          78.6       3e-16 
PYAP_18713                                                            75.5       4e-16 
PHYSO_324715                                                          77.4       4e-16 
PHYKE_8390                                                            74.3       4e-16 
PHYCA_18657                                                           77.4       4e-16 
PYU1_G005873                                                          76.3       4e-16 
PHYKE_1913                                                            77.4       4e-16 
PITG_08202                                                            75.5       4e-16 
PHYCA_19612                                                           78.6       5e-16 
PYVX_20783                                                            77.0       5e-16 
PHYRA_80750                                                           77.0       5e-16 
PYAP_18221                                                            76.3       5e-16 
PHYSO_255056                                                          76.6       6e-16 
PYAP_18138                                                            76.6       6e-16 
SPRG_07796                                                            77.4       7e-16 
SDRG_17317                                                            73.6       7e-16 
PYU1_G005985                                                          75.1       7e-16 
HYAP_11923                                                            78.2       7e-16 
H257_11271                                                            77.4       8e-16 
PYIR_25999                                                            77.4       8e-16 
PYAP_22257                                                            75.9       9e-16 
PYIR_22134                                                            76.6       9e-16 
SPRG_07825                                                            77.0       9e-16 
PHYKE_6077                                                            76.6       1e-15 
PYIR_25334                                                            76.3       1e-15 
PHYRA_83499                                                           77.4       1e-15 
SPRG_07826                                                            77.0       1e-15 
PHALS_02044                                                           75.5       1e-15 
PYU1_G001514                                                          77.4       1e-15 
PYAR_24818                                                            74.7       1e-15 
PYU1_G007254                                                          74.3       1e-15 
PPTG_07521                                                            75.9       1e-15 
PPTG_04617                                                            77.0       2e-15 
PYAR_15391                                                            73.9       2e-15 
PYIR_24743                                                            76.3       2e-15 
PHYSO_246481                                                          75.9       2e-15 
SDRG_08782                                                            76.6       2e-15 
PYIR_20481                                                            75.5       2e-15 
SDRG_00972                                                            75.9       2e-15 
PHYRA_84732                                                           75.1       2e-15 
PHYKE_2539                                                            75.1       2e-15 
PYAR_25093                                                            73.9       2e-15 
HYAP_14170                                                            75.1       3e-15 
PITG_11937                                                            75.5       3e-15 
PHYCA_19611                                                           76.3       3e-15 
SDRG_16534                                                            75.5       3e-15 
PYVX_21297                                                            74.7       3e-15 
PHYRA_78172                                                           75.9       3e-15 
PHYRA_73581                                                           75.1       3e-15 
PHYKE_5749                                                            75.1       4e-15 
PHYSO_255975                                                          72.8       5e-15 
PYAP_16338                                                            74.3       5e-15 
PYAR_16493                                                            73.9       5e-15 
PPTG_10073                                                            72.8       5e-15 
PPTG_10186                                                            73.9       5e-15 
PYIR_25571                                                            74.3       5e-15 
SPRG_04679                                                            73.2       6e-15 
PHYRA_84947                                                           73.9       6e-15 
PHYCA_98479                                                           73.9       7e-15 
PHYSO_476077                                                          73.6       7e-15 
PHYSO_472009                                                          73.6       7e-15 
PHYRA_86241                                                           72.4       7e-15 
PYIW_21964                                                            73.6       8e-15 
PHYSO_525076                                                          74.3       1e-14 
PHYKE_7445                                                            74.3       1e-14 
PHYCA_122958                                                          73.2       1e-14 
PYU1_G005868                                                          73.2       1e-14 
PPTG_03143                                                            73.9       1e-14 
PYIR_22549                                                            72.8       1e-14 
PHYRA_78175                                                           73.6       1e-14 
SPRG_07799                                                            73.6       2e-14 
SPRG_07627                                                            73.9       2e-14 
PHYKE_6079                                                            73.2       2e-14 
PHYSO_262844                                                          72.8       2e-14 
PYIW_24287                                                            73.2       2e-14 
PHYKE_2454                                                            73.2       2e-14 
PHYRA_77292                                                           70.9       3e-14 
PHYCA_120062                                                          71.2       3e-14 
PITG_01966                                                            72.4       3e-14 
PHYCA_123316                                                          72.4       3e-14 
PYU1_G001524                                                          72.0       4e-14 
PYVX_22511                                                            72.0       4e-14 
PYVX_16138                                                            72.8       5e-14 
PYAP_24691                                                            68.9       5e-14 
PITG_20312                                                            71.2       6e-14 
PYIW_16810                                                            70.5       6e-14 
PYIR_22133                                                            72.0       8e-14 
PYVX_19277                                                            71.6       8e-14 
SDRG_00948                                                            71.6       8e-14 
PHALS_01293                                                           71.6       9e-14 
PHALS_05110                                                           69.7       9e-14 
PHYRA_86751                                                           68.6       1e-13 
PHYSO_488921                                                          70.9       1e-13 
PYIR_14463                                                            71.2       1e-13 
PITG_20631                                                            70.5       1e-13 
PYAP_22462                                                            69.3       1e-13 
PHYKE_6076                                                            70.5       1e-13 
PHYSO_329293                                                          70.9       1e-13 
PYAP_18584                                                            69.3       1e-13 
PYVX_24563                                                            70.1       1e-13 
PHYRA_93650                                                           69.7       2e-13 
PPTG_03140                                                            70.9       2e-13 
PHYSO_256017                                                          67.8       2e-13 
PHYSO_374025                                                          70.5       2e-13 
SPRG_07795                                                            70.5       2e-13 
PPTG_01148                                                            70.1       2e-13 
PYU1_G001528                                                          69.7       2e-13 
SPRG_07797                                                            70.1       2e-13 
PYU1_G001520                                                          70.5       2e-13 
PYAP_18226                                                            68.9       3e-13 
HYAP_01683                                                            70.1       3e-13 
PHYCA_112615                                                          68.2       3e-13 
PYAP_16994                                                            69.3       3e-13 
PYIW_25573                                                            69.3       3e-13 
PHYKE_10295                                                           69.7       3e-13 
PYVX_16673                                                            70.5       3e-13 
PYU1_G006405                                                          69.7       3e-13 
PYAP_23672                                                            68.9       4e-13 
PHALS_02041                                                           68.9       4e-13 
PYAR_18165                                                            68.9       4e-13 
PYIW_18065                                                            69.3       4e-13 
PHYKE_3912                                                            68.6       5e-13 
PPTG_04803                                                            68.6       5e-13 
PHYRA_77293                                                           68.9       5e-13 
PYAP_19707                                                            68.2       5e-13 
PYU1_G007250                                                          67.0       5e-13 
PHYCA_19608                                                           68.9       6e-13 
H310_05432                                                            68.6       7e-13 
PHYCA_103479                                                          68.9       7e-13 
SDRG_17448                                                            68.2       7e-13 
PYVX_20789                                                            68.6       7e-13 
PYIR_16375                                                            68.2       8e-13 
PYVX_22510                                                            68.9       9e-13 
H257_11264                                                            67.8       1e-12 
PHYCA_132255                                                          64.7       1e-12 
PYU1_G001527                                                          67.8       1e-12 
PYU1_G001523                                                          67.8       1e-12 
PHYSO_318693                                                          68.2       1e-12 
PYIR_25001                                                            66.2       2e-12 
PHYRA_78177                                                           67.8       2e-12 
PYAR_22058                                                            65.9       2e-12 
H257_11265                                                            67.0       3e-12 
PYU1_G001526                                                          67.0       3e-12 
PYIW_16208                                                            66.2       3e-12 
PYU1_G007242                                                          66.2       4e-12 
PHYCA_12944                                                           64.7       4e-12 
PYVX_22508                                                            66.6       4e-12 
PHYRA_78174                                                           66.2       4e-12 
H310_05433                                                            66.6       4e-12 
PYAP_20077                                                            65.9       4e-12 
PHYCA_562062                                                          65.5       5e-12 
PHYRA_78169                                                           66.6       5e-12 
PYIR_15187                                                            64.7       6e-12 
PYIR_23622                                                            65.5       6e-12 
PYAR_21940                                                            65.5       7e-12 
PYIW_18794                                                            65.1       7e-12 
PYAP_16337                                                            65.1       8e-12 
H257_11258                                                            65.9       8e-12 
PHYCA_10471                                                           65.5       9e-12 
PYAP_14265                                                            65.1       1e-11 
PYAP_16347                                                            63.5       1e-11 
PHYCA_15126                                                           65.1       2e-11 
PHYRA_80632                                                           65.1       2e-11 
PYU1_G005866                                                          63.5       2e-11 
PPTG_09880                                                            63.5       2e-11 
PHALS_10635                                                           64.7       2e-11 
PPTG_20376                                                            63.2       2e-11 
PPTG_03145                                                            64.7       2e-11 
PYU1_G005869                                                          64.3       2e-11 
PYIR_26867                                                            62.4       2e-11 
PHYKE_6069                                                            64.3       2e-11 
H257_11306                                                            64.7       2e-11 
PYU1_G006404                                                          63.9       2e-11 
PHYCA_18729                                                           64.7       2e-11 
PHYKE_6066                                                            64.3       2e-11 
PHYRA_78162                                                           64.7       2e-11 
PYVX_21643                                                            63.9       2e-11 
PYAP_19712                                                            63.9       3e-11 
PHYCA_14560                                                           64.3       3e-11 
PPTG_03161                                                            64.7       3e-11 
PYIR_23689                                                            63.2       3e-11 
PYIW_19601                                                            63.2       3e-11 
PHYCA_558591                                                          60.5       4e-11 
PYAP_23455                                                            63.9       4e-11 
PHYKE_2379                                                            63.5       4e-11 
PHYKE_10296                                                           64.3       4e-11 
PHYSO_257305                                                          62.4       4e-11 
PPTG_04801                                                            63.2       4e-11 
PHYSO_426658                                                          62.4       5e-11 
PHYSO_374518                                                          60.1       7e-11 
PPTG_03144                                                            63.2       7e-11 
PYU1_G001517                                                          62.8       7e-11 
PPTG_07511                                                            61.2       8e-11 
PYIR_20483                                                            62.8       8e-11 
PHYKE_7443                                                            62.8       9e-11 
PYAP_23673                                                            62.8       9e-11 
PYVX_21174                                                            58.9       9e-11 
PYU1_G001516                                                          62.8       9e-11 
PHYSO_375794                                                          59.7       9e-11 
PYAP_25026                                                            61.6       1e-10 
PHALS_02037                                                           62.8       1e-10 
PYIW_26657                                                            60.1       1e-10 
PHALS_08575                                                           62.4       1e-10 
PHYRA_77290                                                           62.4       1e-10 
PYAR_13902                                                            60.1       1e-10 
PPTG_01153                                                            62.0       1e-10 
PYIR_22634                                                            61.6       1e-10 
PYU1_G005867                                                          60.8       2e-10 
PYIW_15528                                                            62.0       2e-10 
PYVX_21438                                                            61.6       2e-10 
PHYSO_525490                                                          62.0       2e-10 
PYVX_23997                                                            60.1       2e-10 
PPTG_01147                                                            61.2       2e-10 
PYU1_G006403                                                          60.8       3e-10 
PHYCA_552912                                                          61.6       3e-10 
PHYSO_454780                                                          59.7       3e-10 
PYIR_20482                                                            59.3       3e-10 
PHYKE_7446                                                            61.2       3e-10 
PYIR_22136                                                            60.8       4e-10 
PYAR_17166                                                            57.8       4e-10 
PYIW_14247                                                            60.5       4e-10 
PHYRA_86201                                                           60.5       5e-10 
PHYCA_6388                                                            60.5       5e-10 
PPTG_18176                                                            60.1       6e-10 
PITG_11951                                                            58.5       7e-10 
PPTG_03148                                                            60.1       7e-10 
PITG_04404                                                            59.3       8e-10 
PYAP_18983                                                            58.2       1e-09 
PYVX_22512                                                            58.5       1e-09 
PYU1_G003057                                                          58.5       1e-09 
PPTG_06249                                                            58.9       2e-09 
PITG_11944                                                            58.9       2e-09 
PYAR_17163                                                            56.2       2e-09 
PYU1_G001475                                                          58.5       2e-09 
PYVX_24274                                                            58.2       2e-09 
PHYRA_78164                                                           58.9       2e-09 
PHYRA_95184                                                           59.3       2e-09 
PPTG_01152                                                            58.5       2e-09 
PYIW_23030                                                            58.2       2e-09 
PYIR_24867                                                            58.9       2e-09 
PHYSO_337515                                                          58.5       2e-09 
PHYSO_489485                                                          56.6       3e-09 
PHYCA_15124                                                           58.2       3e-09 
PHYRA_78167                                                           58.2       3e-09 
PITG_08892                                                            58.2       3e-09 
PYIR_26519                                                            57.8       3e-09 
PYAP_18982                                                            57.0       3e-09 
PYIR_24935                                                            57.8       3e-09 
PHYKE_9024                                                            58.2       3e-09 
PHYCA_538650                                                          58.2       4e-09 
PHALS_01460                                                           58.2       4e-09 
PPTG_06256                                                            58.2       4e-09 
PYAR_15784                                                            56.6       4e-09 
PYIR_17978                                                            57.4       4e-09 
PHYCA_15125                                                           57.8       5e-09 
PHYCA_14559                                                           57.4       5e-09 
PITG_08895                                                            56.6       6e-09 
PYU1_G005878                                                          53.1       8e-09 
PYAR_21271                                                            56.6       8e-09 
PYU1_G006672                                                          52.8       8e-09 
PHYSO_339832                                                          56.6       1e-08 
PYAR_14261                                                            55.1       1e-08 
PHYRA_80631                                                           56.6       1e-08 
PITG_11942                                                            56.2       1e-08 
PHYKE_9023                                                            56.2       1e-08 
PHYSO_341657                                                          56.2       1e-08 
PYU1_G001518                                                          56.2       1e-08 
PPTG_06253                                                            56.2       2e-08 
PITG_11957                                                            56.2       2e-08 
PHYSO_488139                                                          55.5       2e-08 
PYIW_26655                                                            55.5       2e-08 
H310_05438                                                            55.8       2e-08 
PYAR_24939                                                            54.3       2e-08 
PYIW_21963                                                            55.5       3e-08 
PHYRA_75781                                                           55.1       3e-08 
PYAR_15390                                                            54.3       3e-08 
PYVX_21644                                                            54.3       3e-08 
PHYRA_78165                                                           55.1       4e-08 
PPTG_13879                                                            55.1       4e-08 
PHYRA_77291                                                           54.7       4e-08 
PHALS_02295                                                           55.1       4e-08 
PHYCA_10470                                                           54.7       5e-08 
PYVX_22509                                                            54.7       6e-08 
PHYCA_97699                                                           54.3       6e-08 
PPTG_06106                                                            54.3       7e-08 
PYAP_24338                                                            54.3       7e-08 
PHYRA_79881                                                           53.9       9e-08 
PITG_01969                                                            53.5       1e-07 
PPTG_22744                                                            52.4       1e-07 
PYAR_23090                                                            52.0       1e-07 
PHALS_02296                                                           53.5       1e-07 
PHYRA_78168                                                           53.5       1e-07 
PYAP_16351                                                            53.1       1e-07 
PYIR_20304                                                            52.8       1e-07 
PHYKE_9025                                                            53.5       1e-07 
PHYCA_123476                                                          53.5       1e-07 

>PPTG_17122
Length=204

 Score = 351 bits (901),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA
Sbjct  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS
Sbjct  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPlsasarrlesaanesVALE  203
            GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANESVALE
Sbjct  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANESVALE  203

Query  204  V  204
            V
Sbjct  204  V  204

>PHYCA_129425
Length=204

 Score = 308 bits (790),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 167/180 (93%), Gaps = 0/180 (0%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQVVLLPAPTYTTDNKDTKYAPLAFLE+QG++TVEDFNGWRR+NGYKTLR FMD A
Sbjct  24   TADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            KYTVTDGADYYCGFTN  AAPQPIPDGTMRSTGYTHDGPCEVWLD+ RVLQSDNCHET  
Sbjct  84   KYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPlsasarrlesaanesVALE  203
            GKTYNLDYSSC G+C LRWYWLG R+LKN +SWQ+YKACIPLS+SARRLE AANES A+E
Sbjct  144  GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203

>PITG_18450
Length=203

 Score = 307 bits (787),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 149/161 (93%), Gaps = 3/161 (2%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T+ AHQVVLLP+PTYTTD+KDTKYAPL FLE QGYETVEDFNGWRRNNGYKTLRDFM+  
Sbjct  24   TATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
             YTV DGADYYCGFTNVNAAPQP PDG MRSTGYTHDGPCEVWLD+ RVLQSDNCHETI 
Sbjct  82   -YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GKTYNLDYSSC GTCTLRWYWLGVR+LKNAYSWQIYKACIP
Sbjct  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIP  181

>PHYSO_284086
Length=204

 Score = 300 bits (769),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 163/180 (91%), Gaps = 0/180 (0%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQVVLLPAPTYTTD+K TKYAPLAFLENQGYETVEDFN WRR+ GYKTLR FMD A
Sbjct  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
             YTV DGADYYCGFT++    QPIPDGTMRSTGYTHDGPCEVWLDT RVLQSDNCHET S
Sbjct  84   SYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPlsasarrlesaanesVALE  203
            GKTY+LDYSSC G+CTLRWYWLGVR+LKN YSWQ+YKAC+PLS SARRLE+AANES ALE
Sbjct  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESAALE  203

>PHYKE_8389
Length=204

 Score = 298 bits (764),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 1/181 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQVVLLPAPTYTTD+KDTKYAPLAFLENQG+ETV+DFN WRRNNGYKTLR FMD A
Sbjct  23   TADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVTDGADY+CGFTN +AAPQ IP G  MRSTGYTHDGPCEVWLDT RVL  DNCHE I
Sbjct  83   KYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  142

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPlsasarrlesaanesVAL  202
            SGK Y +DYSSCTGTCTLRWYWLGVR+LKN YSWQ+YKAC+PLSASARRL+ AANES A+
Sbjct  143  SGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAI  202

Query  203  E  203
            E
Sbjct  203  E  203

>PHYRA_81106
Length=202

 Score = 290 bits (742),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 144/161 (89%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQVVLLPAPTYTTD+KDTKYAPLAFLENQG+ETV DFN WRR+NGYKTLR FMD AK
Sbjct  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK  84

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTV DGADYYCGFTN +A PQ IPDG  MRSTGYTHDGPCEVWLDT RVL  DNCHE IS
Sbjct  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSCTGTCTL WYW+GVRYLKNAYSWQ+YKAC+P
Sbjct  145  GKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVP  185

>PHYRA_82864
Length=193

 Score = 268 bits (686),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 0/160 (0%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQVVLLP P +TTDNKDTKY PLAFLE QG+ T  DFN WRR+NGYKTLRDFMDRA
Sbjct  24   TADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            KYTVT+GADY+CG+T+ N  PQPIP G MRSTGYTHDGPCEVWLD  RVLQ DNCHE   
Sbjct  84   KYTVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFP  143

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
             K Y +DYSSC GTCTL WYW+GVR+LKN+YSWQ+YK CI
Sbjct  144  DKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECI  183

>PHYCA_14369
Length=248

 Score = 266 bits (681),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TT++KDTKY PLAFLENQG++T +DF  WR  NGYK+LRDFMDRA
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVT+GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD   VL  DNCHE  
Sbjct  84   KYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC GTCTLRWYWLGVR+LKNAYSWQ+YKACIP
Sbjct  144  PGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIP  185

>PPTG_17121
Length=202

 Score = 264 bits (674),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 134/161 (83%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            +NAHQVVLL APTYTTD+KDTKYAPLAFLE+QG+ T EDF  WR++NGY +LR F D A 
Sbjct  22   ANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS  81

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTV+DGAD  CGFTN+N   QPIPDG  MRSTGYTHDGPCEVWLD   V+Q DNCHE IS
Sbjct  82   YTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  141

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSCT TCTL W+WLGVRYLKN YSWQIYKAC+P
Sbjct  142  GKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVP  182

>PHYSO_341599
Length=185

 Score = 259 bits (663),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 134/162 (83%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TT++K+TKY PLAFLENQG++T EDF  WR+ NGYK+LRDFMDRA
Sbjct  7    TADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRA  66

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGT-MRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY VT GAD+ CGFT+    PQPIP+G  MRSTGYTHDGPCEVWLD   VL  DNCHE  
Sbjct  67   KYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  126

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC GTCTLRWYWLGVR+LKN YSWQ+YKACIP
Sbjct  127  PGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIP  168

>PHYKE_3446
Length=199

 Score = 259 bits (662),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ+VLLP P + TD+K+ KY PLAFLENQG+ T ED N WRR+NGYKTLR FMD AK
Sbjct  25   TDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAK  84

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y VT+GADY+CG+T+ N   QPIP+G  MRSTGYTHDGPCEVW+D  RVL+S NCHETI+
Sbjct  85   YQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETIT  144

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYS+C GTC LRWYWLGVR+LKN+YSWQ+YKACIP
Sbjct  145  GKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIP  185

>PPTG_15264
Length=194

 Score = 259 bits (661),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 3/164 (2%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            +++AHQ+VL P P +TTDNKD KY PLAFLE QG++T EDFN WRR+NGYKTLRDFMDRA
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVT+GADY+CG+T+    PQPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+I
Sbjct  81   KYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESI  140

Query  143  SGKTYNLDYSSC--TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC   G C LRWYWLGVR+LKN+YSWQ+YK CIP
Sbjct  141  PGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIP  184

>PPTG_17366
Length=194

 Score = 259 bits (661),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 3/164 (2%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            +++AHQ+VL P P +TTDNKD KY PLAFLE QG++T EDFN WRR+NGYKTLRDFMDRA
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVT+GADY+CG+T+    PQPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+I
Sbjct  81   KYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESI  140

Query  143  SGKTYNLDYSSC--TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC   G C LRWYWLGVR+LKN+YSWQ+YK CIP
Sbjct  141  PGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIP  184

>PHYKE_8388
Length=205

 Score = 259 bits (661),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            +NAHQVVLLP+PTYTTD+K TKYAPLAFLE+QG+ T EDF  WR +NGY +LR F D A 
Sbjct  25   ANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS  84

Query  85   YTVTDGADYYCGFTNVNAAPQPIPD-GTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTV+DGAD+ CGFT++N A QPIPD   MRSTGYTHDGPCEVWLD   V+Q +NCH++IS
Sbjct  85   YTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSIS  144

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSCT TCTL W+W+GVRYLKN YSWQ+YKAC+P
Sbjct  145  GKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVP  185

>PPTG_10635
Length=199

 Score = 258 bits (660),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ+VLLP P +TT++KDTKY PLAFLENQG++T EDF  WR  NGYK+LRDFMDRAK
Sbjct  8    ADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAK  67

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y VT GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD   VL  DNCHE   
Sbjct  68   YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFP  127

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSC G+CTLRWYWLGVR+LKN+YSWQ+YKACIP
Sbjct  128  GKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIP  168

>PHYSO_477820
Length=202

 Score = 258 bits (659),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 131/161 (81%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            + AHQVVLLPAPTYTTD+K TKYAPLAFLE+QG+ T EDF  WR +NGY +LR F D A 
Sbjct  22   AGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS  81

Query  85   YTVTDGADYYCGFTNVNAAPQPIPD-GTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTV DGAD+ CGFTN N   QPIPD   MRSTGYTHDGPCEVWLD   V+Q DNCHE+IS
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSCT TCTL W+WLGVRYLKN YSWQIYKAC+P
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVP  182

>PHYRA_81107
Length=202

 Score = 257 bits (657),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 132/161 (82%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQVVLLPAPTYTTD+K TKYAPLAFLE+QG+ T EDF  WR  NGY +LR F D A 
Sbjct  22   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGAS  81

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTV+DGAD+ CGFT++N   Q IPDG  MRSTGYTHDGPCEVWLD   V+Q DNCHE IS
Sbjct  82   YTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVIS  141

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSCT TCTL W+W+GVRYL NAYSWQ+YKAC+P
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVP  182

>PHYRA_85631
Length=228

 Score = 256 bits (654),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 129/162 (80%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQVVLLP P +TTD+KDTKY PLAFLEN+G+ T EDF  WR  NGYK+LRDFMD A
Sbjct  24   TADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY V DGAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD   VL  DNCHE  
Sbjct  84   KYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC GTCTLRWYWLG+R+LKN YSWQ+YK CIP
Sbjct  144  PGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIP  185

>PHYCA_511409
Length=204

 Score = 255 bits (651),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 132/161 (82%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQVVLLPAPTYTTD+K TKYAPLAFLE+QG+ T EDF  WR++NGY +LR F D A 
Sbjct  24   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGAS  83

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTV+DGAD+ CGFTN N   Q IPD   MRSTGYTHDGPCEVWLD   V+Q DNCHE IS
Sbjct  84   YTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  143

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSCT TCTL W+WLGVRYLKN YSWQIYKAC+P
Sbjct  144  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVP  184

>PHYCA_102852
Length=195

 Score = 254 bits (650),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 132/162 (81%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TT++KDTKY PLAFLEN+G+ T EDF  WR  NGYK+LRDFMDRA
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY VT+GAD+ CGFT+ N  PQPIP G  MRSTGYTHDGPCEVWLD   VL  +NCHE  
Sbjct  84   KYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC GTCTL W+WLGVR+LKN YSWQ+YKACIP
Sbjct  144  PGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIP  185

>PPTG_10643
Length=250

 Score = 255 bits (652),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TT++KDTKY PLAFLENQG++  EDF  W + NGYK+LRDFMDRA
Sbjct  24   TTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY VT GAD+ CGFTN    PQPIP  G MRSTGYTHDGPCEV+LD   VLQ DNCHE  
Sbjct  84   KYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK   +DYSSC GTCTLRWYWLG+R+LKNAYSWQ+YK CIP
Sbjct  144  PGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIP  185

>PHYRA_84190
Length=206

 Score = 253 bits (646),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 130/162 (80%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TTD+KDTKY PLAFLEN+G+ T EDF  WR  NGYK+LRDFMD A
Sbjct  7    TADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNA  66

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY+VT+GAD+ CGFT+    PQPIP D  MRSTGYTHDGPCEVWLD   VL  +NCHE  
Sbjct  67   KYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKF  126

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC GTCTLRWYW+GVR+LK  YSWQ+YK CIP
Sbjct  127  PGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIP  168

>PHYSO_536424
Length=197

 Score = 252 bits (644),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 129/158 (82%), Gaps = 1/158 (1%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTV  87
            HQ+VLLP P +TT++K+TKY PLAFLEN+G+ T EDF  WR+ NGYK+LRDFMDRAKY V
Sbjct  23   HQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYDV  82

Query  88   TDGADYYCGFTNVNAAPQPIPDGT-MRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T GAD+ CGFT+    PQPIP+G  MRSTGYTHDGPCEVWLD   VL  DNCHE   GK 
Sbjct  83   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  142

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            Y +DYSSC GTCTLRWYWLGVR+LKN YSWQ+YKACIP
Sbjct  143  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIP  180

>PHYSO_507031
Length=197

 Score = 252 bits (644),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 129/158 (82%), Gaps = 1/158 (1%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTV  87
            HQ+VLLP P +TT++K+TKY PLAFLEN+G+ T EDF  WR+ NGYK+LRDFMDRAKY V
Sbjct  23   HQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYDV  82

Query  88   TDGADYYCGFTNVNAAPQPIPDGT-MRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T GAD+ CGFT+    PQPIP+G  MRSTGYTHDGPCEVWLD   VL  DNCHE   GK 
Sbjct  83   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  142

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            Y +DYSSC GTCTLRWYWLGVR+LKN YSWQ+YKACIP
Sbjct  143  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIP  180

>PHYKE_7718
Length=220

 Score = 252 bits (644),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 131/161 (81%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ+VLLP PT+TTD+KDTKY PLAFLE +G+   EDF  WR  NGYK+LRDFMD AK
Sbjct  29   ADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK  88

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y+VT GAD  CGFT+ N  PQPIP+G  MRSTGYTHDGPCEVW+D    + +DNCHE   
Sbjct  89   YSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFP  148

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYS+C GTCTLRWYWLGVR+LKN+YSWQ+YKACIP
Sbjct  149  GKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIP  189

>PPTG_10634
Length=208

 Score = 251 bits (641),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 130/162 (80%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T +AHQ+VLLP P +TT++K+TKY PLAFLEN+G+ T EDF  WR+ NGYK+LRDF+D A
Sbjct  24   TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY VTDGAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD   VL  DNCHE  
Sbjct  84   KYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYSSC GTCTL WYWLGVR+LKN YSWQ+YKACIP
Sbjct  144  PGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIP  185

>PPTG_10636
Length=246

 Score = 252 bits (644),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ+VLLP P +TT++KDTKY PLAFLENQG++T EDF  WR  N YK+LRDFMD AK
Sbjct  25   ADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAK  84

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y VT GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD   VL  +NCHE   
Sbjct  85   YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFP  144

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYSSC GTCTLRWYWLG+R+LKN YSWQ+YKACIP
Sbjct  145  GKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIP  185

>PHYCA_102550
Length=268

 Score = 252 bits (643),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 131/162 (81%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T+ AHQVVLLPAP + TDN+DT++ PLAFLE+QG++T +DF  WR  NGYK+LRDFMDRA
Sbjct  24   TATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTV +GAD+ CG+T+ N  PQPIP G  MRSTGYTHDGPCEVW+D   V++ DNCHE  
Sbjct  84   KYTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYS C G CTL WYWLGVR+LKN+YSWQ+YK CIP
Sbjct  144  PGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIP  185

>PYVX_18176
Length=201

 Score = 246 bits (627),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 129/160 (81%), Gaps = 0/160 (0%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ V+LPAPT+ TD+KD  YAPLAFLE+QG+ T EDF  WR +NGY +LR FMD A 
Sbjct  22   ADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS  81

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISG  144
            YTVTDGAD  CG+TN +   Q +PDG MRSTGYTH GPCEVWLD   VLQ DNCH++ISG
Sbjct  82   YTVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISG  141

Query  145  KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            KTY+LDYSSCT TCTL W+W+GVRYL N YSWQ+YK C+P
Sbjct  142  KTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVP  181

>PYVX_18174
Length=204

 Score = 242 bits (617),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 2/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ V+LP PT+TT ++D  YAPLAFLE+QG+ETVEDFN WRR+NGYKTLR FMD+A 
Sbjct  25   ADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS  84

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISG  144
            YTVTDGAD  CGFT ++  PQPIP    RSTGYTHDGPCE+WLD+ RV  +DNCHE ISG
Sbjct  85   YTVTDGADQTCGFTEIDGTPQPIP-ANFRSTGYTHDGPCEIWLDSTRVYANDNCHEAISG  143

Query  145  KTYNLDYS-SCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            K   +DYS    GTCTL WYW+GVRYL NAYSWQ+YK C+P
Sbjct  144  KDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVP  184

>PHYCA_102624
Length=195

 Score = 241 bits (615),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T+ AHQVVLLP P + TDN+DT++ PL FLE  G++T  DF  WR+ NGYK+LRDFMD A
Sbjct  24   TATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY V++GAD+ CGFT+ N  PQPIP G  MRSTGYTHDGPCEVW+D   V++ DNCHE  
Sbjct  84   KYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GK Y +DYS C G CTL WYWLGVR+LKN YSWQ+YK CIP
Sbjct  144  PGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIP  185

>PPTG_10048
Length=190

 Score = 236 bits (602),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            + AHQVVL PAP + TDN+DT++ PLAFLE+QG++T EDF  WR  NGYKTLRDFM+ AK
Sbjct  22   TEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAK  81

Query  85   YTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            YTVT+GAD+ CG+TN    PQPIP  G MRSTGYTH+GPCE+W+   +V Q+DNCH ++ 
Sbjct  82   YTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLP  141

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYS C G C L WYWLGVR+LKN+YSWQ+YK CIP
Sbjct  142  GKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIP  182

>PYVX_18173
Length=500

 Score = 243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 1/159 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKY  85
            AHQ+V+LPAPTYT + KD ++ PLAFLE Q + T +DF G+   NG+ +LR FMD  + Y
Sbjct  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293

Query  86   TVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145
            +V   AD+ CGFT+ +AAPQPIPDG MRSTGYTHDGPCEVWLD  RVLQ DNCHE ISGK
Sbjct  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353

Query  146  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            TY+LDYS+C G+CTL WYWLGVRYLK  YSWQ+YKAC+P
Sbjct  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392

 Score = 141 bits (356),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 90/157 (57%), Gaps = 2/157 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKYTV  87
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLR  MD    Y+V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T+   + CG T  N   QPIP +G+  ++GYT DGPCE+W+D    L   NCH       
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            + +DYS C  +C + W+WLG++Y    YSWQ++K CI
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194

>PHALS_00498
Length=199

 Score = 229 bits (583),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 120/159 (75%), Gaps = 1/159 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYT  86
            AHQ+VLLP P + T++KDT+Y PLAFLENQ ++T  D   + + N +KTLRDFMD AKYT
Sbjct  27   AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAKYT  86

Query  87   VTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145
            V  GAD  CGFT+ N  PQPIP +  MRSTGYTHDGPCEVWL+  RVL + NCHE   GK
Sbjct  87   VVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGK  146

Query  146  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             Y +DYSSC   C LRWYWLGVR+LK  YSWQ+YKACIP
Sbjct  147  DYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIP  185

>PYU1_G001741
Length=199

 Score = 225 bits (574),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 125/162 (77%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ V+LPAPT+T   +  ++ PLAFLENQG+ET  DFN + +  GYKTLR FMD  
Sbjct  23   TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDK  82

Query  84   K-YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            K YTV  GAD+ CG+T ++   Q IP GT+RSTGYTHDGPCEVWLD+ RV++ +NCH   
Sbjct  83   KAYTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEF  142

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +G T+ +DYSSC G+CTLRWYW+G+R+LK  YSWQ+YK C+P
Sbjct  143  TGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVP  184

>PYU1_G001742
Length=213

 Score = 223 bits (567),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 124/162 (77%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            +++AHQ V+LPAPT+T   +  ++ PLAFLENQGY+T  DFN + +  GYKTLR FMD  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDP  83

Query  84   K-YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            K Y V  GAD+ CG+T ++   QPIP GT+RSTGYTHDGPCEVWLD+ RV++ +NCH   
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             G T+ +DYSSC G+CTLRWYW+G+R+LK  YSWQ+YK C+P
Sbjct  144  PGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVP  185

>PYIR_25089
Length=262

 Score = 220 bits (561),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAK  84
            +AHQ V+LPAPT+T   +  ++ PLAFLENQG++T  DF+ + +  GYKTLR FMD ++ 
Sbjct  26   DAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSA  85

Query  85   YTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y V DGAD+ CG+T +   PQPIP   T+RSTGYTHDGPCEVWLD  RVL+  NCH    
Sbjct  86   YKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFP  145

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            G T+ +DYSSC G+C LRWYW+G+R+LK  YSWQ+YK C+P
Sbjct  146  GTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVP  186

>PYIR_26626
Length=212

 Score = 218 bits (555),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 125/161 (78%), Gaps = 2/161 (1%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  85
            +AHQ V+LPAPT+T  +K+  + PLAFLENQGY+T  DFNG+ ++ GYKTLR FMD  K 
Sbjct  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85

Query  86   TVTD--GADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
               D  GA++ CG+TN+N   QPIP GT+RSTGYTHDGPCEVWLD  +V+   NC++   
Sbjct  86   YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GKT+++ Y+SC G+CTLRWYW+G+R+LKN +SWQ+YK C+P
Sbjct  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVP  186

>PHYSO_499978
Length=174

 Score = 216 bits (551),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 114/142 (80%), Gaps = 1/142 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VL P P +TT++K+TKY PLAFLENQG+ T +DF  WR  NGYKTLRDFMD  
Sbjct  24   TADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHG  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVT GAD+ CG+T+    PQPIPDG  MRSTGYTHDGPCEVW+D  RVLQ DNCHE I
Sbjct  84   KYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKI  143

Query  143  SGKTYNLDYSSCTGTCTLRWYW  164
            + K Y +DYS+C GTCTLRWYW
Sbjct  144  ADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 216 bits (551),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 114/142 (80%), Gaps = 1/142 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VL P P +TT++K+TKY PLAFLENQG+ T +DF  WR  NGYKTLRDFMD  
Sbjct  24   TADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHG  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVT GAD+ CG+T+    PQPIPDG  MRSTGYTHDGPCEVW+D  RVLQ DNCHE I
Sbjct  84   KYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKI  143

Query  143  SGKTYNLDYSSCTGTCTLRWYW  164
            + K Y +DYS+C GTCTLRWYW
Sbjct  144  ADKGYTIDYSACKGTCTLRWYW  165

>PYU1_G001744
Length=213

 Score = 214 bits (546),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 121/162 (75%), Gaps = 1/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            +++AHQ V+LPAPT+T   +  ++ PLAFLENQG++T  DFN + +  GYK+LR FMD  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDK  83

Query  84   K-YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            K Y V  GAD+ CG+T ++   QPIP GT+RSTGYTHDGPCEVWLD   V++ +NCH   
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEF  143

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             G T+ + Y+SC G+CTLRWYW+G+R+LK  YSWQ+YK C+P
Sbjct  144  PGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVP  185

>PYU1_G001740
Length=206

 Score = 212 bits (540),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 2/162 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
             ++AHQ+V+LP PT+T   KD +++PLAFLENQGY+T  DFN + ++ GYK+LR FMD  
Sbjct  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83

Query  84   K-YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            K Y V   AD+ CG+TN N A QPIP    R+TGYTHDGPCEVWLD  +VL   NCH+  
Sbjct  84   KAYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDF  142

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             GKT+ + Y++C G+CTLRWYW+G+R+LK  +SWQ+YK C+P
Sbjct  143  PGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184

>PHALS_03284
Length=188

 Score = 210 bits (535),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 114/159 (72%), Gaps = 1/159 (1%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYT  86
            AHQ++LLP P + T++KDTKY PLAFLENQ + T  DF G+ + N Y +LRDF+ RA YT
Sbjct  13   AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRANYT  72

Query  87   VTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145
            VT+GAD  CGFT+ N  PQPIP G  MR TGYTHDG CE+WLD  +VL   NCH    GK
Sbjct  73   VTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGK  132

Query  146  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               +DYSSC   C + WYWL VR LKN YSWQ+YKACIP
Sbjct  133  DCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIP  171

>PPTG_08820
Length=250

 Score = 210 bits (534),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 126/168 (75%), Gaps = 7/168 (4%)

Query  24   TSNAHQVVLLPAPTYT--TDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD  81
            T +AHQ++L P P +    +++DT++ PLAFLE+QG+    DFNGWR  +GYK LRDFMD
Sbjct  24   TVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  83

Query  82   RAKYT--VTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNC  138
            RAKYT  VT GAD  CG T +   P+PIP DG M+STGYTHDGPC V+LD + VL+ DNC
Sbjct  84   RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNC  143

Query  139  HETISGKTYNLDYSSC--TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            HE + GK+Y +DYSSC   G CTL W+WLG+R++K+ +SWQ+YK C+P
Sbjct  144  HEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVP  191

>PITG_13520
Length=171

 Score = 201 bits (512),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 1/132 (1%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TT +KDTKY PLAFLENQG++T +DF  WR  NGYK+LRDFMDRA
Sbjct  24   TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY VT GAD+ CGFT+    PQPIP  G MRSTGYTHDGPCEVWLD K VL  DNCHE  
Sbjct  84   KYDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKF  143

Query  143  SGKTYNLDYSSC  154
             GK Y +DYSSC
Sbjct  144  PGKDYTVDYSSC  155

>PPTG_14254
Length=188

 Score = 202 bits (513),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 121/166 (73%), Gaps = 6/166 (4%)

Query  25   SNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + AHQVV +PAPT+T  N  +K     + PL+FLE +G++T E+F  ++ +NGYK+LRDF
Sbjct  20   TEAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDF  79

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNC  138
            MDRAKY VT+GAD  CG+T+    PQ IP DGTMR+TGYTHDGPCE+++  K  L   NC
Sbjct  80   MDRAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNC  139

Query  139  HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            HE+I  +T+ LDYS C  +C L WYWLGVR LK  YSWQ+YK CIP
Sbjct  140  HESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIP  185

>PHYCA_510817
Length=188

 Score = 201 bits (510),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 122/167 (73%), Gaps = 6/167 (4%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRD  78
            ++ AHQVV +P+PT+T  N  +K     + PL+FLE +G++T E+F  ++ +NGYK+LRD
Sbjct  19   STEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  78

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDN  137
            FM++AKY V+DGAD  CG+++    PQ IP DGTMR++GYTHDGPCE+W+  K  L   N
Sbjct  79   FMEKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLN  138

Query  138  CHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            CHE+I  +T+ LDYS C  +C L WYWLGVR LK  YSWQ+YK CIP
Sbjct  139  CHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIP  185

>PHYSO_343376
Length=172

 Score = 200 bits (508),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 104/131 (79%), Gaps = 1/131 (1%)

Query  35   APTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYY  94
            A  +TT++K+TKY PLAFLENQG+ T +DF  WR  NGYKTLRDFMD  KYTVT GAD+ 
Sbjct  33   AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFS  92

Query  95   CGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSS  153
            CG+T+    PQPIPDG  MRSTGYTHDGPCEVW+D  RVLQ DNCHE I+ K Y +DYS+
Sbjct  93   CGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSA  152

Query  154  CTGTCTLRWYW  164
            C GTCTLRWYW
Sbjct  153  CKGTCTLRWYW  163

>PPTG_14255
Length=268

 Score = 201 bits (512),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 121/166 (73%), Gaps = 6/166 (4%)

Query  25   SNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + AHQVV +P+PT+T  N  +      + PL+FLE +GY T E+F  ++ +NGYK+LRDF
Sbjct  19   TQAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDF  78

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNC  138
            MD AKY+VTDGAD  CG+T+    PQ IP DGTMR++GYTHDGPCE+++     L   NC
Sbjct  79   MDNAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNC  138

Query  139  HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            HE+I+ +T+ LDYS+C  +C L WYWLGVRYLK  YSWQ+YK CIP
Sbjct  139  HESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIP  184

>PYU1_G001739
Length=266

 Score = 201 bits (510),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 111/160 (69%), Gaps = 2/160 (1%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK-  84
            +AHQ+++ P P +  D KD ++ PLAFLENQG  T  D  G+ +  GY  LR  MD  K 
Sbjct  22   DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKL  81

Query  85   YTVTDGADYYCGFTNVNAAPQPIPD-GTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y V   A + CG+T+     QPIP  GT+RSTGYTHDGPCEVWLD  +V+  DNCH+   
Sbjct  82   YEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFP  141

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            GKT+ LDYSSC G+CTLRWYWLGVRYLK  YSWQIYK C+
Sbjct  142  GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECV  181

>PHYSO_417649
Length=185

 Score = 196 bits (497),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 120/165 (73%), Gaps = 6/165 (4%)

Query  26   NAHQVVLLPAPTYTTDN-----KDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFM  80
             AHQVV +P+PT+T  N     +   + PL+FLE +G++T E+F  ++ +NGYK+LRDFM
Sbjct  19   EAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFM  78

Query  81   DRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCH  139
            +RAKY +TDGAD  CG+T+    PQ IP DGTMR++GYTHDGPCE+++  K  L   NCH
Sbjct  79   ERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  138

Query  140  ETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            E+I+ +T+ LDYS C  +C L WYWLGVR LK  +SWQ+YK CIP
Sbjct  139  ESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIP  183

>PHYKE_9185
Length=281

 Score = 198 bits (504),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 122/167 (73%), Gaps = 6/167 (4%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRD  78
            T+ AHQVV +P+PT+T  N  +K     + PL+FLE +G +T E+F  ++ +N Y +LRD
Sbjct  21   TTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRD  80

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDN  137
            FMD+AKY V+DGAD  CG+T+    PQ IP DGTMR++GYTHDGPCE+++  K  L   N
Sbjct  81   FMDKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  140

Query  138  CHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            CHE+I+ +T+ LDYS+C  +C L WYWLGVR LK +YSWQIYK CIP
Sbjct  141  CHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIP  187

>PITG_10499
Length=323

 Score = 199 bits (507),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 119/157 (76%), Gaps = 7/157 (4%)

Query  34   PAPTYT--TDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY--TVTD  89
            P P +    +++DT++ PLAFLE+QG+   EDFNGWR  NGYK LRDFMDRAKY  +VT 
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  90   GADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYN  148
            GAD  CG T +   P+PIP DG MRSTGYTHDGPC ++LD + V++ DNCHE+I G+TY 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  149  LDYSSC--TGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            +D+SSC   G CTL W+WLG+R++K+ +SWQ+YK CI
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECI  160

>PHYSO_254168
Length=170

 Score = 194 bits (493),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 109/146 (75%), Gaps = 16/146 (11%)

Query  41   DNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNV  100
            ++KDTKY PLAFLE QG+ T E F+  RR+NGYKTLRDFMDR KYTVT GADY+CG+TN 
Sbjct  29   EDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTNP  88

Query  101  NAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSC--TGTC  158
               PQPIP    RSTGYTHDGPCE+WLD  RVL+          ++  +DYSSC   G C
Sbjct  89   KGTPQPIP----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGGC  134

Query  159  TLRWYWLGVRYLKNAYSWQIYKACIP  184
            T+ WYWLGVR+LKN+YSWQ+YK CIP
Sbjct  135  TMHWYWLGVRFLKNSYSWQVYKECIP  160

>PHYCA_536934
Length=983

 Score = 205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 120/166 (72%), Gaps = 6/166 (4%)

Query  25   SNAHQVVLLPAPTYTTDN-----KDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + AHQVV +P+PT+T  N     +   + PL+FLE +GY T E+F  ++ +NGYK LRDF
Sbjct  36   TEAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDF  95

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNC  138
            MD AKY VTDGAD  CG+++ N  PQ IP DGTMR++GYTHDGPCE+W+  K  L   NC
Sbjct  96   MDNAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNC  155

Query  139  HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            HE+I+ +T+ LDYS C  +C L WYWLGVRYLK  YSWQ+YK CIP
Sbjct  156  HESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIP  201

>PYAR_24096
Length=227

 Score = 186 bits (473),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 109/163 (67%), Gaps = 4/163 (2%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AK  84
             AHQ V LP   YT  N++T + P A LE QGY+T  DFN + + N YKTLR+FMD+   
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  85   YTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y    GA + CGFT+  A  QPIP DG  R++GYTH+GPCE+W+D  RV   DNCH  IS
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  144  GKTY--NLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               +   +DYS+C GTC L+WYWLG+R    +YSWQIYKACIP
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIP  187

>PYAP_22278
Length=289

 Score = 187 bits (474),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 8/167 (5%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAK  84
            +AHQ V +PAPT+T ++++  + PLAFLENQG +  +D  G+ R+ G KTLRD+MD +A 
Sbjct  23   DAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKAN  82

Query  85   YTV-TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQS--DNCHE  140
            Y +   GA + CG+TN N A QPIP +G MRSTGYTHDGPCEVWLD  RVL S   NCH 
Sbjct  83   YKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHR  142

Query  141  TISGK--TYNLDYSSCTGTCTLRWYWLGVRYL-KNAYSWQIYKACIP  184
             +  K  +Y +D+S C G C LRWYWLG R +    +SWQIYKAC+P
Sbjct  143  DVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVP  189

>PYAP_22273
Length=268

 Score = 186 bits (471),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 108/162 (67%), Gaps = 4/162 (2%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKY  85
            AHQ V  P   YT  ++ T + P A LENQGY+T +DFN +   NGYKTLRDFMD+   Y
Sbjct  25   AHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAY  84

Query  86   TVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISG  144
                GA   CG+T+ NA PQPIP +G  R++GYTH+GPCE+W+D   V    NCH  IS 
Sbjct  85   KANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISE  144

Query  145  KTY--NLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            K +   +DYS+C G C L+WYWLG+R +   YSWQIYKACIP
Sbjct  145  KAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIP  186

>PHYSO_262732
Length=188

 Score = 180 bits (456),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 111/166 (67%), Gaps = 20/166 (12%)

Query  25   SNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + AHQVV +P+PT+T  N         + PLAFLENQG++T               LRDF
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDF  64

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNC  138
            MD AKYTVT+GAD  CG+T+     Q IP DGTMR++GYTHDGPCE+++  K  L   NC
Sbjct  65   MDNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNC  124

Query  139  HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            HE+I+ +T+ LDYS C  +CTL WYWLGVR+L N YSWQ+YK CIP
Sbjct  125  HESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIP  170

>PYAP_22279
Length=223

 Score = 180 bits (457),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 112/164 (68%), Gaps = 8/164 (5%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYT  86
            HQ + +PAPT TTD ++T   PLAFLENQG +  +D  G+ R  G KTLRDFMD +A Y 
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  87   V-TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVL--QSDNCHETI  142
            V   GA + CG+T+ N A QPIP +G MRSTGYTHDGPCEVWLD  RVL   S +CH+ I
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  143  SGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
                 +Y +D+S C G C LRWYWL  R + + +SWQ+YK C+P
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVP  184

>PHYSO_341596
Length=231

 Score = 180 bits (456),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 95/125 (76%), Gaps = 9/125 (7%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLL        +KDTKY PLAFLENQG+ET EDF  WR  NGYK+LRDFMD+A
Sbjct  24   TADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDKA  75

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDG-TMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KYTVT GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD  +VL+ DNCHE  
Sbjct  76   KYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKF  135

Query  143  SGKTY  147
             GK Y
Sbjct  136  PGKDY  140

>PYIW_18791
Length=194

 Score = 178 bits (451),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 112/162 (69%), Gaps = 4/162 (2%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK  84
            ++AHQ V +P P +T   K T +APL+FLE  G +T E  +G+ ++ GY TLR  MD +K
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  85   -YTVTDGAD-YYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHET  141
             Y     AD + CG+T+ +   Q IP D TMR+TGYTH GPCEVW+D +RV+  DNCHE 
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  142  ISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            +S  T  +DYS+C G CT+RWYWLG+RYLK  +SWQ+YK CI
Sbjct  139  VSNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCI  179

>PHYCA_14368
Length=219

 Score = 174 bits (440),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 100/161 (62%), Gaps = 44/161 (27%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T+ AHQ+VLLP P +TT++KDTKY PLAFLENQG++T +DF  WR  N YK+LRDFMD A
Sbjct  24   TAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNA  83

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            KYTVTDGAD+ CGFT+                                            
Sbjct  84   KYTVTDGADFSCGFTDP-------------------------------------------  100

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             K Y +DYSSC GTCTLRWYWLG+R+LKN YSWQ+YKACIP
Sbjct  101  -KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIP  140

>PYIR_26546
Length=239

 Score = 174 bits (440),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 113/166 (68%), Gaps = 5/166 (3%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQ-GYETVEDFNGWRRNNGYKTLRDFMDR  82
            T+ AHQ+V+LP PT+T + K  ++ P+A+LE Q G+    DFNG+  + G+KT+R+FMD 
Sbjct  24   TARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDN  83

Query  83   AK-YTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCH-  139
             K Y     AD+ CG+T ++  PQPIP +  +R+TGYTH+GPCE+WLD  +V    NCH 
Sbjct  84   DKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHY  143

Query  140  ETISGKTYN-LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +  SG  +  LD+SSC G CT+ WYW+G+R    + SWQIYK CIP
Sbjct  144  DVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIP  189

>PHYSO_527908
Length=174

 Score = 167 bits (423),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 6/152 (4%)

Query  26   NAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFM  80
            +AHQVV +P PT+T  N  +      + PLAFLE QG+ T  +F  +  +NGYK+LRDFM
Sbjct  20   DAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFM  79

Query  81   DRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCH  139
            D   Y+VT GAD  CG+T+ N  PQ IP DGTMR++G+THD PCE+++  K  L   NCH
Sbjct  80   DNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCH  139

Query  140  ETISGKTYNLDYSSCTGTCTLRWYWLGVRYLK  171
            E+I+ + + LDYS+C  +C L WYWLGVR++K
Sbjct  140  ESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PHYSO_246676
Length=187

 Score = 159 bits (401),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 100/162 (62%), Gaps = 39/162 (24%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            T++AHQ+VLLP P +TT++K TKY PLAFLENQG++T EDF  WR+ NGY+TLRDFMD+A
Sbjct  7    TADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDKA  66

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGT-MRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142
            KY VT GAD+ CGFT+    PQPIP+G  MRSTGYTHDG                     
Sbjct  67   KYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG---------------------  105

Query  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
                             L    L +  +KN+YSW++YKACIP
Sbjct  106  -----------------LVHASLVLDGMKNSYSWKVYKACIP  130

>PHYRA_81105
Length=201

 Score = 149 bits (375),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 2/157 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW + +GY +LR  +D  + Y V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T+ A + CG T+     Q IP + + +S+GYT DGPCEVWLD  +     NCH       
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            + +DYS+C   C LRWYWLG++Y++ AYSWQ+YK CI
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCI  193

>PPTG_17123
Length=201

 Score = 147 bits (371),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 2/157 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87
            QVVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR  +D  + Y V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T+ A + CG T+     QPIP + + +++GYT DGPCEVWLD  +V    NCH       
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            + +DYSSC   CTL WYWLG++Y++  YSWQ+YK C+
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCV  193

>PYU1_G001738
Length=226

 Score = 147 bits (370),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 92/160 (58%), Gaps = 2/160 (1%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK-  84
            +A   VL P P Y  D  + + AP+A LE QG +T  D + + +  GY  LR  +D  K 
Sbjct  20   HAQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKL  79

Query  85   YTVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            Y V   A   CG+T+     QPIP      STGY  +GPCEVWLD  +V+   NCH    
Sbjct  80   YNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYP  139

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            G  + LDYSSC G+C LRWYWLG++ +   YSWQ+YK C+
Sbjct  140  GTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCV  179

>PHYSO_340369
Length=200

 Score = 145 bits (365),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 97/166 (58%), Gaps = 20/166 (12%)

Query  25   SNAHQVVLLPAPTYT-----TDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + A+QVV +PAPT+T     TD +   + PLA+ E+QG+ T  +F  W+  NG+KTLRDF
Sbjct  22   TRANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDF  81

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIPD-GTMRSTGYTHDGPCEVWLDTKRVLQSDNC  138
            MD   Y+VT              +PQ IPD   MR+ GYT DGPCE+WLD      S +C
Sbjct  82   MDNGNYSVT--------------SPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDC  127

Query  139  HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              ++   TY LDYS C  +C + WY LGV      YSW++YK CIP
Sbjct  128  LVSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIP  173

>PHYCA_537323
Length=200

 Score = 144 bits (363),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 94/157 (60%), Gaps = 2/157 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87
            QVV  P P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  +D  + Y V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T+ A + CG T+     QPIP + + +++GYT DGPCEVWLD  +V    NCH       
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            + +DYSSC  +CTL WYWLG++Y++  YSWQ+YK C+
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  192

>HYAP_07096
Length=251

 Score = 144 bits (364),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 100/158 (63%), Gaps = 3/158 (2%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87
            QVVL P+P +  D+   +   LA+L+ QG +T  +   W++ +GY +LR  +D ++ Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  88   TDGADYYCGFTNVNAAP-QPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145
            +  A + CGFT++ +   Q IP +GT+ S+GYT DGPCEVW D  +V    NC       
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  146  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
             + +DYSSC  +CTLRWYWLG++Y+   YSWQ+YK CI
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243

>PITG_18452
Length=856

 Score = 150 bits (379),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 66/157 (42%), Positives = 95/157 (61%), Gaps = 2/157 (1%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W +  GY +LR  +D  + Y V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146
            T+ A + CG T+     QPIP + + +++GYT DGPCE+WLD  +V    NCH       
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            + +DYSSC G+C L WYWLG++Y++  YSWQ+YK C+
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848

>PHYSO_353401
Length=146

 Score = 133 bits (335),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 87/136 (64%), Gaps = 2/136 (1%)

Query  50   LAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIP  108
            LA+L+ QG  T  +   W + +GY +LR  +D  + Y VT+ A + CG T+     QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  109  -DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGV  167
             + + +++GYT DGPCEVWLD  +V    NCH       + +DYS+C  +CTL WYWLG+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  168  RYLKNAYSWQIYKACI  183
            +Y++ AYSWQ+YK C+
Sbjct  123  KYVEGAYSWQVYKNCV  138

>PYIW_18788
Length=244

 Score = 127 bits (318),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 90/160 (56%), Gaps = 3/160 (2%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKY  85
            A+  V  P P +  D      A +A LE+Q   T  D  G+ +  GY +LR  +D    Y
Sbjct  26   ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  85

Query  86   TVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISG  144
             V   + + CG+T+     QPIP +G +R TGY  DGPCE+W+D  ++L S NC +   G
Sbjct  86   DVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145

Query  145  KTYNLDYSSCTGTCTLRWYWLGV-RYLKNAYSWQIYKACI  183
             +  LDYSSC G CTLRWY L V +    +YSW++YK C+
Sbjct  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCV  185

>PYAP_18131
Length=226

 Score = 115 bits (287),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 8/110 (7%)

Query  81   DRAKYTV-TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSD--  136
            D+A Y V   GA + CG T+ N   QPIP +G MRSTG+THDG   VW+D  RVL S   
Sbjct  3    DKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSKLG  60

Query  137  NCHETISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            NCH++I     +Y +D+S C G C +RWYWLG+R L   +SWQ+YKACIP
Sbjct  61   NCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIP  110

>PYVX_18179
Length=147

 Score = 112 bits (280),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 80/161 (50%), Gaps = 58/161 (36%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
             ++AHQ V+LP PT+T+++ D  Y+PLAFLE+QG+ T EDFN WR  N            
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSAN------------  71

Query  84   KYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
                                            GY          DT R        + +S
Sbjct  72   --------------------------------GY----------DTLRAFMD----QAVS  85

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK   +DYSSC+G+CTL W+W+GVRYLK AYSWQ+YK C+P
Sbjct  86   GKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVP  126

>PHYRA_78625
Length=434

 Score = 117 bits (293),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 86/164 (52%), Gaps = 49/164 (30%)

Query  25   SNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + AHQVV +P+PT+T  N  +      + PL+FLE +G+ET E+F  ++ +NGY +LRDF
Sbjct  238  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  297

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCH  139
            +D+AKY                                            K  L   NCH
Sbjct  298  LDKAKY--------------------------------------------KLALSYLNCH  313

Query  140  ETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            E+I+ +T+ LDYS C  +C L WYWLG RYLK +YSWQ+YK CI
Sbjct  314  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  357

>PYIW_18792
Length=125

 Score = 110 bits (274),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 1/101 (1%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  85
            +AHQ V LPAPT+T   +  ++ PLAFLE QGY+   DF  + ++ GYK LR FMD  K 
Sbjct  22   DAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKA  81

Query  86   TVTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEV  125
               DG ++ CG++++   PQPIP  G +RSTGYTHDGP  +
Sbjct  82   YKVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PHYRA_78626
Length=473

 Score = 117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 86/164 (52%), Gaps = 49/164 (30%)

Query  25   SNAHQVVLLPAPTYTTDNKDTK-----YAPLAFLENQGYETVEDFNGWRRNNGYKTLRDF  79
            + AHQVV +P+PT+T  N  +      + PL+FLE +G+ET E+F  ++ +NGY +LRDF
Sbjct  277  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  336

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCH  139
            +D+AKY                                            K  L   NCH
Sbjct  337  LDKAKY--------------------------------------------KLALSYLNCH  352

Query  140  ETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            E+I+ +T+ LDYS C  +C L WYWLG RYLK +YSWQ+YK CI
Sbjct  353  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  396

>PYIR_16443
Length=275

 Score = 104 bits (259),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 91/167 (54%), Gaps = 23/167 (14%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----NQGYETVEDFNGWRRNNGYKTLRDFM  80
            NAH  + +P   +    K TKY     +E        ++  ++F    +  G++TLR ++
Sbjct  24   NAHGFIEVPKSEFV---KGTKYPSEWIVEFPPPWEGNWKDPKNFATVSKQKGFETLRSYI  80

Query  81   DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR--STGYTHDGPCEVWLDTKRVLQSDNC  138
            +        GA   CG TN NA+P+ IP  ++   S    H GPCE+WLD KRV+Q DNC
Sbjct  81   E------DKGA--LCGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQDDNC  132

Query  139  HETISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY-KAC  182
              T   K  T+ +D+SSC G+C LRW+WLG++   +   WQ+Y K+C
Sbjct  133  EGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PYIR_16435
Length=304

 Score = 104 bits (260),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 77/126 (61%), Gaps = 14/126 (11%)

Query  63   DFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHD  120
            +F    +  GY TLR +++  K T+       CG TN +A P+ IP D T++ S    H 
Sbjct  66   NFATVSKEKGYSTLRSYIED-KGTL-------CGRTNPDATPKAIPSDNTVKFSRAIVHP  117

Query  121  GPCEVWLDTKRVLQSDNCHETISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQI  178
            GPCE+WLD KRV+Q DNC  T   K  T+ +D+SSC G+C LRW+WLG++   +   WQ+
Sbjct  118  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQV  175

Query  179  YKACIP  184
            YK C+P
Sbjct  176  YKNCVP  181

>PHYSO_342364
Length=194

 Score = 101 bits (252),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 78/136 (57%), Gaps = 15/136 (11%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDG--TMRSTG  116
            ++V+ FN  + ++ YK LR  +D    T   G +  CG+TN N  PQPIP     + S G
Sbjct  61   KSVQVFNSLKTSHNYKDLRTLLDN---TAVYGPN--CGYTNPNGTPQPIPTNGKAIFSRG  115

Query  117  YTHDGPCEVWLDTKRVLQSDNC-----HETISGKT-YNLDYSSC--TGTCTLRWYWLGVR  168
              H GPCE+WLD K+V+ +D+C     H  ++ KT + +DYS C   G C +R+YWLG +
Sbjct  116  LIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQ  175

Query  169  YLKNAYSWQIYKACIP  184
             L     WQ YK CIP
Sbjct  176  ALGKKTVWQTYKNCIP  191

>PHYKE_8104
Length=86

 Score = 97.4 bits (241),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)

Query  24  TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
           T++AHQ+VLLP PT+TT++KDTKY PLAFLE +G+   EDF  WR  NGYK+LRDFMD A
Sbjct  24  TADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDNA  83

Query  84  KY  85
           KY
Sbjct  84  KY  85

>PYIR_16444
Length=182

 Score = 100 bits (248),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 85/165 (52%), Gaps = 16/165 (10%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLE--NQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            +AH  V +P   +     +     + F    +  ++  ++F    +  G+ TLR +++  
Sbjct  24   DAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPKNFAKVAKQKGFPTLRSYIE--  81

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDTKRVLQSDNCHET  141
                  GA   CG TN  A P+PIP DG +  S    H GPCE+WLD KRV Q+DNC   
Sbjct  82   ----NKGA--ICGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELWLDNKRVYQNDNCEGV  135

Query  142  ISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               K   + +D+SSC G C LR++WLG++       WQ+YK C+P
Sbjct  136  FGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVP  178

>PYU1_G007476
Length=195

 Score = 99.8 bits (247),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 70/131 (53%), Gaps = 17/131 (13%)

Query  61   VEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTM----RST  115
            + DF    +  GYKTLR F++        GA   CG+T  N  P+ IP DG +     + 
Sbjct  63   MNDFARISKQKGYKTLRSFLE------NKGAS--CGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  116  GYTHDGPCEVWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNA  173
            G+ H GPCE+WLD K +L  DNC +   G      +D+SSC GTC LR YWLG  +    
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  174  YSWQIYKACIP  184
              WQ YK C+P
Sbjct  173  QRWQTYKYCVP  183

>PITG_19818
Length=147

 Score = 95.5 bits (236),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)

Query  24  TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
           T++AHQ+VLLP P +TT +KDTKY PLAFLENQG++  +DF  WR  NGYK+LRDFMDRA
Sbjct  22  TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81

>PYVX_18175
Length=147

 Score = 94.4 bits (233),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 52/65 (80%), Gaps = 0/65 (0%)

Query  24  TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            ++AHQ V+LP P++TT ++D  Y+PLAFLENQG++T EDF+ WRR NGYKTLR FMD  
Sbjct  24  VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83

Query  84  KYTVT  88
           KYT T
Sbjct  84  KYTDT  88

>PHYRA_73582
Length=326

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 90/177 (51%), Gaps = 25/177 (14%)

Query  26   NAHQVVLLPAPTYTTDNKD---TKYAPL---AFLENQGYETV-EDFNGWRRNNGYKTLRD  78
             AH  +  PAPT+  +  +    + APL    + E++G + +   F      N YK L+ 
Sbjct  22   QAHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKT  81

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDTKRVLQSD  136
             MD  ++    G D  CGFT+ N  P   P DGT   S G  H GPCE+WLD K VLQ+D
Sbjct  82   LMDGPEF----GED--CGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQND  135

Query  137  NC--------HETISGKTYNLDYSSC-TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +C         ETIS     +DYS C  G C LR+YWL ++ L     WQ YK CIP
Sbjct  136  DCQSAYGDGTQETIS-VFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIP  191

>PHYCA_130365
Length=266

 Score = 95.5 bits (236),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 74/142 (52%), Gaps = 16/142 (11%)

Query  54   ENQGYE-TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGT  111
            E++G E  +  F     +N YK +R  MD       D     CGFT+ N  P  P  DGT
Sbjct  55   ESKGDEGLLATFKELAASNNYKDVRSMMDGNSVYGED-----CGFTDPNGTPVDPPTDGT  109

Query  112  MR-STGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRW  162
               S G  H GPCE+WLD K VLQ+D+C       T +       +DYSSC +G C LR+
Sbjct  110  ATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRF  169

Query  163  YWLGVRYLKNAYSWQIYKACIP  184
            YWLG++ L     WQ YK CIP
Sbjct  170  YWLGLQRLDGKTVWQAYKNCIP  191

>PHYRA_86151
Length=170

 Score = 92.8 bits (229),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 1/74 (1%)

Query  50   LAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-  108
            L+FLE +G+ET E+F  ++ +NGY +LRDF+D+AKY V+DGAD  CG+++    PQ IP 
Sbjct  29   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  88

Query  109  DGTMRSTGYTHDGP  122
            DGTM  +GYTHD P
Sbjct  89   DGTMSPSGYTHDAP  102

>PHYSO_533903
Length=208

 Score = 94.0 bits (232),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 78/137 (57%), Gaps = 16/137 (12%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DG-TMRSTG  116
            ++VE F   +  N +K L+  +D       D     CGFT+ N  PQPIP DG  + S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  117  YTHDGPCEVWLDTKRVLQSDNC-----HETISGKT-YNLDYSSC-TGTC-TLRWYWLGVR  168
              H GPCE WLD K+VL +D+C     H  ++ KT + +DYSSC  G C  +R+YWLG +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  169  YLKNAYS-WQIYKACIP  184
             L +  + WQ YK CIP
Sbjct  177  ALDDKKTVWQTYKDCIP  193

>PYIW_18790
Length=86

 Score = 90.1 bits (222),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 0/78 (0%)

Query  31   VLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDG  90
            VLLP PT+T   +  ++ PLAFLENQG++T  DF  + R+ GYKTLRDFMD       DG
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVDG  64

Query  91   ADYYCGFTNVNAAPQPIP  108
             D+ CG++ +   PQPIP
Sbjct  65   GDFECGWSTLKGTPQPIP  82

>PHYRA_87941
Length=157

 Score = 92.0 bits (227),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 1/74 (1%)

Query  50   LAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-  108
            L+FLE +G+ET E+F  ++ +NGY +LRDF+D+AKY V+DGAD  CG+++    PQ IP 
Sbjct  16   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  75

Query  109  DGTMRSTGYTHDGP  122
            DGTM  +GYTHD P
Sbjct  76   DGTMSPSGYTHDAP  89

>PHYRA_74651
Length=344

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHD  120
            +   + +NGY  +R  +D    T   GAD  CGFT+ NA P+  P   D T  S G  H 
Sbjct  69   YTSLKESNGYSDIRTLLDSD--TSLYGAD--CGFTDPNATPKDPPSTGDATF-SRGMVHA  123

Query  121  GPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKN  172
            GPCE+WLD  +VL +DNC       T         +DYSSC +G CTLR+YWL  + L +
Sbjct  124  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  183

Query  173  AYSWQIYKACIP  184
            +  WQ+YK C+P
Sbjct  184  STVWQVYKNCVP  195

>PYAR_24113
Length=192

 Score = 92.8 bits (229),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 85/172 (49%), Gaps = 19/172 (11%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET--------VEDFNGWRRNNGYKTLR  77
            +AH  ++ PAP YTT+  ++    +  L+    +T           FN   +N+ YK+L+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  78   DFMDRAKYTVTDGADYYCGFTNVNAA-PQPIPDGTM--RSTGYTHDGPCEVWLDTKRVLQ  134
            + + + +  V+ GA   CGF  ++ A PQP+PD       TG +H GPCEVW D     Q
Sbjct  80   ELVLQNQ-KVSAGATAECGFATLSGATPQPLPDVVEWDEFTG-SHTGPCEVWCDNNLAFQ  137

Query  135  SDNCHETISGKTYNLDYS--SCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             DNC + I G    L+Y   +C G   L  YW+ +   +    WQ+Y  C P
Sbjct  138  DDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAP  185

>PYAP_18709
Length=235

 Score = 93.6 bits (231),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 69/116 (59%), Gaps = 13/116 (11%)

Query  72   GYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDT  129
            G+K LR F++    T        CG +  NA+P+PIP DGT++ ++   H GPCEVWLD 
Sbjct  68   GFKDLRSFLEDKGPT--------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDN  119

Query  130  KRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             R   +D+C +   S  ++ +D+ +C G+C LR+YWLG++       WQ YK CIP
Sbjct  120  TRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIP  173

>PHYCA_127270
Length=279

 Score = 93.6 bits (231),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 72/136 (53%), Gaps = 15/136 (11%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ F   +  N +K L+  MD    T   GAD  CGFT+ N  PQPIP DG    S  
Sbjct  61   QSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD K+VL  D+C      K       + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQ  175

Query  169  YLKNAYSWQIYKACIP  184
             L     WQ YK CIP
Sbjct  176  GLSKKTVWQSYKDCIP  191

>PYU1_G014690
Length=295

 Score = 93.6 bits (231),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 14/126 (11%)

Query  63   DFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP--DGTMRSTGYTHD  120
            +F    +  G+ TLR +++        GA   CG T+ NA P+ IP  +    S    H 
Sbjct  62   NFAKVSKEKGFDTLRSYIED------KGA--LCGKTDPNATPKAIPSDNKVHFSRPIVHP  113

Query  121  GPCEVWLDTKRVLQSDNCHETISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQI  178
            GPCE+WLD KRV+Q D+C  T   +   +N+D+SSC   C LR++WLG++   +   WQ+
Sbjct  114  GPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQV  171

Query  179  YKACIP  184
            YK C+P
Sbjct  172  YKNCVP  177

>PHYKE_10578
Length=239

 Score = 91.7 bits (226),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 80/177 (45%), Gaps = 28/177 (16%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLA---FLENQGYETVEDFNGWRRNNGYKTLRDFMD  81
            ++AH  + +P PT+      + +  L    +    G + V  F       G       +D
Sbjct  20   ADAHGALKVPEPTFEQGASHSNWVTLVDNYWDIGSGGDQVGKFKTMATEKGMSVKDVILD  79

Query  82   RAKYTVTDGADYYCGFTNVNAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDTKRVLQS  135
              K       D  CGFT  +A PQP+P DG +      + G+TH GPCEV++D K VL  
Sbjct  80   MVK-------DKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHG  132

Query  136  DNCHETISG--------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            DNC +   G            +DYSSC G C L +YWLG +  +    WQ Y  C+P
Sbjct  133  DNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVP  185

>PHYCA_12942
Length=353

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 82/174 (47%), Gaps = 29/174 (17%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLEN-----QGYETVEDFNGWRRNNGYKTLRDF  79
            ++AH  +  P PT+  D    ++  +  ++N      G + V  F       G       
Sbjct  20   ADAHGSLKQPKPTF--DGSSAEW--VTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKDVI  75

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVL  133
            +D  K       D  CG+T  +A PQPIP DG ++       G+TH GPCE+++D K VL
Sbjct  76   LDMVK-------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVL  128

Query  134  QSDNCHETISG---KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              DNC E   G       +DYSSC G C L  YWLG    +NA  WQ Y  C+P
Sbjct  129  HGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLG---FQNA-QWQAYVNCVP  178

>PITG_04949
Length=337

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 85/175 (49%), Gaps = 22/175 (13%)

Query  27   AHQVVLLPAPTYT---TDNKDTKYAPL---AFLENQGYETV-EDFNGWRRNNGYKTLRDF  79
            AH  +  PAP++    T+N   +  P     + E++G E +   F      N +K +R  
Sbjct  23   AHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKDVRSL  82

Query  80   MDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGTMR-STGYTHDGPCEVWLDTKRVLQSDN  137
            MD       +     CGFT+    P +P  DGT   S G  H GPCE+WLD K VLQ+D+
Sbjct  83   MDGNPVFGEE-----CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  138  CHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            C       T         +DYSSC  G C LR+YWL ++ LK    WQ YK CIP
Sbjct  138  CQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIP  192

>PITG_04948
Length=232

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 71/127 (56%), Gaps = 14/127 (11%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEV  125
            + +N  K +R  +D    T   GAD  CG+TN + +P+  P DGT   S G  H GPCE+
Sbjct  71   KASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQ  177
            WLD K VLQ+D+C       T         +DYSSC +G C LR+YWL ++ L     WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  186

Query  178  IYKACIP  184
            +YK CIP
Sbjct  187  VYKNCIP  193

>PPTG_04618
Length=326

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 86/178 (48%), Gaps = 26/178 (15%)

Query  26   NAHQVVLLPAPTYTTDNKDT-----KYAPL---AFLENQGYETV-EDFNGWRRNNGYKTL  76
             AH  +  PAP++   +K+T     +  P     + E++G E +   F      N YK +
Sbjct  22   QAHGYIAKPAPSWK--DKETNDWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKDV  79

Query  77   RDFMDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGTMR-STGYTHDGPCEVWLDTKRVLQ  134
            R  MD       D     CGFT+    P +P  DGT   S G  H GPCE+WLD K VLQ
Sbjct  80   RSLMDGNPVYGED-----CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQ  134

Query  135  SDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +D+C       T         +DYSSC +G C LR+YWL ++ L     WQ YK CIP
Sbjct  135  NDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIP  192

>PYAP_24689
Length=252

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 70/124 (56%), Gaps = 13/124 (10%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDG  121
            ++  R+ +G KTLR F++ +K  V       CG TN NA  +PIP DG ++  +   H G
Sbjct  64   YDAVRKKHGVKTLRAFLE-SKGPV-------CGSTNPNAKRKPIPRDGLIKFGSSMEHPG  115

Query  122  PCEVWLDTKRVLQSDNCHETISGKT-YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYK  180
            PCE+W D  RV    +C++     T + +DYS C G C LR+YWLG++       WQ YK
Sbjct  116  PCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYK  173

Query  181  ACIP  184
             C+P
Sbjct  174  NCVP  177

>PYIW_27477
Length=180

 Score = 88.2 bits (217),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 84/163 (52%), Gaps = 22/163 (13%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----NQGYETVEDFNGWRRNNGYKTLRDFM  80
            NAH  V +P   + +    T Y     +E        ++   +F    +  G++TLR ++
Sbjct  1    NAHGFVEVPKSEFPSG---TSYPSEWIVEFAPPWEGSWKDPANFAKVSKEKGFETLRSYI  57

Query  81   DRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDTKRVLQSDNC  138
            +        GA   CG T+ NA  + IP D  ++ S    H GPCE+W+D  RV+Q DNC
Sbjct  58   E------DKGAK--CGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCELWIDDTRVMQDDNC  109

Query  139  HETISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179
             +T   K  T+ +D+S+C G C LRW+WLG++   +   WQ+Y
Sbjct  110  EKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PYU1_G005324
Length=191

 Score = 88.6 bits (218),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 13/118 (11%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWL  127
              GYK L+ F+D    T        CG T  NA  + IP DG ++ ++   H GPCE+WL
Sbjct  67   KKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIWL  118

Query  128  DTKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               R   +D+C +T  S  ++ +D+S+C G C LR+YWLG++       WQ YK C+P
Sbjct  119  GNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

>PYU1_G005326
Length=191

 Score = 88.6 bits (218),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 13/118 (11%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWL  127
              GYK L+ F+D    T        CG T  NA  + IP DG ++ ++   H GPCE+WL
Sbjct  67   KKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIWL  118

Query  128  DTKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               R   +D+C +T  S  ++ +D+S+C G C LR+YWLG++       WQ YK C+P
Sbjct  119  GNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

>PYU1_G005328
Length=191

 Score = 88.6 bits (218),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 13/118 (11%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWL  127
              GYK L+ F+D    T        CG T  NA  + IP DG ++ ++   H GPCE+WL
Sbjct  67   KKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIWL  118

Query  128  DTKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               R   +D+C +T  S  ++ +D+S+C G C LR+YWLG++       WQ YK C+P
Sbjct  119  GNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

>PYU1_G005325
Length=207

 Score = 89.0 bits (219),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 65/118 (55%), Gaps = 13/118 (11%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWL  127
              GYK L+ F+D    T        CG T  NA  + IP DG ++ ++   H GPCE+WL
Sbjct  67   KKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIWL  118

Query  128  DTKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               R   +D+C +T  S  ++ +D+S+C G C LR+YWLG++       WQ YK CIP
Sbjct  119  GNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIP  174

>PYAP_18711
Length=210

 Score = 89.0 bits (219),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 68/130 (52%), Gaps = 13/130 (10%)

Query  58   YETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-ST  115
            + T   ++  R+  G K LR F++      + G +  CG TN NA  +PIP DG ++  +
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLE------SKGPE--CGRTNPNAKRKPIPSDGLIKFGS  106

Query  116  GYTHDGPCEVWLDTKRVLQSDNCHETISGKT-YNLDYSSCTGTCTLRWYWLGVRYLKNAY  174
               H GPCEVW D   V    +C +     T + +DYS C G C LR+YWLG++      
Sbjct  107  SMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQIYKACIP  184
             WQ YK C+P
Sbjct  165  RWQSYKNCVP  174

>PHYSO_533682
Length=278

 Score = 90.1 bits (222),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 70/135 (52%), Gaps = 15/135 (11%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +VE F  ++  N +K L+  MD       D     CGFT+ N  PQPIP DG    S G 
Sbjct  62   SVEVFTSFKSVNNFKDLKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRGL  116

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSC-TGTCT-LRWYWLGVRY  169
             H GPCE+WLD  +VL  D+C+            T+ +DYSSC  G C  +R Y LG + 
Sbjct  117  IHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQG  176

Query  170  LKNAYSWQIYKACIP  184
            L +   WQ YK CIP
Sbjct  177  LVDKTVWQSYKNCIP  191

>PHYSO_438103
Length=238

 Score = 89.4 bits (220),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 68/135 (50%), Gaps = 15/135 (11%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +VE F   +  N +K L+  MD       D     CGFT+ N  PQPIP DG    S   
Sbjct  61   SVEVFKSLKSANNFKDLKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRAL  115

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSCT-GTCT-LRWYWLGVRY  169
             H GPCE+WLD  +VL  D+C      +       + +DYSSC  G C  +R+YWL  + 
Sbjct  116  VHVGPCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQG  175

Query  170  LKNAYSWQIYKACIP  184
            L +   WQ YK CIP
Sbjct  176  LDSKTVWQSYKDCIP  190

>PYIW_19151
Length=248

 Score = 89.4 bits (220),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 14/127 (11%)

Query  62   EDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTH  119
            ++F    +  G+ TLR +++        GA   CGFT+   +P+ IP D T+R S    H
Sbjct  59   KNFAAAAKEKGFSTLRSYLE------DKGA--VCGFTDPKVSPRAIPADRTIRFSRDIPH  110

Query  120  DGPCEVWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQ  177
             GPCE+++D  RV Q+D+C    +G   ++++D+S C G C +R+YWLG++   +   WQ
Sbjct  111  PGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQ  168

Query  178  IYKACIP  184
            +YK+C+P
Sbjct  169  VYKSCVP  175

>PHYSO_340333
Length=284

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 71/135 (53%), Gaps = 15/135 (11%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +V+ F   +  N +K L+  MD    T   GAD  CGFT+ N  PQPIP DG    S   
Sbjct  62   SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  116

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSC-TGTCT-LRWYWLGVRY  169
             H GPCE+WLD K+VL  D+C      +       + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNAYSWQIYKACIP  184
            +     WQ YK CIP
Sbjct  177  VDGKTVWQSYKDCIP  191

>PPTG_14221
Length=275

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 70/136 (51%), Gaps = 15/136 (11%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ F   +  N +K L+  MD    T   GAD  CGFTN N  PQPIP DG    S  
Sbjct  61   KSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTNPNGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGKT------YNLDYSSC-TGTCT-LRWYWLGVR  168
              H GPC +WLD K VL  D+C      +       + +DYSSC  G C  +R+YWL  +
Sbjct  116  LVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQ  175

Query  169  YLKNAYSWQIYKACIP  184
             L     WQ YK CIP
Sbjct  176  GLNKKTVWQSYKDCIP  191

>PHYSO_340332
Length=295

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 71/135 (53%), Gaps = 15/135 (11%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +V+ F   +  N +K L+  MD    T   GAD  CGFT+ N  PQPIP DG    S   
Sbjct  62   SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  116

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSC-TGTCT-LRWYWLGVRY  169
             H GPCE+WLD K+VL  D+C      +       + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNAYSWQIYKACIP  184
            +     WQ YK CIP
Sbjct  177  VDGKTVWQSYKDCIP  191

>PHYSO_483955
Length=320

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 70/142 (49%), Gaps = 16/142 (11%)

Query  54   ENQGYETV-EDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGT  111
            E++G E +   F      N YK +R  MD       D     CGFT+    P  P  DGT
Sbjct  56   ESKGDEGLLATFKELSAANNYKDVRSLMDGNPVYGED-----CGFTDPKGKPVAPPTDGT  110

Query  112  MR-STGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRW  162
               S G  H GPCE+WLD K VLQ+D+C       T         +DYSSC +G C LR+
Sbjct  111  ATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRF  170

Query  163  YWLGVRYLKNAYSWQIYKACIP  184
            YWL ++ L     WQ YK CIP
Sbjct  171  YWLALQRLDGKTVWQAYKNCIP  192

>PHYKE_6002
Length=197

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 84/165 (51%), Gaps = 18/165 (11%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFL------ENQGYETVEDFNGWRRNNGYKTLRDF  79
            NAH  +L+P   +  D        +A +      +    ++V  F+  ++ N +  L+  
Sbjct  22   NAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDLKTL  81

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDTKRVLQSDN  137
            MD    T   GAD  CGFT+ +  PQPIP DG    S    H GPCE+WLD+ +    DN
Sbjct  82   MDD---TSVYGAD--CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFSKDN  136

Query  138  CHETISGKTYNLDYSSC-TGTCT-LRWYWLGVRYLKNAYSWQIYK  180
            C +    +T+ +DYSSC +G C  +R+YWL  + L +   WQ Y+
Sbjct  137  CADM---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PPTG_04619
Length=276

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 72/128 (56%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQ-PIPDGTMR-STGYTHDGPCEV  125
            + +N  K +R  +D    T   GAD  CG+TN +  P+ P  DGT   S G  H GPCE+
Sbjct  71   KASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDTKRVLQSDNC--------HETISGKTYNLDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            WLD K VLQ+D+C         ETIS     +DYSSC +G C  R+YWL ++ L     W
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETIS-VFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  185

Query  177  QIYKACIP  184
            Q+YK CIP
Sbjct  186  QVYKNCIP  193

>PHALS_03176
Length=207

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 71/136 (52%), Gaps = 16/136 (12%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ F   +  N +K L+  MD + +    GA   CGF++    PQPIP DG    S  
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMDTSAF----GAK--CGFSDPKGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGKTYNL------DYSSCT-GTCT-LRWYWLGVR  168
              H GPCE+WLD K+VL  D+C+        N+      DYSSC  G C  +R+YWL  +
Sbjct  115  IVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQ  174

Query  169  YLKNAYSWQIYKACIP  184
             +     WQ YK CIP
Sbjct  175  GVNGKTVWQSYKNCIP  190

>PHYSO_485524
Length=278

 Score = 88.6 bits (218),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 70/127 (55%), Gaps = 14/127 (11%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEV  125
            + +N  K +R  +D    T   GA+  CG+TN +A P+  P DGT   S G  H GPCE+
Sbjct  71   KDSNNAKDIRTLLDSD--TKLYGAN--CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQ  177
            WLD K VLQ+D+C       T         +DYSSC +G C  R+YWL ++ L     WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  186

Query  178  IYKACIP  184
            +YK CIP
Sbjct  187  VYKNCIP  193

>PYU1_G007364
Length=316

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 82/177 (46%), Gaps = 30/177 (17%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYA-------PLAFLENQGYETVEDFNGWRRNNGYKTLRD  78
            NAH  + +P   ++     T +        P  F +N           ++ +  Y +LRD
Sbjct  35   NAHGYITVPMAEFSDGAMKTNFIAKMDPAFPGKFNDNPQANVDTFTKAFQASGKYASLRD  94

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRS-------TGY--THDGPCEVWLDT  129
             +         G    CG T ++A P+PIP   M S        G+  +H GPCE+WLD 
Sbjct  95   LLQ--------GHGEDCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGPCEIWLDD  146

Query  130  KRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              VL+ +NC     G    +  D+SSCTG C +R+YWL ++      +WQIYK CIP
Sbjct  147  TPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIYKNCIP  199

>PHYKE_6001
Length=289

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 73/136 (54%), Gaps = 15/136 (11%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V  FN  ++ N Y  L+  MD    T   GAD  CGFT+ N  PQPIP DG    S  
Sbjct  61   QSVTAFNALKKANNYVDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPSDGKATYSRA  115

Query  117  YTHDGPCEVWLDTKRVLQSDNCH-----ETISGKT-YNLDYSSCTGTC--TLRWYWLGVR  168
              H GPCE+WLD K V   ++C+     E +  K+ + +DYSSC G     +R+YWL  +
Sbjct  116  IQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQ  175

Query  169  YLKNAYSWQIYKACIP  184
             +     WQ YK CIP
Sbjct  176  GVDGKTVWQSYKNCIP  191

>PHYRA_78689
Length=296

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 73/136 (54%), Gaps = 15/136 (11%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ F   +  N +K L+  MD    T   GAD  CGFT+ +  PQPIP DG    S  
Sbjct  61   QSVDTFKSLKTANNFKDLKTLMDD---TSVYGAD--CGFTDPDGTPQPIPTDGKATFSRA  115

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSC-TGTCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C      +       + +DYSSC +G C  +R+YWL  +
Sbjct  116  LVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQ  175

Query  169  YLKNAYSWQIYKACIP  184
             L +   WQ YK CIP
Sbjct  176  GLDSKTVWQSYKDCIP  191

>PYIW_24289
Length=196

 Score = 86.7 bits (213),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 74/177 (42%), Gaps = 23/177 (13%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAP-------LAFLENQGYETVEDFNGWRRNNG------  72
            + H  + +P PT+TT   +  +         L   E   Y    + N             
Sbjct  24   DGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTAFSSQTD  83

Query  73   ---YKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDT  129
               Y+ LRD +D  K   + G D  CGFTNV +A QP+          TH GPCE+W D 
Sbjct  84   SIKYRNLRDLID-TKAVFSAGTDKECGFTNVTSAKQPLSAHATGGFTPTHQGPCEIWCDR  142

Query  130  KRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              V Q+DNC +        L Y  S C G   L++YWL V  +K    W+ Y  C P
Sbjct  143  VLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAP  195

>PPTG_04622
Length=273

 Score = 88.2 bits (217),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHD  120
            +   + +NGY  +R  +D      TD     CGFT+ +A P+  P   D T  S G  H 
Sbjct  69   YTSLKESNGYSDIRALLDSD----TDLYGANCGFTDPDATPKDPPTTGDATF-SRGMVHA  123

Query  121  GPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKN  172
            GPCE+WLD   VL +D+C       T +       +DYSSC TG C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDS  183

Query  173  AYSWQIYKACIP  184
               WQ+YK C+P
Sbjct  184  KMVWQVYKDCVP  195

>PHYRA_73607
Length=343

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 72/132 (55%), Gaps = 16/132 (12%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHD  120
            ++  + +NGY  +R  +D    T   GAD  CGFTN +A  +  P   D T  S G  H 
Sbjct  69   YSSLKSSNGYSDIRTLLDSD--TSLYGAD--CGFTNPDATAKDPPTTGDATF-SRGMVHV  123

Query  121  GPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKN  172
            GPCE+WLD  +VL +DNC       T +       +DYSSC T  C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  AYSWQIYKACIP  184
            +  WQ+YK C+P
Sbjct  184  SMVWQVYKNCVP  195

>PYAR_14260
Length=212

 Score = 86.7 bits (213),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (58%), Gaps = 13/116 (11%)

Query  72   GYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDT  129
            G+K LR F++    T        CG +  +A P+PIP DG ++ ++   H GPCE+WLD 
Sbjct  45   GFKNLRSFLESKGPT--------CGNSLSSAKPKPIPSDGMVKFASTLEHPGPCEIWLDE  96

Query  130  KRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
                 SD+C +   S  +  +++S+C G+C LR+YWLG++   +   WQ YK C+P
Sbjct  97   TMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVP  150

>CCI47381
Length=211

 Score = 86.3 bits (212),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 25/124 (20%)

Query  73   YKTLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIP---------DGTMRSTGYTHDGP  122
            ++TLRDF+ D+  Y         CG TN NA+P+PIP           T      +H GP
Sbjct  72   FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  122

Query  123  CEVWLDTKRVLQSDNC--HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYK  180
            CEVWL   RV   DNC  H T S     +++SSC+G C L+++WL +   +    WQ+YK
Sbjct  123  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYK  178

Query  181  ACIP  184
             CIP
Sbjct  179  NCIP  182

>H310_06362
Length=197

 Score = 85.1 bits (209),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 24/125 (19%)

Query  72   GYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTM------RSTGY--THDGP  122
            G+KTLR  +D        G D  CG+T +N   +PIP DG +         G+  +H GP
Sbjct  51   GFKTLRAMLD------PHGPD--CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTGP  102

Query  123  CEVWLDTKRVLQSDNCHETISGKT---YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179
            CE+WLD  RV Q++NC      K      +D+SSC G+CT+R+YWL +    +   WQ+Y
Sbjct  103  CEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLWQVY  158

Query  180  KACIP  184
            K C P
Sbjct  159  KNCAP  163

>PHALS_03177
Length=259

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 70/136 (51%), Gaps = 16/136 (12%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ F   +  N +K L+  MD        G D  CG+++ N  PQPIP DG    S  
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMDNPVL----GRD--CGYSDPNGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGKTYNL------DYSSCT-GTCT-LRWYWLGVR  168
              H GPCE+WLD K+VL  D+C+        N+      DYSSC  G C  +R+YWL  +
Sbjct  115  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  174

Query  169  YLKNAYSWQIYKACIP  184
             +     WQ YK CIP
Sbjct  175  GINGKTFWQSYKMCIP  190

>PYU1_G005323
Length=251

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 65/118 (55%), Gaps = 13/118 (11%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWL  127
              GYK L+ F++             CG +  +A  +PIP DG ++ ++   H GPCEVW 
Sbjct  66   GKGYKDLKSFLEDKGPV--------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWF  117

Query  128  DTKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D  R    D+C +T  S  ++ +D+S+C G+C LR+YWLG++       WQ YK CIP
Sbjct  118  DDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIP  173

>SDRG_16535
Length=313

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 79/175 (45%), Gaps = 25/175 (14%)

Query  26   NAHQVVLLPAPTYTTDNKD-TKY-----APLAFLENQGYE-----TVEDFNGWRRNNGYK  74
            N H  ++ P PT+   N D TKY      P+  L    Y          F    R + ++
Sbjct  16   NGHGFLINPTPTFNELNGDRTKYCGTIDGPVV-LPGSSYNQDPAWNTRQFTMQFRASKFQ  74

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY-----THDGPCEVWLDT  129
            TL  F+D   +         CG TN N APQP+P     + G      +H+GPCEVW D+
Sbjct  75   TLASFVDDPSFAPCG----TCGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWCDS  130

Query  130  KRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             RV Q+DNC         ++D + C G   LR  WL +    +  SWQ+Y  C+P
Sbjct  131  TRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVP  181

>PYIR_19612
Length=260

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 77/133 (58%), Gaps = 20/133 (15%)

Query  62   EDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTH  119
            ++F    +  G+ TLR +++    T        CGFT+ N AP+ IP D  +R S   +H
Sbjct  61   KNFATAAKEKGFATLRSYLEDKGAT--------CGFTDPNVAPRAIPADRKVRFSRDISH  112

Query  120  DGPCEVWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQ  177
             GPCE+W+D KRV Q+D+C    +G   ++++D++ C+G C +R+YWL ++   +   WQ
Sbjct  113  PGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQ  170

Query  178  IYKA------CIP  184
            +Y++      C+P
Sbjct  171  VYRSELTRDLCVP  183

>PHYKE_3913
Length=321

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 57/100 (57%), Gaps = 10/100 (10%)

Query  95   CGFTNVNAAPQ-PIPDGTMR-STGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYN----  148
            CGFTN +A P+ P  DGT   S G  H GPCE+WLD K VLQ+D+C       T      
Sbjct  121  CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISI  180

Query  149  ---LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               +DYSSC  G C  R+YW+ ++ L     WQ+YK C+P
Sbjct  181  FKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCVP  220

>PYIW_15526
Length=256

 Score = 85.1 bits (209),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 86/184 (47%), Gaps = 38/184 (21%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKY-APLAFLENQGY----------ETVEDFNGWRRNNG  72
            ++ AH  +  P  TYT     T + A +    N+G+          +   +F       G
Sbjct  17   STEAHGFISEPKATYTGGGSYTSFSAEIGADVNKGFSGRIFNRSPEQNAAEFTAAWPKTG  76

Query  73   YKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY-----------THDG  121
            Y +L++ +D++      G    CG+TN NAAP  +    ++S  Y           +H G
Sbjct  77   YTSLKEMLDKS----VSG----CGYTNPNAAPVDVSG--LKSMKYQNNEYKEGFLGSHRG  126

Query  122  PCEVWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179
            PCE W+D  ++  +D+C +T  G   T  +DYS C GTC L +YWL V   K    WQ+Y
Sbjct  127  PCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQVY  182

Query  180  KACI  183
            K C+
Sbjct  183  KGCV  186

>PHYSO_533747
Length=206

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 75/136 (55%), Gaps = 16/136 (12%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DG-TMRSTG  116
            ++VE F   +  N +K L+  +D       D     CGFT+ N  PQPIP DG  + S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  117  YTHDGPCEVWLDTKRVLQSDNC-----HETISGKT-YNLDYSSC-TGTC-TLRWYWLGVR  168
              H GPCE WLD K+VL +D+C     H  ++ KT + +DYSSC  G C  +R+YWLG +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  169  YLKNAYS-WQIYKACI  183
             L +  + WQ Y   +
Sbjct  177  ALDDKKTVWQTYSTLL  192

>CCA17179
Length=185

 Score = 83.6 bits (205),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 63/124 (51%), Gaps = 25/124 (20%)

Query  73   YKTLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIP---------DGTMRSTGYTHDGP  122
            ++ LRDF+ D+  Y         CG TN NA P+PIP           T      +H GP
Sbjct  46   FQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGP  96

Query  123  CEVWLDTKRVLQSDNCHETI--SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYK  180
            CEVWL+  RV   DNC E    S     +D+S+CT  C L+++WL +   +    WQ+YK
Sbjct  97   CEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQVYK  152

Query  181  ACIP  184
             CIP
Sbjct  153  NCIP  156

>PYAR_14256
Length=199

 Score = 83.6 bits (205),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 64/117 (55%), Gaps = 12/117 (10%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-STGYTHDGPCEVWLD  128
            + G+K LR F++    T        CG T  NA P+P     ++ ++   H GPCE+WLD
Sbjct  63   DKGFKNLRAFLEDKGPT--------CGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWLD  114

Query  129  TKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
                   D+C +   S  ++ +D+S+C G+C LR+YWLG++   +   WQ YK CIP
Sbjct  115  DSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIP  169

>PPTG_07509
Length=299

 Score = 85.1 bits (209),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 67/142 (47%), Gaps = 25/142 (18%)

Query  57   GYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR--  113
            G + V  F    +  G       +D  K       D  CG+T  +  P+PIP DG ++  
Sbjct  54   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  106

Query  114  ---STGYTHDGPCEVWLDTKRVLQSDNCHETISG--------KTYNLDYSSCTGTCTLRW  162
                 G+TH GPCE+++D K VL  DNC E   G            +D+SSC G CTL  
Sbjct  107  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  166

Query  163  YWLGVRYLKNAYSWQIYKACIP  184
            YWLG    +NA  WQ Y  C+P
Sbjct  167  YWLG---FQNAQ-WQAYVNCVP  184

>PPTG_03153
Length=314

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 78/177 (44%), Gaps = 21/177 (12%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGY---------ETVEDFNGWRRNNGYKT  75
            +NAH  +  PA  Y T    ++Y         G+         + V  F     ++ YK+
Sbjct  18   ANAHGWLTKPAAVYDTQMDKSQYIGTIESTTSGFKGTFTGAPADNVAAFTKAFESSKYKS  77

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGT----MRSTGYT--HDGPCEVWLDT  129
            L+  +D     +  GA   CG  +  A PQP+P         S G+T  H+GPCEVW D 
Sbjct  78   LKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEVWCDK  137

Query  130  KRVLQSDNC--HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +RV   DNC  H T +      + S CTG   L  YW+ +    +  SWQ+Y  C P
Sbjct  138  ERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----HGPSWQVYVNCAP  190

>PPTG_07507
Length=299

 Score = 85.1 bits (209),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 67/142 (47%), Gaps = 25/142 (18%)

Query  57   GYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR--  113
            G + V  F    +  G       +D  K       D  CG+T  +  P+PIP DG ++  
Sbjct  54   GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  106

Query  114  ---STGYTHDGPCEVWLDTKRVLQSDNCHETISG--------KTYNLDYSSCTGTCTLRW  162
                 G+TH GPCE+++D K VL  DNC E   G            +D+SSC G CTL  
Sbjct  107  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  166

Query  163  YWLGVRYLKNAYSWQIYKACIP  184
            YWLG    +NA  WQ Y  C+P
Sbjct  167  YWLG---FQNAQ-WQAYVNCVP  184

>PHYKE_2809
Length=291

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 68/128 (53%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEV  125
            +  N  K +R  +D    T   G D  CGFT+  A P+  P DG    S G  H GPCE+
Sbjct  58   KAANNVKDIRTMLDSD--TKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEI  113

Query  126  WLDTKRVLQSDNCH--------ETISGKTYNLDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            WLD K VLQ+D+C         ETIS     +DYSSC  G C  R+YWL ++ L     W
Sbjct  114  WLDDKMVLQNDDCQSAYGDGTKETIS-VFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFW  172

Query  177  QIYKACIP  184
            Q+YK C+P
Sbjct  173  QVYKNCVP  180

>PHYRA_77971
Length=230

 Score = 84.0 bits (206),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 56/109 (51%), Gaps = 18/109 (17%)

Query  90   GADYYCGFTNVNAAPQPIPDGTMR------STGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            GAD  CGFT  +  PQP+P             GYTH GPCE+++D K VL SDNC     
Sbjct  82   GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  141

Query  144  GKTYN--------LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            G   +        +DYSSC G CT   YWLG    +NA  WQ Y  C+P
Sbjct  142  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-QWQAYINCVP  186

>PHYRA_85794
Length=230

 Score = 83.6 bits (205),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 56/109 (51%), Gaps = 18/109 (17%)

Query  90   GADYYCGFTNVNAAPQPIPDGTMR------STGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            GAD  CGFT  +  PQP+P             GYTH GPCE+++D K VL SDNC     
Sbjct  82   GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  141

Query  144  GKTYN--------LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            G   +        +DYSSC G CT   YWLG    +NA  WQ Y  C+P
Sbjct  142  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-QWQAYINCVP  186

>PHYRA_73583
Length=630

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 70/128 (55%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            + +N  K +R  +D    T   GA+  CG+TN +A+P+  P   D T  S G  H GPCE
Sbjct  71   KASNNAKDIRTLLDSD--TTLYGAN--CGYTNPDASPKDPPSTGDATF-SRGIVHAGPCE  125

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            +WLD K VLQ+D+C       T         +DYSSC +G C  R+YWL ++ L     W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWW  185

Query  177  QIYKACIP  184
            Q+YK CIP
Sbjct  186  QVYKNCIP  193

 Score = 80.9 bits (198),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 67/128 (52%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            + +N  K +R  +D    T   GAD  CGFT+  A P+  P   D T  S G  H GPCE
Sbjct  372  KASNNIKDIRTMIDSD--TKLYGAD--CGFTDPKATPKDPPSTGDATF-SRGMVHAGPCE  426

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            VWLD + VLQ+D+C       T         +DYSSC  G C  R++WL ++   +   W
Sbjct  427  VWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWW  486

Query  177  QIYKACIP  184
            Q+YK C+P
Sbjct  487  QVYKNCVP  494

>PHYCA_534296
Length=309

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 70/135 (52%), Gaps = 15/135 (11%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +VE F   +  N +K L+  MD    T   GAD  CGFTN +   QPIP DG    S   
Sbjct  36   SVETFKSLKSANNFKDLKTLMDD---TSVYGAD--CGFTNPSGTAQPIPTDGKATFSRAL  90

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGKT------YNLDYSSC-TGTC-TLRWYWLGVRY  169
             H GPCE+WLD  +VL  D+C+     +       + +DYSSC  G C  +R+YWL  + 
Sbjct  91   VHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQG  150

Query  170  LKNAYSWQIYKACIP  184
            +     WQ YK CIP
Sbjct  151  VDGKTVWQSYKDCIP  165

>PHYKE_7717
Length=568

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)

Query  144  GKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            GK Y +DYS+C GTCTLRWYWLGVR+LKNAYSWQ+YKACIP
Sbjct  4    GKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIP  44

>PYIR_23585
Length=240

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 79/164 (48%), Gaps = 15/164 (9%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKY-APLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRA  83
            +NAH  +  P   + +    + + A  +        +  DF       G+ T R F++  
Sbjct  22   ANAHGYIATPKSEFKSGASQSSWVAEFSSPWGGSKWSAADFAKTAPGKGFATTRAFLESR  81

Query  84   KYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDTKRVLQSDNCHET  141
              T        CG T  NA+P+PIP D T++ S    H GPCE+W+D  RV  +D+C   
Sbjct  82   GPT--------CGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWIDNTRVYHNDDCEAA  133

Query  142  ISGK--TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
                  T+ +D+S+C G+C LR+YWLG++       +Q Y  C+
Sbjct  134  FGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCL  175

>PITG_11936
Length=333

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 22/179 (12%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETV---------EDFNGWRRNNGYK  74
            T+  H  +  P   +T +  +T+Y         G+  +          +FN     + YK
Sbjct  20   TAKGHGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASKYK  79

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-------GTMRSTGYTHDGPCEVWL  127
            +L++FM+     V +     CG+TN +A PQP+P        G       +H+GPCEV+ 
Sbjct  80   SLKEFMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYC  139

Query  128  DTKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D  RV Q DNC +        L  D+ +C G+  L  YW+ +    ++ SWQ+Y  C P
Sbjct  140  DETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HSPSWQVYINCAP  194

>PYU1_G001519
Length=265

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 77/177 (44%), Gaps = 20/177 (11%)

Query  24   TSNAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLENQGYETVEDFNGWRRN  70
            T++AH  + LP PT+           T D   T   P  ++F  +    T      ++  
Sbjct  18   TADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQ  77

Query  71   NGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTM-RSTGYTHDGPCEVWLDT  129
              YK+L+D        V  GA   CGF++VN  PQP+PD         +H GPCEVW D 
Sbjct  78   TKYKSLKDLAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDD  137

Query  130  KRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              V Q DNC   I      L Y  + C G   L  +W+ +    +  +WQIY  C P
Sbjct  138  VMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIAL----HVPTWQIYTNCAP  190

>PHYSO_459106
Length=223

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 66/128 (52%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            ++ N  K +R  +D    T   G D  CGFT+    PQ  P   D T  S G  H GPCE
Sbjct  71   KKANNVKDIRTMIDSD--TKLYGED--CGFTDPKGKPQDPPTTGDATF-SRGIVHAGPCE  125

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            +WLD K VLQ+D+C       T         +DYSSC +G C  R+YWL ++   +   W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYW  185

Query  177  QIYKACIP  184
            Q+YK CIP
Sbjct  186  QVYKNCIP  193

>PHYCA_531163
Length=314

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 69/128 (54%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            + +NGY  +R  +D    T   GAD  CG+TN +A  +  P   D T  S G  H GPCE
Sbjct  73   KSSNGYSDIRTLLDSD--TSLYGAD--CGYTNADATAKDPPSTGDATF-SRGMVHVGPCE  127

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            +WLD   VL +D+C       T +       +DYSSC T  C LR+YWL  + + +A  W
Sbjct  128  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  187

Query  177  QIYKACIP  184
            Q+YK C+P
Sbjct  188  QVYKDCVP  195

>PHYKE_6078
Length=317

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 87/180 (48%), Gaps = 28/180 (16%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNN-----------GYK  74
            N H  +  PA T+ T N  T++  +A +E         FNG   +N            Y 
Sbjct  22   NGHGYMSDPAVTFLTSNDPTQF--IATIEASDSGLSGTFNGAPADNTAAFTTAFESSSYS  79

Query  75   TLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
            +L++F+ D+A  TVTD A   CG  + + A Q +PD  +      S G+T  H+GPCEVW
Sbjct  80   SLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVW  138

Query  127  LDTKRVLQSDNCHE--TISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             D  RV Q D+C    T +      D+ +C G+ T+  YWL +     + +WQ+Y  C P
Sbjct  139  CDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALH----SSTWQVYVNCAP  194

>PITG_05271
Length=278

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 68/135 (50%), Gaps = 15/135 (11%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +V  F   +  N +K L+  MD    T   GAD  CGFT+ N   QPIP DG    S   
Sbjct  62   SVNAFKALKTANKFKDLKTLMDD---TSVYGAD--CGFTDPNGKAQPIPKDGKATFSRAL  116

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSC-TGTCT-LRWYWLGVRY  169
             H GPCE+WLD  +VL  D+C      +       + +DYSSC  G C  +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  176

Query  170  LKNAYSWQIYKACIP  184
            +     WQ YK CIP
Sbjct  177  VDGKTVWQSYKDCIP  191

>PHALS_03179
Length=372

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 69/136 (51%), Gaps = 16/136 (12%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ +   +  N +K L+  M+      T      CGF++    PQPIP DG    S  
Sbjct  102  QSVKAYQSLKAANNFKDLKTLME------THALGPECGFSDPKGKPQPIPKDGKATLSRA  155

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGKTYNL------DYSSCT-GTCT-LRWYWLGVR  168
              H GPCE+WLD K+VL  D+C+     +   +      DYSSC  G C  +R+YWL  +
Sbjct  156  IVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQ  215

Query  169  YLKNAYSWQIYKACIP  184
             +K    WQ YK CIP
Sbjct  216  GIKGITFWQSYKNCIP  231

>PHYCA_97965
Length=288

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 80/179 (45%), Gaps = 32/179 (18%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLEN-----QGYETVEDFNGWRRNNGYKTLRDF  79
            +NAH  +  P  T+       ++  +  ++N      G + V  F    +  G       
Sbjct  22   ANAHGNLKQPEATFKDGAPTVEW--VTLIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  79

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVL  133
            +D  K       D  CG+T  +  PQPIP DG ++       G+TH GPCE+++D K VL
Sbjct  80   LDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVL  132

Query  134  QSDNCHETISG--------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              D+C +   G           ++D+SSC G CTL  YWL  +  +    WQ Y  C+P
Sbjct  133  HGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVP  187

>PHALS_05392
Length=367

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 59/124 (48%), Gaps = 15/124 (12%)

Query  71   NGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDG--TMRSTGYTHDGPCEVWLD  128
            N +K +R  MD       D     CG+T+ N  P   P       S G  H GPCE+WLD
Sbjct  157  NNFKDVRSLMDGNPVYGED-----CGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLD  211

Query  129  TKRVLQSDNCHETISGKTYN-------LDYSSCTGT-CTLRWYWLGVRYLKNAYSWQIYK  180
             K VLQ+D+C       T         +DYSSC    C LR+YWL ++ L     WQ YK
Sbjct  212  DKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYK  271

Query  181  ACIP  184
             CIP
Sbjct  272  NCIP  275

>PHYRA_73584
Length=287

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 16/132 (12%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHD  120
            ++  +++NGY  +R  +D    T   GA+  CGFTN +A  +  P   D T  S G  H 
Sbjct  66   YSSLKKSNGYSDIRTLLDSD--TTLYGAN--CGFTNPDATAKDPPTTGDATF-SRGMVHA  120

Query  121  GPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSCTGT-CTLRWYWLGVRYLKN  172
            GPCE+WLD   VL +D+C       +         +DYSSC+ + C LR+YWL  + + +
Sbjct  121  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  180

Query  173  AYSWQIYKACIP  184
               WQ+YK C+P
Sbjct  181  KTVWQVYKDCVP  192

>SDRG_15426
Length=523

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 72/138 (52%), Gaps = 26/138 (19%)

Query  61   VEDFN-GWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-----  113
            V +FN  +   + YKTLRD +D +      G D  CG T  N AP+PIP DG M      
Sbjct  33   VANFNKAFAAQSQYKTLRDLLDLS------GPD--CGNTRTNVAPKPIPSDGMMTWQNPD  84

Query  114  -STGY--THDGPCEVWLDTKRVLQSDNC---HETISGKTYNLDYSSC-TGTCTLRWYWLG  166
               G+  +H GPCE+WLD  RV Q+DNC     T       +DY+ C    C LR+YWL 
Sbjct  85   TGEGFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLA  144

Query  167  VRYLKNAYSWQIYKACIP  184
            +   +    WQ+YK C+P
Sbjct  145  LHQPQ----WQVYKNCVP  158

>H257_13550
Length=266

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 74/141 (52%), Gaps = 27/141 (19%)

Query  59   ETVEDFNGWRRNN---GYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTM--  112
            + V  FN   R+    G+KTLR  +D        G D  CG++ ++   +PIP DG +  
Sbjct  90   KNVAAFNKAFRDQQATGFKTLRAMLD------PQGPD--CGYSKLDVPAKPIPSDGNVVW  141

Query  113  ----RSTGY--THDGPCEVWLDTKRVLQSDNCHETISGKT---YNLDYSSCTGTCTLRWY  163
                   G+  +H GPCE+WLD  RV Q+D+C      K      +D++SC G+CT+R+Y
Sbjct  142  QNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFY  201

Query  164  WLGVRYLKNAYSWQIYKACIP  184
            W+ +    +   WQ+YK C P
Sbjct  202  WIAL----HQDLWQVYKNCAP  218

>SDRG_08137
Length=282

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 86/178 (48%), Gaps = 34/178 (19%)

Query  28   HQVVLLPAPTYTTDNKDTKYA-------PLAFLENQGYETVEDF-NGWRRNNGYKTLRDF  79
            H +V  PA  ++ +   T Y        P  F +    E V  F + ++  + +KTLRD 
Sbjct  83   HGIVSNPAAEFSLNVMRTTYVATIQANLPGKF-DGSPQENVAAFTSAFKAQSQFKTLRDM  141

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR------STGY--THDGPCEVWLDTK  130
            ++             CG +  NA+ + IP DGTM         G+  +H GPCEVWLD K
Sbjct  142  LEPQGPA--------CGNSLPNASKKTIPSDGTMTWRNPDTGEGFISSHTGPCEVWLDDK  193

Query  131  RVLQSDNCHETISGKT---YNLDYSSCTG-TCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            RV Q+D+C      K      +DYSSC G  C LR+YWL +   +    WQ+YK C+P
Sbjct  194  RVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNCVP  247

>PHYSO_484051
Length=285

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 67/128 (52%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            + +NGY  +R  +D    T   GAD  CGFTN +A+P+  P   D T  S    H  PCE
Sbjct  73   KESNGYSDIRTLLDSD--TSLYGAD--CGFTNPDASPKDPPTTGDPTF-SRCMVHASPCE  127

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            +WLD   VL +D+C       T         +DYSSC T  C LR+YWL  + + +   W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  177  QIYKACIP  184
            Q+YK C+P
Sbjct  188  QVYKDCVP  195

>PHYRA_73606
Length=366

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 70/132 (53%), Gaps = 16/132 (12%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHD  120
            + G + +NGY  +R  +D    T   GAD  CG+TN +A  +  P   D T  S G  H 
Sbjct  69   YTGLKSSNGYSDIRTLLDSD--TSLYGAD--CGYTNPDATAKDPPTTGDATF-SRGMVHV  123

Query  121  GPCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKN  172
            GPCE+WLD   VL +D+C       T +       +DYSSC T  C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  AYSWQIYKACIP  184
               WQ+YK C+P
Sbjct  184  EIVWQVYKDCVP  195

>SPRG_19916
Length=305

 Score = 82.8 bits (203),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 72/138 (52%), Gaps = 26/138 (19%)

Query  61   VEDFN-GWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRS-----  114
            V +FN  ++    +KTLRD +D        G D  CG T  N A + IP   M +     
Sbjct  60   VANFNKAFKAQTQFKTLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  115  --TGY--THDGPCEVWLDTKRVLQSDNCHETISGK---TYNLDYSSCTG-TCTLRWYWLG  166
               G+  +H GPCEVW+D KRV Q+D+C      K      +DYSSC+G  C LR+YWL 
Sbjct  112  TGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLA  171

Query  167  VRYLKNAYSWQIYKACIP  184
            +    +   WQ+YK C+P
Sbjct  172  L----HEPMWQVYKNCVP  185

>PHYCA_12943
Length=287

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 80/179 (45%), Gaps = 32/179 (18%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLEN-----QGYETVEDFNGWRRNNGYKTLRDF  79
            +NAH  +  P  T+       ++  +  ++N      G + V  F    +  G       
Sbjct  22   ANAHGNLKQPEATFKDGAPTVEW--VTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  79

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVL  133
            +D  K       D  CG+T  +  PQPIP DG ++       G+TH GPCE+++D K VL
Sbjct  80   LDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVL  132

Query  134  QSDNCHETISG--------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              D+C +   G           ++D+SSC G CTL  YWL  +  +    WQ Y  C+P
Sbjct  133  HGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVP  187

>SDRG_07565
Length=278

 Score = 82.0 bits (201),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 85/179 (47%), Gaps = 34/179 (19%)

Query  27   AHQVVLLPAPTYTTDNKDTKYA-------PLAFLENQGYETVEDFN-GWRRNNGYKTLRD  78
             H +V  PA  ++ +   T Y        P  F +    E V  F   ++  + +KTLRD
Sbjct  80   GHGIVSNPAAEFSPNVMRTTYVATIQANLPGKF-DGSPQENVAAFTTAFKAQSQFKTLRD  138

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR------STGY--THDGPCEVWLDT  129
             ++             CG +  NA+ + IP DGTM         G+  +H GPCEVWLD 
Sbjct  139  MLEPQGPA--------CGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTGPCEVWLDD  190

Query  130  KRVLQSDNCHETISGKT---YNLDYSSCTGT-CTLRWYWLGVRYLKNAYSWQIYKACIP  184
            KRV Q D+C      K      +DYSSC G+ C LR+YWL +   +    WQ+YK C+P
Sbjct  191  KRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLALHQPQ----WQVYKNCVP  245

>SDRG_08129
Length=218

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 85/179 (47%), Gaps = 34/179 (19%)

Query  27   AHQVVLLPAPTYTTDNKDTKYA-------PLAFLENQGYETVEDF-NGWRRNNGYKTLRD  78
             H +V  PA  ++ +   T Y        P  F +    E V  F + ++  + +KTLRD
Sbjct  18   GHGIVSNPAAEFSPNVMRTTYVATIQANLPGKF-DGSPQENVAAFTSAFKVQSQFKTLRD  76

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR------STGY--THDGPCEVWLDT  129
             ++             CG +  NA+ + IP DG M         G+  +H GPCEVWLD 
Sbjct  77   MLEPQGPA--------CGNSLPNASKKTIPSDGAMTWRNPDTGEGFISSHTGPCEVWLDD  128

Query  130  KRVLQSDNCHETISGKT---YNLDYSSCTG-TCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            KRV Q+D+C      K      +DYSSC G  C LR+YWL +   +    WQ+YK C+P
Sbjct  129  KRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNCVP  183

>PPTG_04647
Length=327

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 69/130 (53%), Gaps = 20/130 (15%)

Query  68   RRNNGYKTLRDFMDRAKYTVTD--GADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGP  122
            + +NGY  +R  +D      TD  GAD  CG+TN +A  +  P   D T  S G  H GP
Sbjct  72   KSSNGYSDIRTLLDSD----TDLYGAD--CGYTNPDATAKDPPTTGDATF-SRGMVHVGP  124

Query  123  CEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAY  174
            CE+WLD   VL +DNC       T +       +DYSSC T  C LR+YWL  + + +  
Sbjct  125  CEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKM  184

Query  175  SWQIYKACIP  184
             WQ+YK C+P
Sbjct  185  VWQVYKDCVP  194

>PHYCA_19598
Length=390

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 85/181 (47%), Gaps = 29/181 (16%)

Query  26   NAHQVVLLPAPTYTTDNKD-TKYAPLAFLENQGYETVEDFNGWRRNN-----------GY  73
            N H  + +P   +T    D T++  +  +++        FNG  ++N            Y
Sbjct  19   NGHGYLTIPKVKFTASAGDPTQF--IGTIQSSASGLPGTFNGAPKDNVAAYTKAFASSKY  76

Query  74   KTLRD-FMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEV  125
            K+L+D F D+AK TV+ GA   CG  +    PQP+P+  +      S G+T  H+GPCEV
Sbjct  77   KSLKDLFTDKAKITVS-GATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCEV  135

Query  126  WLDTKRVLQSDNCHET--ISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            W D  R  Q DNC     +       D  +C G  TL +YW+ +     + +WQ+Y  C 
Sbjct  136  WCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH----SDTWQVYVNCA  191

Query  184  P  184
            P
Sbjct  192  P  192

>PHYRA_86016
Length=236

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 18/107 (17%)

Query  92   DYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVLQSDNCHETISG-  144
            D  CG+T  +  PQPIP DG ++       G+TH GPCE+++D   VL  D+C E   G 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  145  -------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
                       +DYSSC G CTL  YWL     +NA  WQ Y  C+P
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNAQ-WQAYVNCVP  121

>PHYRA_83494
Length=224

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 18/109 (17%)

Query  90   GADYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            G D  CG T+ +AAPQ +P DG  +       G+TH GPCE+++D K VL  DNC +   
Sbjct  18   GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYP  77

Query  144  GKTYN--------LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            G            +DYSSC G CT   YWL     +NA  WQ Y  C+P
Sbjct  78   GGDVGSTVTSDMPVDYSSCNGDCTFTIYWLA---FQNAQ-WQAYVNCVP  122

>PHYRA_78176
Length=312

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 87/178 (49%), Gaps = 28/178 (16%)

Query  28   HQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNN-----------GYKTL  76
            H  +  PA T+ T N  T++  +A +E         FNG   +N            Y +L
Sbjct  25   HGYLSDPAVTFLTTNDPTQF--IATIEATASGFSGTFNGAPADNTAAFTTAFESSSYSSL  82

Query  77   RDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
            ++F+D +A  TVTD A   CG  + +   QP+P+  +      S G+T  H+GPCEVW D
Sbjct  83   KEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASHEGPCEVWCD  141

Query  129  TKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              RV Q D+C    +     L  D+ +C G+  L +YWL +    ++ +WQ+Y  C P
Sbjct  142  DVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLAL----HSSTWQVYVNCAP  195

>PHYSO_524101
Length=308

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 86/180 (48%), Gaps = 28/180 (16%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNN-----------GYK  74
            NAH  +  PA  + T    T++  +A +E         FNG   +N            Y 
Sbjct  22   NAHGYMSDPAVKFLTTGDPTQF--IATIEASASGFSGTFNGAPADNTAAFTTAFESSSYS  79

Query  75   TLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
            +L++ + D+A  TVTD A   CG  + +   QP+PD  +      S G+T  H+GPCEVW
Sbjct  80   SLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCEVW  138

Query  127  LDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             D  RV Q D+C    +     L Y   +C G+ TL +YWL +    ++ +WQ+Y  C P
Sbjct  139  CDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLAL----HSSTWQVYVNCAP  194

>PYIR_24421
Length=213

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 14/133 (11%)

Query  61   VEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-----GTMRST  115
             + F    +++ YK++RD ++ AK +   GA   CG ++ + A QP+P          S 
Sbjct  39   AKAFTAALKSSSYKSVRDLVN-AKASFISGASKECGISSSSGAKQPLPAQYVEWAHSSSE  97

Query  116  GYT--HDGPCEVWLDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLK  171
            G+T  H+GPCEVW D      +DNC +        L Y  S C+G   LR+YW+ +    
Sbjct  98   GFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----  153

Query  172  NAYSWQIYKACIP  184
            ++ +WQ+Y  C P
Sbjct  154  HSSTWQVYINCAP  166

>PPTG_03160
Length=379

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 86/181 (48%), Gaps = 29/181 (16%)

Query  26   NAHQVVLLPAPTYTTDNKD-TKYAPLAFLENQGYETVEDFNGWRRNN-----------GY  73
            N H  +  P   +T    D T++       + G+     FNG  ++N            Y
Sbjct  19   NGHGYMTDPKVKFTAQAGDPTQFIGSIQASDSGFSGT--FNGAPKDNVAAFTKAFTSSKY  76

Query  74   KTLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEV  125
            K+L++++ D+AK  V+ GA   CG  +    PQP+P  T+      S G+T  H+GPCEV
Sbjct  77   KSLKEYVTDKAKIIVS-GATLTCGSCDPKQEPQPMPKSTVEWSHSDSEGFTPSHEGPCEV  135

Query  126  WLDTKRVLQSDNC--HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            W D  R  Q D+C  H T+       D  +C G  TL +YW+ +    ++ SWQ+Y  C 
Sbjct  136  WCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAM----HSSSWQVYVNCA  191

Query  184  P  184
            P
Sbjct  192  P  192

>PHYCA_534473
Length=1050

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTN--VNAAPQPIPDGTMRSTGYTHDGPCEV  125
            + +NGY  +R  +D    + TD     CGFT+  V A   P       S G  H GPCE+
Sbjct  845  KESNGYSDIRTLLD----SDTDLYGANCGFTDPDVTAKDPPTTGDATFSRGMVHAGPCEI  900

Query  126  WLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQ  177
            WLD  +VL +D+C       T         +DYSSC T  C LR+YWL  + + +   WQ
Sbjct  901  WLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIVWQ  960

Query  178  IYKACIP  184
            +YK C+P
Sbjct  961  VYKDCVP  967

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 65/128 (51%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            +++N  K +R  +D        G D  CG T+  A P+  P   D T  S G  H GPCE
Sbjct  540  KKSNNVKDIRTMIDADPKLY--GED--CGNTDPKAKPKDPPSTGDATF-SRGIVHAGPCE  594

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSW  176
            +WLD + VLQ+D+C       T         +DYSSC  G C  R+YWL ++   +   W
Sbjct  595  IWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLW  654

Query  177  QIYKACIP  184
            Q+YK CIP
Sbjct  655  QVYKNCIP  662

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 60/124 (48%), Gaps = 15/124 (12%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGTMR-STGYTHDG  121
            F      N YK +R  MD       D     CGFT+    P  P  DGT   S G  H G
Sbjct  67   FKELAAKNNYKDVRTLMDGNPVYGED-----CGFTDPKGTPVDPPTDGTATFSRGIVHAG  121

Query  122  PCEVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNA  173
            PCE+WLD K VLQ+D+C       T         +DYSSC +G C LR+YWL ++ LK  
Sbjct  122  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGG  181

Query  174  YSWQ  177
             + Q
Sbjct  182  GASQ  185

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 62/120 (52%), Gaps = 14/120 (12%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEV  125
            + +N  K +R  +D    T   GAD  CG+TN +  P+  P DGT   S G  H GPCE+
Sbjct  277  KASNNAKDIRTLLDSD--TKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  332

Query  126  WLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQ  177
            WLD K VL +D+C       T         +DYSSC +G C  R+YWL ++ L    + Q
Sbjct  333  WLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGGGASQ  392

>PYVX_14662
Length=540

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 69/140 (49%), Gaps = 17/140 (12%)

Query  55   NQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR  113
            NQG  +V+ +       G   +R  +D       D     CGFT+ +   Q IP DG   
Sbjct  60   NQG--SVDTYKSLAAEKGVTEIRSLLDDTSIYGQD-----CGFTDPDGTAQDIPTDGKAT  112

Query  114  -STGYTHDGPCEVWLDTKRVLQSDNCHETISG------KTYNLDYSSC-TGTC-TLRWYW  164
             S G  H GPCE+WLD   VL  D+C+ T  G        + +DYSSC +G C  +R+YW
Sbjct  113  FSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYW  172

Query  165  LGVRYLKNAYSWQIYKACIP  184
            L  + +     WQ+YK CIP
Sbjct  173  LAFQGVDGDTVWQVYKNCIP  192

>PHYKE_2937
Length=366

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (55%), Gaps = 16/128 (13%)

Query  68   RRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPCE  124
            + +NGY  +R  +D    T   GAD  CG+TN +A  +  P   D T  S G  H GPCE
Sbjct  77   KSSNGYSDIRTLLDSD--TSLYGAD--CGYTNPDATAKDPPTTGDATF-SRGMVHVGPCE  131

Query  125  VWLDTKRVLQSDNCHETISGKTYN-------LDYSSCTGT-CTLRWYWLGVRYLKNAYSW  176
            +WLD   VL +D+C       T +       +DYSSC+ + C LR+YWL  + + ++  W
Sbjct  132  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  191

Query  177  QIYKACIP  184
            Q+YK C+P
Sbjct  192  QVYKDCVP  199

>SPRG_22161
Length=300

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 70/138 (51%), Gaps = 26/138 (19%)

Query  61   VEDFN-GWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRS-----  114
            V +FN  ++    +KTLRD +D        G D  CG T  N A + IP   M +     
Sbjct  60   VANFNKAFKAQTQFKTLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  115  --TGY--THDGPCEVWLDTKRVLQSDNCHETISGK---TYNLDYSSCTGT-CTLRWYWLG  166
               G+  +H GPCEVW+D KRV Q+D+C      K      +DYSSC    C LR+YWL 
Sbjct  112  TGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLA  171

Query  167  VRYLKNAYSWQIYKACIP  184
            +    +   WQ+YK C+P
Sbjct  172  L----HEPMWQVYKNCVP  185

>PHYRA_86752
Length=300

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 56/107 (52%), Gaps = 18/107 (17%)

Query  92   DYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVLQSDNCHETISG-  144
            D  CG+T  +  PQPIP DG ++       G+TH GPCE+++D   VL  D+C E   G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
                       +DYSSC G CTL  YWL     +NA  WQ Y  C+P
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNAQ-WQAYVNCVP  185

>PYIW_24288
Length=201

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 14/123 (11%)

Query  71   NGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-------DGTMRSTGYTHDGPC  123
            N Y+ LR+ +D      + GAD  CGFT+   A QP+P       +   +    TH+GPC
Sbjct  83   NRYRNLRELVDFTA-VFSAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPC  141

Query  124  EVWLDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKA  181
            EVW D +   +  NC +   G    L Y  S CTG   L++YWL +    ++  W++Y  
Sbjct  142  EVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYIN  197

Query  182  CIP  184
            C+P
Sbjct  198  CVP  200

>PHYRA_79140
Length=424

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 90/185 (49%), Gaps = 44/185 (24%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNG------YKTLRD  78
            +NAH  +  P P++T+ +            N G+ T+ D N W   +G      YKT+  
Sbjct  20   ANAHGYLEEPKPSWTSGSA-----------NPGWITMVD-NYWDIGSGGDQCGLYKTM--  65

Query  79   FMDRAKYTVTDGA-----DYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWL  127
                 K TV D          CG T+ +A+PQPIP DG  +       G+TH GPCE++L
Sbjct  66   -AAEKKMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYL  124

Query  128  DTKRVLQSDNCHETISG------KTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179
            D   VL SDNC +   G      +T ++  DYSSC G CTL  YWL     +NA  WQ Y
Sbjct  125  DDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLA---FQNAQ-WQAY  180

Query  180  KACIP  184
              C+P
Sbjct  181  VNCVP  185

>PITG_04947
Length=298

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 66/129 (51%), Gaps = 18/129 (14%)

Query  68   RRNNGYKTLRDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPC  123
            +++N  K +R  +D  AK    D     CG T+  A P+  P   D T  S G  H GPC
Sbjct  46   KKSNNIKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPTTGDATF-SRGIVHAGPC  99

Query  124  EVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYS  175
            E+WLD + VLQ+D+C       T         +DYSSC +G C  R+YWL ++       
Sbjct  100  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTL  159

Query  176  WQIYKACIP  184
            WQ+YK CIP
Sbjct  160  WQVYKNCIP  168

>PYU1_G001525
Length=312

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 79/177 (45%), Gaps = 21/177 (12%)

Query  24   TSNAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLENQGYETVEDFNGWRRN  70
            T++AH  + LP PT+           T D       P  ++F  +    T      ++  
Sbjct  16   TADAHSKMALPKPTWNPVWGTNSPSGTIDGPKALTVPGGMSFGTDPTSNTKAFTAAFKAQ  75

Query  71   NGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTM-RSTGYTHDGPCEVWLDT  129
              YK+L+D +  A  TV  G    CGF+ V+  PQP+PD         +H+GPCE+W D 
Sbjct  76   TKYKSLKDLV-FATQTVESGTTKECGFSLVSGTPQPLPDVVEWDELTPSHEGPCEIWCDN  134

Query  130  KRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            K    ++NC +   G    L  D S CTG   L   WL +    +  +WQ+Y  C P
Sbjct  135  KLAFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLAL----HTPTWQVYTNCAP  187

>PPTG_04620
Length=342

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 67/129 (52%), Gaps = 18/129 (14%)

Query  68   RRNNGYKTLRDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIP---DGTMRSTGYTHDGPC  123
            +++N  K +R  +D  AK    D     CG T+  A P+  P   D T  S G  H GPC
Sbjct  73   KKSNNVKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPSTGDATF-SRGIVHAGPC  126

Query  124  EVWLDTKRVLQSDNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYS  175
            E+WLD + VLQ+D+C       T         +DYSSC +G C  R+YWL ++   +   
Sbjct  127  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTL  186

Query  176  WQIYKACIP  184
            WQ+YK CIP
Sbjct  187  WQVYKNCIP  195

>PPTG_07520
Length=294

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 64/142 (45%), Gaps = 25/142 (18%)

Query  57   GYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR--  113
            G + +  F    +  G       +D  K       D  CG T  N  PQPIP DG ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDTKRVLQSDNCHETISG--------KTYNLDYSSCTGTCTLRW  162
                 G+TH GPCE++LD K VL  D+C +   G            +D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGVRYLKNAYSWQIYKACIP  184
            YWL     +NA  WQ Y  C+P
Sbjct  166  YWLA---FQNAQ-WQTYVNCVP  183

>PPTG_07516
Length=294

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 67/142 (47%), Gaps = 25/142 (18%)

Query  57   GYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR--  113
            G + +  F    +  G       +D  K       D  CG T  N  PQPIP DG ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDTKRVLQSDNCHETISG------KTYNL--DYSSCTGTCTLRW  162
                 G+TH GPCE++LD K VL  D+C +   G      +T ++  D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGVRYLKNAYSWQIYKACIP  184
            YWL     +NA  WQ Y  C+P
Sbjct  166  YWLA---FQNAQ-WQTYVNCVP  183

>PPTG_03139
Length=320

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 64/129 (50%), Gaps = 13/129 (10%)

Query  63   DFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-------GTMRST  115
            +FN     + Y +L++FM      V+      CG+TN +  PQP+P+       G+    
Sbjct  68   NFNKGFAASKYSSLKEFMTDKMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGF  127

Query  116  GYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNA  173
              +H+GPCEVW D  RV Q DNC +        L  D+ +C G+  L  YW+ +    ++
Sbjct  128  TASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HS  183

Query  174  YSWQIYKAC  182
             SWQ+Y  C
Sbjct  184  PSWQVYINC  192

>PPTG_03138
Length=294

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 88/179 (49%), Gaps = 28/179 (16%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNN-----------GYKT  75
            AH  +  PA T+ T N  T++  +A +E+        FNG   +N            + +
Sbjct  23   AHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGTFNGAPADNTAAFTKAFESSSFSS  80

Query  76   LRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
            L++ + ++A  TV+D A   CG  + +   QP+PD  +      S G+T  H+GPCE+W 
Sbjct  81   LKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCEIWC  139

Query  128  DTKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D  RV Q D+C    +     L  D+ +C G+  L +YWL +    ++ +WQ+Y  C P
Sbjct  140  DDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLAL----HSSTWQVYVNCAP  194

>PHYRA_78161
Length=373

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 84/181 (46%), Gaps = 29/181 (16%)

Query  26   NAHQVVLLPAPTYTTDNKD-TKYAPLAFLENQGYETVEDFNGWRRNN-----------GY  73
            N H  +  P  T+T    D T+Y  +A +E+        FNG   +N            Y
Sbjct  19   NGHGYMTDPKVTFTAQAGDPTQY--IATIESTASGLTGTFNGAPSDNVAAFTKAFGSSKY  76

Query  74   KTLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEV  125
             +L++F+ D+A  TVT GA   CG  +     QP+P  TM      S G+T  H+GPCEV
Sbjct  77   SSLKEFINDKATVTVT-GATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCEV  135

Query  126  WLDTKRVLQSDNCHET--ISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            W D  R  Q D+C     +       D  +C G+ TL +YW+ +     + +WQ+Y  C 
Sbjct  136  WCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH----SSTWQVYVNCA  191

Query  184  P  184
            P
Sbjct  192  P  192

>PPTG_03156
Length=445

 Score = 80.5 bits (197),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 87/179 (49%), Gaps = 26/179 (15%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLE--NQGY---------ETVEDFNGWRRNNGYK  74
            +AH  +  PA T++ +  D K   +A +E  + G+         + V  F      + YK
Sbjct  19   SAHGWLSKPAATFSNEAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFATSTYK  77

Query  75   TLRDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIPDGT----MRSTGYT--HDGPCEVWL  127
            +L+ F+D +AK TVT GA   CG    +A  QP+PD        S G+T  H+GPCE W 
Sbjct  78   SLKAFIDDKAKITVT-GATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAWC  136

Query  128  DTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D++RV   +NC          + Y  S C+G  TL +YW+ +       +WQ+Y  C P
Sbjct  137  DSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMH----GPTWQVYVNCAP  191

>PYU1_G005871
Length=284

 Score = 79.3 bits (194),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 79/179 (44%), Gaps = 34/179 (19%)

Query  27   AHQVVLLPAPTYTTDNKDTKY-APLAFLENQGY----------ETVEDFNGWRRNNGYKT  75
            AH  V  P  TY   +  T Y A +    N+G+          +  + F       GYK+
Sbjct  23   AHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYKS  82

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-GTMR------STGY--THDGPCEVW  126
            L+  MD+A           CG++N NAAP  +     M+        G+  +H GPCE W
Sbjct  83   LKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEGW  134

Query  127  LDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            +D  RV   D+C     G   T  + Y SC GTC L +YWL +   K    WQ YK+C+
Sbjct  135  IDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

>PHALS_04411
Length=262

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 81/177 (46%), Gaps = 22/177 (12%)

Query  25   SNAHQVVLLPAPTYTTDNKD---TKYAPL---AFLENQGYE-TVEDFNGWRRNNGYKTLR  77
            + AH  +  P PT+ +   +    +  PL    + +++G E  +  F      N YK +R
Sbjct  21   AQAHGYIAKPPPTWKSKETNKWVVEIKPLWDGPWDKSKGDEGLLSTFKELAAKNNYKNVR  80

Query  78   DFMDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGTMR-STGYTHDGPCEVWLDTKRVLQS  135
              MD       D     CGFT+    P  P  DGT   S G  H GPCE+W + K +LQ+
Sbjct  81   TLMDGNPAFGED-----CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMILQN  135

Query  136  DNCHETISGKTYN-------LDYSSC-TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D+C       T         + YS C +G   LR+YWL ++ L+    WQ YK CIP
Sbjct  136  DDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIP  192

>PYIW_25463
Length=216

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 82/179 (46%), Gaps = 26/179 (15%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKY-APLAFLENQGY----------ETVEDFNGWRRNNG  72
            ++ AH  V  P   YT     T + A      N+G+          + V+ F       G
Sbjct  19   SAEAHGFVSQPKAQYTGGGSYTSFSAEFTASVNKGFSGYIFNRSPEQNVQQFTAAWSKTG  78

Query  73   YKTLRDFMDRA----KYTVTD-GADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWL  127
            YK+L++ MD+      ++ TD  A    G +++        +G + S    H GPCE W+
Sbjct  79   YKSLKELMDKQVPGCGFSRTDIAAVDVSGMSSMKFQNNEYKEGFLGS----HHGPCEGWI  134

Query  128  DTKRVLQSDNCHETISGKTYN--LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D  +V  SD+C ++  G   N  + Y++C GTC L +YWL +   K    WQ YK C+P
Sbjct  135  DNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQK----WQAYKHCVP  189

>PHYCA_69583
Length=224

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 55/102 (54%), Gaps = 12/102 (12%)

Query  95   CGFTNVNA-APQPIPDGTMR-STGYTHDGPCEVWLDTKRVLQSDNCHETISGKTY-----  147
            CGF+N +A A  P  DGT     G  H GPCE+WLD   VL +D+C +  S   Y     
Sbjct  96   CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKS  155

Query  148  ---NLDYSSCTGT-CTLRWYWLGVR-YLKNAYSWQIYKACIP  184
                +DYSSC+ + C  R+YWL  +      Y WQIYK CIP
Sbjct  156  VFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIP  197

>PYU1_G005872
Length=297

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 79/179 (44%), Gaps = 34/179 (19%)

Query  27   AHQVVLLPAPTYTTDNKDTKY-APLAFLENQGY----------ETVEDFNGWRRNNGYKT  75
            AH  V  P  TY   +  T Y A +    N+G+          +  + F       GYK+
Sbjct  23   AHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYKS  82

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-GTMR------STGY--THDGPCEVW  126
            L+  MD+A           CG++N NAAP  +     M+        G+  +H GPCE W
Sbjct  83   LKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEGW  134

Query  127  LDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            +D  RV   D+C     G   T  + Y SC GTC L +YWL +   K    WQ YK+C+
Sbjct  135  IDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

>SDRG_17318
Length=241

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 82/176 (47%), Gaps = 30/176 (17%)

Query  28   HQVVLLPAPTYTTDNKDTKYAP--LAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  85
            H +V  P   +  D   T Y     AFL  +       FNG  R+N     + F  ++KY
Sbjct  21   HGIVSNPFAEFKADVMHTTYVAEIQAFLPGK-------FNGSPRDNAVNFNKAFKAQSKY  73

Query  86   ----TVTDGADYYCGFTNVNAAPQPIP-DGTMR------STGY--THDGPCEVWLDTKRV  132
                 + D     CG T  N A + IP +G M         G+  +H GPCEVWLD KRV
Sbjct  74   KTLRAMLDPHGPDCGNTLTNVARKEIPSNGKMTFQNPDTGEGFIPSHTGPCEVWLDNKRV  133

Query  133  LQSDNCHETISGK---TYNLDYSSCTGT-CTLRWYWLGVRYLKNAYSWQIYKACIP  184
             Q+D+C      K      +DYSSC    C LR+YW+ +    ++  WQ+YK C+P
Sbjct  134  FQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIAL----HSPRWQVYKNCVP  185

>PYAR_20617
Length=254

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 65/130 (50%), Gaps = 13/130 (10%)

Query  58   YETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY  117
            ++T   +    +  G   LR F++  K  V       CG +  +A P+ IP     S   
Sbjct  55   FKTGAQYAAKAKAEGIPDLRTFLED-KGPV-------CGNSLKDATPKAIPASGKISLAS  106

Query  118  T--HDGPCEVWLDTKRVLQSDNCHETI-SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAY  174
            T  H GPCEVW D       D+C +T  S  ++ +D+S C+G+C LR+YWLG++      
Sbjct  107  TIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGK  164

Query  175  SWQIYKACIP  184
             WQ YK C+P
Sbjct  165  RWQSYKNCVP  174

>PPTG_18166
Length=445

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 59/107 (55%), Gaps = 18/107 (17%)

Query  92   DYYCGFTNVNAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDTKRVLQSDNCHE-----  140
            D  CG T  N +P+PIP DG +     R  G+TH GPCE++LD K VL  D+C E     
Sbjct  81   DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGG  140

Query  141  ---TISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
               + SG    +D+SSC G CTL  YWL     +NA  WQ Y  C+P
Sbjct  141  SDGSSSGSEMPVDFSSCNGKCTLTIYWLA---FQNAQ-WQTYVNCVP  183

>PHALS_05394
Length=288

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 63/123 (51%), Gaps = 15/123 (12%)

Query  71   NGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAP-QPIPDGTMR-STGYTHDGPCEVWLD  128
            N +K+ R  MD        GAD  CG+T+ N  P  P  DGT   S    H G CE+W++
Sbjct  76   NNFKSARSLMDGNPVY---GAD--CGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWIN  130

Query  129  TKRVLQSDNCHETISGKTYN-------LDYSSCTG-TCTLRWYWLGVRYLKNAYSWQIYK  180
             K VLQ+D+C      K          +DYSSC G  C LR+YWL ++ + +   WQ YK
Sbjct  131  KKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYK  190

Query  181  ACI  183
             CI
Sbjct  191  NCI  193

>SPRG_19917
Length=241

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 81/176 (46%), Gaps = 30/176 (17%)

Query  28   HQVVLLPAPTYTTDNKDTKYAP--LAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  85
            H +V  P   +  +   T Y     AFL  +       FNG  +NN     + F  ++KY
Sbjct  21   HGIVSNPFAEFKANVMHTTYVAEIQAFLPGK-------FNGSPQNNAANFNKAFKAQSKY  73

Query  86   ----TVTDGADYYCGFTNVNAAPQPIP-DGTMR----STG----YTHDGPCEVWLDTKRV  132
                 + D     CG T  N A + IP +G M      TG     +H GPCEVWLD KRV
Sbjct  74   KTLRALLDQHGPDCGNTLTNVARKEIPSNGKMTFQNPDTGEGFILSHTGPCEVWLDNKRV  133

Query  133  LQSDNCHETISGK---TYNLDYSSCTGT-CTLRWYWLGVRYLKNAYSWQIYKACIP  184
             Q+D+C      K      +DYSSC    C LR+YW+ +   +    WQ+YK C+P
Sbjct  134  FQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIALHSPR----WQVYKNCVP  185

>PHYRA_83500
Length=394

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (57%), Gaps = 18/104 (17%)

Query  95   CGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVLQSDNCHETISG----  144
            CG T+ +A+PQPIP DG  +       G+TH GPCE++LD   VL SDNC +   G    
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  --KTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              +T ++  DYSSC G CTL  YWL     +NA  WQ Y  C P
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLA---FQNAQ-WQAYVNCAP  185

>PHYSO_318683
Length=352

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGY-----------ETVEDFNGWRRNNGYK  74
            NAH  + LPA T+  D   T++  +A +E+              E    F     ++ Y 
Sbjct  17   NAHGYLGLPAVTFPNDVDKTQF--IATIESSASGFSGSFSGSPAENTAAFWTAFNSSQYS  74

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
            ++++F+      V +GA+  CG T+ +  PQP+PD        + G+T  H+GPCE W D
Sbjct  75   SIKEFVTDLGQIVANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCEAWCD  134

Query  129  TKRVLQSDNC--HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
              RV Q  +C  H T +      D + C+G   L +YWL +     + +WQ+Y  C
Sbjct  135  NTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDC  186

>PYAP_18713
Length=184

 Score = 75.5 bits (184),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 14/119 (12%)

Query  69   RNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGT--MRSTGYTHDGPCEVW  126
            ++ G+K LR F++             CG TN NA P+ +P  +  + S    H GPCE+W
Sbjct  68   KDKGFKDLRSFLEDKGPA--------CGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCELW  119

Query  127  LDTKRVLQSDNCHETISGKT--YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            +D   V  +D+C      K   + +D+SSC G C LR+YWLG++   +   WQ Y   I
Sbjct  120  IDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSYSTYI  176

>PHYSO_324715
Length=274

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 82/172 (48%), Gaps = 33/172 (19%)

Query  24   TSNAHQVVLLPAPTYTTDNK-DTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR  82
            T   H  +L+P     +D+K D   +     + +GYE          NN    +R  +D 
Sbjct  33   TVQGHGYMLVPEAVPLSDHKKDNMISSWIKAKAEGYE----------NN----IRKLLDG  78

Query  83   AKYTVTDGADYYCGFTNVNAAPQ-PIPDGTMR-STGYTHDGPCEVWLDTKRVLQSDNCHE  140
               T   GAD  CG+++ NA+P+ P  DGT   S G  H GPCE+WLD K +L  D+C E
Sbjct  79   D--TKLYGAD--CGYSDPNASPKDPSTDGTATFSRGIAHHGPCEIWLDDKMILHDDDCEE  134

Query  141  TISGKTYN--------LDYSSCTGT-CTLRWYWL---GVRYLKNAYSWQIYK  180
            T     Y         +DYSSC+   C L +YWL   G     + Y WQIYK
Sbjct  135  TFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNSKYVWQIYK  186

>PHYKE_8390
Length=130

 Score = 74.3 bits (181),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 2/97 (2%)

Query  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFM-DRAKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  ++GY +LR  + D A Y V
Sbjct  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90

Query  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPC  123
            T+ A + CG T+     Q IP + T +++GYT DGPC
Sbjct  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PHYCA_18657
Length=295

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 55/109 (50%), Gaps = 18/109 (17%)

Query  90   GADYYCGFTNVNAAPQPIPDGTMR------STGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            G D  CGFT  +  P+P+P             G+TH GPCE+++D K VL SD+C     
Sbjct  167  GNDKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYP  226

Query  144  GKTYN--------LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            G   +        +DYSSC G CT   YWLG    +NA  WQ Y  C+P
Sbjct  227  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-QWQAYINCVP  271

>PYU1_G005873
Length=214

 Score = 76.3 bits (186),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 78/182 (43%), Gaps = 38/182 (21%)

Query  27   AHQVVLLPAPTYTTDNKDTKY-APLAFLENQGY----------ETVEDFNGWRRNNGYKT  75
            AH  +  P   YT  +  T Y A +    N+G+          +  + F       GYK+
Sbjct  23   AHGYISQPKAQYTGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYKS  82

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY-----------THDGPCE  124
            L+  MD+A      G    CG++  + AP  +    M S  +           +H GPCE
Sbjct  83   LKQMMDKA----VPG----CGYSRTDIAPVDV--SRMSSMKFQNNEYKEGFLASHHGPCE  132

Query  125  VWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
             W+D  RV   D+C     G   T  + + +C GTC L +YWL +   K    WQ YK+C
Sbjct  133  GWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSPK----WQAYKSC  188

Query  183  IP  184
            +P
Sbjct  189  VP  190

>PHYKE_1913
Length=280

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 79/179 (44%), Gaps = 32/179 (18%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLEN-----QGYETVEDFNGWRRNNGYKTLRDF  79
            ++AH  +  P PT+       ++  +  +EN      G + V  +       G       
Sbjct  20   ADAHGHLKSPEPTFEDGAPTVEW--VTLIENYWDIGSGGDQVGKYKTMAAEKGMSVKDVV  77

Query  80   MDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDTKRVL  133
            +D  K       D  CG+T  +A P+P+P DG          G+TH GPCEV+++ K VL
Sbjct  78   LDMVK-------DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVL  130

Query  134  QSDNCHETISG--------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
              D+C +   G            +DYSSC G CTL  YWL     +NA  WQ Y  C+P
Sbjct  131  HGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLA---FQNA-QWQAYINCVP  185

>PITG_08202
Length=191

 Score = 75.5 bits (184),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 64/125 (51%), Gaps = 19/125 (15%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STG  116
            ++V+ F   +  N +K LR  MD    T   GAD  CGFTN N  PQPIP DG    S  
Sbjct  62   KSVDTFKSLKAANNFKDLRTLMDD---TSVYGAD--CGFTNPNDTPQPIPSDGKATFSRA  116

Query  117  YTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCT-GTCT-LRWYWLGVRYLKNAY  174
              H GPC +WLD K  ++S           + +DYSSC+ G C  +R+YWL  + L    
Sbjct  117  LVHHGPCGIWLDDKMDIKS----------IFPVDYSSCSNGGCKQMRFYWLAFQGLNKKT  166

Query  175  SWQIY  179
             WQ Y
Sbjct  167  VWQSY  171

>PHYCA_19612
Length=610

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 88/181 (49%), Gaps = 29/181 (16%)

Query  26   NAHQVVLLPAPTYTTDNKD-TKYAPLAFLENQGYETVEDFNGWRRNN-----------GY  73
            N H  +  PA T+ + + D T++  +A +E+   +    F+G   +N            Y
Sbjct  24   NGHGYMTEPAVTFLSSSTDNTQF--IATIESSASKFSGTFSGSPADNTAAFTKAFASSSY  81

Query  74   KTLRDFMDR-AKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEV  125
             +L+D +   A  TVTD A   CG  N +   QP+PD  +      + G+T  H+GPCEV
Sbjct  82   TSLKDLITSLATVTVTD-ATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPCEV  140

Query  126  WLDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            W D  RV Q D+C    +     L Y   +C GT TL +YWL +    ++ +WQ+Y  C 
Sbjct  141  WCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYVNCA  196

Query  184  P  184
            P
Sbjct  197  P  197

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 85/182 (47%), Gaps = 28/182 (15%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGY-----------ETVEDFNGWRRNNG  72
            T NAH  +  PA  + T N  T++  +A +E               +    F     ++ 
Sbjct  325  TRNAHGYMSDPAVKFLTTNDPTQF--IATIEASASGFSGSFSGSPADNTAAFTTAFESSS  382

Query  73   YKTLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCE  124
            Y +L++ + D+A  TVTD A   CG  + +   Q +P   +      S G+T  H+GPCE
Sbjct  383  YSSLKELINDKATITVTD-ATLTCGACDPDETAQALPATYVEWAHSDSEGFTASHEGPCE  441

Query  125  VWLDTKRVLQSDNCHE--TISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
            VW D  RV Q D+C    T +      D+ +C G+  L +YWL +    ++ +WQ+Y  C
Sbjct  442  VWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLAL----HSSTWQVYVNC  497

Query  183  IP  184
             P
Sbjct  498  AP  499

>PYVX_20783
Length=276

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 84/175 (48%), Gaps = 29/175 (17%)

Query  25   SNAHQVVLLPAPTYTTDNKDTKYAPLAFLE----------NQGYETVEDFNGWRRNNGYK  74
            ++ H  +++P PT  +D+      P   ++             Y+ V+D   W   NG  
Sbjct  20   ASGHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDD---WFTANGIS  76

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR--STGYTHDGPCEVWLDTKR  131
            +L+      +Y  T G+   CG T  +  PQP+P DG  +  + G +H GPCE+W D  R
Sbjct  77   SLK------EYITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTR  130

Query  132  VLQSDNCHETISGKT---YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            V  S NC    SG++     +D ++CTG+    +YWL +    +A  WQ+Y  C+
Sbjct  131  VFTSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLAL----HAQPWQVYINCV  181

>PHYRA_80750
Length=275

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 65/130 (50%), Gaps = 15/130 (12%)

Query  60   TVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGY  117
            +V+ F   +  N +  L+  MD    T T GAD  CGFT+ +  PQPIP DG    S   
Sbjct  62   SVDAFKALKTANNFVDLKTLMDD---TATFGAD--CGFTDPSGTPQPIPSDGKATFSRAI  116

Query  118  THDGPCEVWLDTKRVLQSDNCHETISGK------TYNLDYSSCTGTC--TLRWYWLGVRY  169
             H GPCE+WLD K+V   D+C  T   +       + +DYS C G     +R+YWL  + 
Sbjct  117  VHVGPCEIWLDDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQG  176

Query  170  LKNAYSWQIY  179
            +     WQ Y
Sbjct  177  VDGKTVWQSY  186

>PYAP_18221
Length=226

 Score = 76.3 bits (186),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 23/137 (17%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD---GTMRST  115
            +  + F    + +G K+LR+ MD  KY         CG TN N  P+ +      T ++ 
Sbjct  67   QNTQVFTDAFKQSGLKSLRELMD--KYVPG------CGNTNPNTTPRDVTKLKTMTYQNN  118

Query  116  GY------THDGPCEVWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGV  167
             Y      +H GPCEVW+D  RV Q+++C            +DYS C GTC L +YWL +
Sbjct  119  EYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAALPVDYSKCKGTCRLTFYWLAL  178

Query  168  RYLKNAYSWQIYKACIP  184
               K    WQ YK C+P
Sbjct  179  HSQK----WQAYKQCVP  191

>PHYSO_255056
Length=269

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 55/98 (56%), Gaps = 10/98 (10%)

Query  90   GADYYCGFTNVNAAPQ-PIPDGTMR-STGYTHDGPCEVWLDTKRVLQSDNCHETISGKTY  147
            GAD  CGF+N +A P+ P  DGT     G  H GPCE+WLD   VL +D+C +  S +  
Sbjct  94   GAD--CGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVE--  149

Query  148  NLDYSSCTGTCTLRWYWLGVR-YLKNAYSWQIYKACIP  184
              DY S  G C  R+YWL  +      Y WQIYK CIP
Sbjct  150  --DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIP  184

>PYAP_18138
Length=268

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 66/116 (57%), Gaps = 16/116 (14%)

Query  69   RNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP--DGTMRSTGYTHDGPCEVW  126
            + +G K LR ++D AK T        CG +  + +P+PIP  +        TH GPCE W
Sbjct  80   KQHGVKDLRSYID-AKIT-------ECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFW  131

Query  127  LDTKRVLQSDNCHETISGK-TYNLDYSSCTG-TCTLRWYWLGVRYLKNAYSWQIYK  180
            +D  RV Q+++C      K T  LDYS CTG TC LR+YWLG   L+N+  WQ+Y+
Sbjct  132  IDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLG---LQNS-DWQVYR  183

>SPRG_07796
Length=322

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query  25   SNAHQVVLLPAPTYTTDNKD-TKYAPL----------AFLENQGYETVEDFNGWRRNNGY  73
            ++ H  ++ P PT+   N D TKY             ++ ++  + T++ F    + + +
Sbjct  16   ADGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQ-FTTQFKASPF  74

Query  74   KTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY-----THDGPCEVWLD  128
            +TL  F+D             CG TN   A QP+P     + G      +H+GPCEVW D
Sbjct  75   RTLAAFVDSQNVASCG----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCD  130

Query  129  TKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            + RV Q+DNC         ++D + C G   LR  WL +    +  SWQ+Y  C+P
Sbjct  131  STRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVP  182

>SDRG_17317
Length=122

 Score = 73.6 bits (179),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 57/103 (55%), Gaps = 17/103 (17%)

Query  95   CGFTNVNAAPQPIP-DGTMR------STGY--THDGPCEVWLDTKRVLQSDNCHETISGK  145
            CG T    A + IP DGTM         G+  +H GPCEVWLD KRV Q+D+C      K
Sbjct  9    CGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPAK  68

Query  146  T---YNLDYSSCTGT-CTLRWYWLGVRYLKNAYSWQIYKACIP  184
                  +DYSSC+G  C LR+YWL +    +   WQ+YK C+P
Sbjct  69   PAAHLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKNCVP  107

>PYU1_G005985
Length=200

 Score = 75.1 bits (183),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 76/180 (42%), Gaps = 34/180 (19%)

Query  27   AHQVVLLPAPTYTTDNKDTKYAP-LAFLENQGY----------ETVEDFNGWRRNNGYKT  75
            AH  + +P  TY  D   T +   L    N  +          E  + F       GY +
Sbjct  23   AHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKWDGSPQENTQQFTSGFHAAGYSS  82

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---------DGTMRSTGYTHDGPCEVW  126
            L+  +D     V  G    CG + V+  P  +          D        +H GPCEVW
Sbjct  83   LKALLD----PVAPG----CGNSRVDVPPVGVSRLAAMEFRNDEFHEGFVNSHHGPCEVW  134

Query  127  LDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +D KR+   D+C    +G   T  +++S C G CTL +YWL +    +  +WQ+YK C+P
Sbjct  135  IDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL----HEPTWQVYKQCVP  190

>HYAP_11923
Length=606

 Score = 78.2 bits (191),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 76/176 (43%), Gaps = 25/176 (14%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNG-----------YK  74
            NAH     PA T+      T++  +A +E+        F G   +N            + 
Sbjct  23   NAHGYCSRPAVTFPNGGDTTQF--VATIESSASGLPGVFTGSPADNAAAFWTAFGSSKFS  80

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD----GTMRSTGYT--HDGPCEVWLD  128
            +++D        V  GA   CG T+ N  PQPIPD        + G+T  H+GPCE W D
Sbjct  81   SIKDLATSLGQIVAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCD  140

Query  129  TKRVLQSDNC--HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
              +V Q +NC  H T +      D + C+G     +YWL +     + +WQ+Y  C
Sbjct  141  DTQVFQDENCAAHFTTAPAKMPYDKAKCSGASRFTFYWLALH----SSTWQVYVNC  192

>H257_11271
Length=372

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 78/175 (45%), Gaps = 26/175 (15%)

Query  26   NAHQVVLLPAPTYTTDNKDTK----------YAPLAFLENQGYETVEDFNGWRRNNGYKT  75
            ++H  +L P PT+ T   DT             P A       +    F    + + +KT
Sbjct  18   HSHGALLDPLPTWNTPYSDTSQFCGTMEGPSVLPGAAYNTSPQDNAAAFTRQFQASSFKT  77

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPI-PDGTMR----STGY--THDGPCEVWLD  128
            LRD +     T        CG TN N  P+ I  DGT++    S G+  +H+GPCEVW D
Sbjct  78   LRDLVLANPSTCGS-----CGITNPNGTPRQINADGTVKWAHGSEGFISSHEGPCEVWCD  132

Query  129  TKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            T RV Q+DNC    +     +D + C     L  YWL +    +  +WQIY  C+
Sbjct  133  TDRVFQNDNCARNAANGIVKIDVAKCKRAIHLVVYWLAL----HVPTWQIYLNCV  183

>PYIR_25999
Length=344

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 77/177 (44%), Gaps = 25/177 (14%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYA----PLAFLENQGYETVED-------FNGWRRNNGYK  74
            +AH  + +P PT+T     T++A      A     G     D       F    + + YK
Sbjct  25   DAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESNTKAFTAAIKTSAYK  84

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
            ++RD ++ AK  +  GA   CG T+    PQP+P   +      S G+T  H GPCEVW 
Sbjct  85   SVRDLIN-AKGVMMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSHQGPCEVWC  143

Query  128  DTKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
            D      +DNC +        L  D+S C G   L   WL +    ++ +WQ Y  C
Sbjct  144  DDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLAL----HSPTWQAYINC  196

>PYAP_22257
Length=247

 Score = 75.9 bits (185),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (49%), Gaps = 22/129 (17%)

Query  67   WRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-------DGTMRSTGY--  117
            ++    +KTL+D +++            CG ++    PQ +        + T   TG+  
Sbjct  65   FKSQKTFKTLKDMVEKQ-------LKGSCGKSSGKGKPQSVEGLSDVHWENTEEKTGFVS  117

Query  118  THDGPCEVWLDTKRVLQSDNCHETISG--KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYS  175
            +H GPCE+W+D  RV+  DNC     G      ++YS C G C LR+YWL +    +   
Sbjct  118  SHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLAL----HEPE  173

Query  176  WQIYKACIP  184
            WQ+YK C+P
Sbjct  174  WQVYKNCVP  182

>PYIR_22134
Length=300

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 78/180 (43%), Gaps = 26/180 (14%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYA-----PLAFLENQGYETVED-------FNGWRRNNGY  73
            +AH  + +P PT+T     T+++     P       G     D       F    + + Y
Sbjct  27   DAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTY  86

Query  74   KTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
             ++R  ++ AK     GA   CG T+     QP+P   +      S G+T  H GPCEVW
Sbjct  87   DSVRALVE-AKGVFISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVW  145

Query  127  LDTKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
             D  +V   +NC +        L  D++ C GT  L+  WL +    ++ +WQIY  C P
Sbjct  146  CDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIYINCAP  201

>SPRG_07825
Length=337

 Score = 77.0 bits (188),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 78/175 (45%), Gaps = 26/175 (15%)

Query  27   AHQVVLLPAPTYTTDNKD-----------TKYAPLAFLENQGYETVEDFNGWRRNNGYKT  75
            AH  +  P PT+   N D           T     A+ ++ GY   + F    + + YKT
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNAAQ-FAANFKTSKYKT  77

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAA-PQPIPD------GTMRSTGYTHDGPCEVWLD  128
            L+ F+D    +   G    CG T V+AA PQP+P       G       +H+GPCE+W D
Sbjct  78   LKAFLDAWDTSAQCGQ---CGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  134

Query  129  TKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
              RV  +D+C + I   +  +D S C G   L   W+ +   +    WQ YK C+
Sbjct  135  ETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCV  185

>PHYKE_6077
Length=322

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 60/129 (47%), Gaps = 13/129 (10%)

Query  63   DFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-------GTMRST  115
            +FN     + Y +L++FM       +      CG+TN   A QP+P+       G+    
Sbjct  68   NFNKGMAASKYTSLKEFMAAKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGF  127

Query  116  GYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNA  173
              +H+GPCEVW D  RV Q DNC          L Y   +C G+  L  YW+ +    ++
Sbjct  128  TSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL----HS  183

Query  174  YSWQIYKAC  182
             SWQ+Y  C
Sbjct  184  PSWQVYINC  192

>PYIR_25334
Length=272

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 69/155 (45%), Gaps = 9/155 (6%)

Query  35   APTYTTDNKDTKYAP--LAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTVTDGAD  92
            +P+ T D   T   P  +++  +    T     G++    YK+L+D    A   +  GA 
Sbjct  41   SPSGTIDGPSTIPVPAGMSYGTDPQSNTNAYLAGFKAQTKYKSLKDLATSAAVKLEAGAS  100

Query  93   YYCGFTNVNAAPQPIPDGTM-RSTGYTHDGPCEVWLDTKRVLQSDNC--HETISGKTYNL  149
              CG+++V    QP+PD         +H GPCEVW D     + DNC  H T +      
Sbjct  101  KECGYSSVTGTAQPLPDTVQWDRFDSSHMGPCEVWCDDVLAFEDDNCSVHMTTTPAVLKY  160

Query  150  DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            D S C G   L  +W+ +    +  +WQIY  C P
Sbjct  161  DKSKCVGKKMLTSFWIAL----HVPTWQIYTNCAP  191

>PHYRA_83499
Length=473

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 54/106 (51%), Gaps = 18/106 (17%)

Query  92   DYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVLQSDNCHETISG-  144
            D  CG+T  +  PQPIP DG ++       G+TH GPCE+++D   VL  D+C E   G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
                       +DYSSC G CTL  YWL  +  +    WQ Y  C+
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCV  184

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 12/67 (18%)

Query  121  GPCEVWLDTKRVLQSDNCHETISGKTYN--------LDYSSCTGTCTLRWYWLGVRYLKN  172
            GPCE++LD   +L  DNC +  SG   +        +DYSSC G CTL  YWLG +  + 
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ-  409

Query  173  AYSWQIY  179
               WQ Y
Sbjct  410  ---WQAY  413

>SPRG_07826
Length=371

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 78/175 (45%), Gaps = 26/175 (15%)

Query  27   AHQVVLLPAPTYTTDNKD-----------TKYAPLAFLENQGYETVEDFNGWRRNNGYKT  75
            AH  +  P PT+   N D           T     A+ ++ GY   + F    + + YKT
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNAAQ-FAANFKTSKYKT  77

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAA-PQPIPD------GTMRSTGYTHDGPCEVWLD  128
            L+ F+D    +   G    CG T V+AA PQP+P       G       +H+GPCE+W D
Sbjct  78   LKAFLDAWDTSAQCG---QCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  134

Query  129  TKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
              RV  +D+C + I   +  +D S C G   L   W+ +   +    WQ YK C+
Sbjct  135  ETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCV  185

>PHALS_02044
Length=237

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 59/115 (51%), Gaps = 8/115 (7%)

Query  73   YKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTM-RSTGYTHDGPCEVWLDTKR  131
            YKTL++F   A   +  GA   CGF+ V+  PQ +P+     +  Y+H GPCEVW D KR
Sbjct  81   YKTLKEFA-WATQKLEKGASNECGFSLVDGQPQELPEMVEWDAFSYSHMGPCEVWCDDKR  139

Query  132  VLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            V Q+ NC    +     L Y  +SC G   L  YW+ V  +     WQIY  C P
Sbjct  140  VFQNWNCGVDYTETPAKLPYDKASCEGAAVLSCYWIAVHTVP----WQIYTNCAP  190

>PYU1_G001514
Length=469

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 80/181 (44%), Gaps = 27/181 (15%)

Query  26   NAHQVVLLPAPTYTTDNKDTKY-----------AP--LAFLENQGYETVEDFNGWRRNNG  72
            +AH  + +P  T+ T    T++           AP  ++F  +    T      ++  + 
Sbjct  23   SAHGYMSVPKVTFATSGDPTQFCATLDGPSTLTAPSGMSFTTDPESNTKAFAAAFKAQST  82

Query  73   YKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-----GTMRSTGYT--HDGPCEV  125
            YK++R  +D AK     G D  CG T+   A QP+P          S G+T  H GPCEV
Sbjct  83   YKSMRALVD-AKGVFQPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCEV  141

Query  126  WLDTKRVLQSDNCHE--TISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            W D  RV Q DNC +  T +      D S C G   L+ YWL +     + +WQ Y  C 
Sbjct  142  WCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQAYINCA  197

Query  184  P  184
            P
Sbjct  198  P  198

>PYAR_24818
Length=198

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 75/171 (44%), Gaps = 19/171 (11%)

Query  26   NAHQVVLLP--------APTYTTDNKDTKYAPLAFLENQGYE--TVEDFNGWRRNNGYKT  75
            +AH  + LP        AP+ T D  +T   P       G+E  T      ++  + Y +
Sbjct  21   DAHSKMTLPKPNSAIDNAPSGTLDGPNTLQVPAGMSFGYGHEQNTAAFLKAYKSQSKYTS  80

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY--THDGPCEVWLDTKRVL  133
            +R  M   K+    GA   CG + +   PQ +PD     TG+  TH GPCEVW D KRV 
Sbjct  81   IRQ-MIYDKFRPDGGATKECGRSAMTGPPQDLPDFVEYETGFDSTHWGPCEVWCDDKRVF  139

Query  134  QSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
              DNC      K   L Y  + C G   L+ +WL +    +   WQ Y +C
Sbjct  140  YEDNCAVKYPQKPGKLPYDKAQCRGAKRLQSFWLAL----HVPDWQAYISC  186

>PYU1_G007254
Length=186

 Score = 74.3 bits (181),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 63/128 (49%), Gaps = 12/128 (9%)

Query  61   VEDFNGWRRNNGYKTLRDFM----DRAKYTVTDG-ADYYCGFTNVNAAPQPIPDGTMRST  115
             + F+   R     TL+DF+    D +K +   G AD  CGF+  N A Q +PD     T
Sbjct  63   ADSFDKAFRAQKKSTLKDFILQYQDTSKGSAGGGTAD--CGFSKSNGAAQALPDSLQWGT  120

Query  116  GYTHDGPCEVWLDTKRVLQ-SDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAY  174
            G+ H GPCE W D + V+  + NC +T SG       + C G   L +YWLGV    +  
Sbjct  121  GFIHPGPCEAWCDNEIVVPYTANCWKTFSGGNVPYAKAKCAGKSRLTFYWLGV----HGP  176

Query  175  SWQIYKAC  182
             WQ+Y  C
Sbjct  177  PWQVYINC  184

>PPTG_07521
Length=281

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 56/109 (51%), Gaps = 18/109 (17%)

Query  90   GADYYCGFTNVNAAPQPIP-DGTMR-----STGYTHDGPCEVWLDTKRVLQSDNCHETIS  143
            GA   CG T  +   QPIP DG  +       G+TH GPCE++LD K VL  DNC +   
Sbjct  81   GAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYP  140

Query  144  GKTYN--------LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            G            +DYSSCT  CTL  YWL     +NA +WQ Y  C+P
Sbjct  141  GGDVGSTVTSDMPVDYSSCTEDCTLTIYWLA---FQNA-NWQAYINCVP  185

>PPTG_04617
Length=496

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 61/117 (52%), Gaps = 17/117 (15%)

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR-STGYTHDGPCEVWLDTKRVLQSD  136
            F+D   Y    GAD  C +++  A P+  P DGT   S G  H GPCE+WLD K VL  D
Sbjct  57   FIDSKLY----GAD--CEYSDPKADPKTSPSDGTATFSRGIAHHGPCEIWLDDKMVLHDD  110

Query  137  NCHETISGKTY--------NLDYSSC-TGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +C +T     Y         +DYSSC T  C  R+YW+  +   N Y  QIY+ C+P
Sbjct  111  DCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVP  167

>PYAR_15391
Length=176

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 74/162 (46%), Gaps = 21/162 (13%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  85
            +AH  ++LP     + +  T+YA     E +G   +    G      + +LRD +++   
Sbjct  22   DAHGYMMLPKAQLASGDP-TRYA----TEIRGTTVMPVPAG----GSFTSLRDLIEKKSP  72

Query  86   TVTDGADYYCGFTNVNAAPQPIPDGTMRST-GYTHDGPCEVWLDTKRVLQSDNCHETISG  144
            +        CG T    APQP+PD    S    +H GPCEVW D KRV Q DNC      
Sbjct  73   STP-----ACGITPPGGAPQPVPDHVEWSAFADSHVGPCEVWCDQKRVFQEDNCAGKYPA  127

Query  145  KTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +   L  + + C     L++YWL +    ++  WQIY  C P
Sbjct  128  RPAKLPINAADCANAKELKFYWLAL----HSQDWQIYINCAP  165

>PYIR_24743
Length=357

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (53%), Gaps = 24/131 (18%)

Query  66   GWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTM------RSTGY-  117
             ++  + +KTLRD +         GAD  CG +  +A+ + IP DG +         G+ 
Sbjct  80   AFQGQSEFKTLRDLLK------DHGAD--CGDSKPDASRKAIPGDGKVVWQNPDTGEGFV  131

Query  118  -THDGPCEVWLDTKRVLQSDNCHETISGK---TYNLDYSSCTGTCTLRWYWLGVRYLKNA  173
             +H GPCE+WLD KRV   +NC    + K      +D+SSC   C LR+YWL +    + 
Sbjct  132  PSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HE  187

Query  174  YSWQIYKACIP  184
             +WQ+YK C+P
Sbjct  188  PTWQVYKNCVP  198

>PHYSO_246481
Length=318

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 86/181 (48%), Gaps = 29/181 (16%)

Query  26   NAHQVVLLPAPTYTTDNKD-TKYAPLAFLENQGYETVEDFNGWRRNN-----------GY  73
            + H  +  PA T+ + + D T++  +A +E+   +    F+G   +N            Y
Sbjct  22   DGHGYMTEPAVTFLSSSTDNTQF--IATIESSASDFSGTFSGSPADNTAAFTKAFEASSY  79

Query  74   KTLRDFM-DRAKYTVTDGADYYCGFTNVNAAPQPIPD-------GTMRSTGYTHDGPCEV  125
             +L++ + D+A  TVTD A   CG  + +   QP+PD        +      +H GPCEV
Sbjct  80   TSLKELINDKATITVTD-ATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEV  138

Query  126  WLDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            W D  RV Q D+C    +     L Y   +C GT TL +YWL +    ++ +WQ+Y  C 
Sbjct  139  WCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCA  194

Query  184  P  184
            P
Sbjct  195  P  195

>SDRG_08782
Length=450

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 85/179 (47%), Gaps = 34/179 (19%)

Query  27   AHQVVLLPAPTYTTDNKDTKYA-------PLAFLENQGYETVEDFN-GWRRNNGYKTLRD  78
             H +V  P   + +D   TKY        P  F ++     V +FN  ++  + +KTLRD
Sbjct  19   GHGIVSNPPAEFRSDVMRTKYVATIQANFPGKF-DDSPQTNVANFNKAFKAQSQFKTLRD  77

Query  79   FMDRAKYTVTDGADYYCGFTNVNAAPQPIP-DGTMR------STGY--THDGPCEVWLDT  129
             +D        G D  CG+T  N   + IP +G M         G+  +H GPCEVW+D 
Sbjct  78   MLD------PHGPD--CGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEVWIDN  129

Query  130  KRVLQSDNCHETI-SGKTYNL--DYSSCTGT-CTLRWYWLGVRYLKNAYSWQIYKACIP  184
            +RV Q+D+C          NL  DYSSC    C LR+YWL +        WQ+YK C+P
Sbjct  130  ERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALHEPM----WQVYKNCVP  184

>PYIR_20481
Length=277

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 63/132 (48%), Gaps = 23/132 (17%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIP---------DGTMRS  114
            F     N GYK+L++ +D +           CGFT  + AP  +          D   + 
Sbjct  66   FTSAFANTGYKSLKEMLDLSVPG--------CGFTLTDGAPVDVSGLKSMKWQNDQEQKG  117

Query  115  TGYTHDGPCEVWLDTKRVLQSDNCHE--TISGKTYNLDYSSCTGTCTLRWYWLGVRYLKN  172
               +H GPCEVW+D  +++ SD+C    T       +DYS C G C L +YWL +    +
Sbjct  118  FIDSHHGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLAL----H  173

Query  173  AYSWQIYKACIP  184
              +WQIYK C+P
Sbjct  174  EPNWQIYKQCVP  185

>SDRG_00972
Length=333

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 79/175 (45%), Gaps = 26/175 (15%)

Query  27   AHQVVLLPAPTYTTDNKD-----------TKYAPLAFLENQGYETVEDFNGWRRNNGYKT  75
            AH  +  P PT+   N D           T     A+ ++ GY   + F    + + YKT
Sbjct  18   AHGGLFDPKPTFIEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNAAQ-FAANFKASKYKT  76

Query  76   LRDFMDRAKYTVTDGADYYCGFTNVNAA-PQPIPD------GTMRSTGYTHDGPCEVWLD  128
            L+ F+D    +   G    CG T V+AA PQP+P       G       +H+GPCE+W D
Sbjct  77   LKAFLDAWDTSAQCGQ---CGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  133

Query  129  TKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
              R+  +D+C + I   +  +D S C+G   L   W+ +   +    WQ YK C+
Sbjct  134  ETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTMLWMALHTPQ----WQAYKNCV  184

>PHYRA_84732
Length=265

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 24/127 (19%)

Query  70   NNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTM-------RSTGY--THD  120
            N GY +LRD +D+    VTD     C  T  + +P  +   T+          G+  +H 
Sbjct  78   NAGYSSLRDMLDQ---QVTD-----CANTRTDVSPVDVSGLTVLNWQNDQEQKGFIDSHH  129

Query  121  GPCEVWLDTKRVLQSDNCHETISG---KTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQ  177
            GPCEVW+D  +V   D+C  T       + + D+S C+G CTLR+YWL +    +  +WQ
Sbjct  130  GPCEVWIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLAL----HEPNWQ  185

Query  178  IYKACIP  184
            +YK C+P
Sbjct  186  VYKQCVP  192

>PHYKE_2539
Length=258

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 63/133 (47%), Gaps = 24/133 (18%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGT-------MRSTG  116
            F     N GY +LRD +D+    VTD     C  T  + +P  +   T           G
Sbjct  59   FTSSFANAGYSSLRDMLDQ---QVTD-----CANTRTDVSPVDVSGLTTMNWQNDQEQKG  110

Query  117  Y--THDGPCEVWLDTKRVLQSDNCHETISG---KTYNLDYSSCTGTCTLRWYWLGVRYLK  171
            +  +H GPCEVW+D   V   D+C  T       + N D+S C+G CTLR+YW+ +    
Sbjct  111  FIDSHHGPCEVWIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRFYWIALHEPN  170

Query  172  NAYSWQIYKACIP  184
                WQIYK C+P
Sbjct  171  ----WQIYKQCVP  179

>PYAR_25093
Length=198

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/178 (29%), Positives = 75/178 (42%), Gaps = 29/178 (16%)

Query  24   TSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVED---------------FNGWR  68
            ++NAH  +  P P     N +   +P  F++      V D                  + 
Sbjct  19   SANAHSRMTAPKP-----NSEISDSPSGFIDGPNTLKVPDGMHFDWNYDQNQAAYQKAFE  73

Query  69   RNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYT--HDGPCEVW  126
                YKTLRD +   K+     +   CGF+ +   PQ +PD    +TG++  H GPCEVW
Sbjct  74   SQTKYKTLRDLV-YDKFVPNGASTKECGFSAMTGTPQSLPDYVEYATGFSESHWGPCEVW  132

Query  127  LDTKRVLQSDNCHETISGKTYNL--DYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
             D  RV    NC  +   +   L  D + C G   L+ +WL +   K    WQ+Y AC
Sbjct  133  CDNTRVFVDPNCRISYPTRPAKLPYDMAKCIGAKRLQTFWLALHEPK----WQVYTAC  186

>HYAP_14170
Length=266

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 24/133 (18%)

Query  64   FNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTM-------RSTG  116
            F     N GYK+LRD +D+            C  T  + AP  +   T+          G
Sbjct  59   FKSSFANAGYKSLRDMLDQQVPG--------CANTRTDVAPVDVAGLTVMNWQNDKEHKG  110

Query  117  Y--THDGPCEVWLDTKRVLQSDNCHETISG---KTYNLDYSSCTGTCTLRWYWLGVRYLK  171
            +  +H GPCE W+D   V + D+C  T       + N D+S C+G CTLR+YWL +  + 
Sbjct  111  FIDSHHGPCETWIDDTMVDRQDDCVATYGTGFPASVNADFSRCSGVCTLRFYWLALHEV-  169

Query  172  NAYSWQIYKACIP  184
               +WQ+YK C+P
Sbjct  170  ---NWQVYKQCVP  179

>PITG_11937
Length=305

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query  26   NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET-----------VEDFNGWRRNNGYK  74
            +AH  + LPA T+  D   T++  +A +E                  E F     ++ + 
Sbjct  16   SAHGYLGLPAVTFPNDVDKTQF--IATIEASASGFSGSFSGSPSANTETFWTAFSSSKFT  73

Query  75   TLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
            ++++F+      V  GA+  CG T+ N  PQP+P+        + G+T  H+GPCE W D
Sbjct  74   SIKEFVTALGQVVATGANLQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCD  133

Query  129  TKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNAYSWQIYKAC  182
              +V Q  NC    +     L Y  ++C+G   L +YWL +     + +WQ+Y  C
Sbjct  134  DTQVFQDTNCAAHFTTAPAKLPYNKAACSGASRLAFYWLALH----SSTWQVYANC  185

>PHYCA_19611
Length=531

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 13/129 (10%)

Query  63   DFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPD-------GTMRST  115
            +FN     + Y +L++FM+     V       CG+TN   APQP+P        G     
Sbjct  275  NFNKGMAASKYTSLKEFMNDKMVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGF  334

Query  116  GYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDY--SSCTGTCTLRWYWLGVRYLKNA  173
              +H+GPCEVW D  RV Q DNC +        + Y   +C G+  L  YW+ +    ++
Sbjct  335  TQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIAL----HS  390

Query  174  YSWQIYKAC  182
             SWQ+Y  C
Sbjct  391  PSWQVYINC  399

 Score = 30.8 bits (68),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (46%), Gaps = 8/68 (12%)

Query  118  THDGPCEVWLDTKRVLQSDNC---HETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAY  174
            T +GP  V      + + DNC   + T   K    D  +C G   L +YWL +    ++ 
Sbjct  75   TSNGPTVVAKALPPLTKDDNCAANYPTAPAK-VPYDRDACLGASRLTFYWLAL----HSS  129

Query  175  SWQIYKAC  182
            +WQ+Y  C
Sbjct  130  TWQVYTNC  137

>SDRG_16534
Length=320

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 77/172 (45%), Gaps = 25/172 (15%)

Query  27   AHQVVLLPAPTYTTDNKD-TKYAPL----AFLENQGYETVEDFNGWR-----RNNGYKTL  76
             H  ++ P P +T    D +K+A        L    YE   D+N  +     + + +KTL
Sbjct  20   GHGHLVDPVPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSFKTL  79

Query  77   RDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGY-----THDGPCEVWLDTKR  131
            + F+D        G D  CG T+ N   QP+P     + G      +H GPCE+W D  R
Sbjct  80   KAFLD----AYPTGGD--CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELWCDETR  133

Query  132  VLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACI  183
            V Q DNC   +     ++D S C+G   L   WL +   +    WQ+YK C+
Sbjct  134  VFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCV  181

Lambda      K        H        a         alpha
   0.318    0.134    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9439740474

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40