Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_16673725825811155e-155
PITG_0000974181945792e-71
PHYKE_572173171674581e-54
PHYSO_29655271351354195e-51
PYVX_15873785465521151372e-08
PYIW_23489836812351981272e-07
PYU1_G003224836813691981043e-04
PYIR_2121783681393189840.093
PHYSO_414166550458649720.60
PHYCA_722813936711047691.9
SPRG_1010912733884188713.8
PPTG_16056287261563696.7
PHALS_0823113681116051677.1
PHYCA_1088064126913740668.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_16673

Length=258
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_16673                                                            434        5e-155
PITG_00009                                                            227        2e-71 
PHYKE_5721                                                            181        1e-54 
PHYSO_296552                                                          166        5e-51 
PYVX_15873                                                            57.4       2e-08 
PYIW_23489                                                            53.5       2e-07 
PYU1_G003224                                                          44.7       3e-04 
PYIR_21217                                                            37.0       0.093 
PHYSO_414166                                                          32.3       0.60  
PHYCA_72281                                                           31.2       1.9   
SPRG_10109                                                            32.0       3.8   
PPTG_16056                                                            31.2       6.7   
PHALS_08231                                                           30.4       7.1   
PHYCA_108806                                                          30.0       8.4   

>PPTG_16673
Length=258

 Score = 434 bits (1115),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 258/258 (100%), Positives = 258/258 (100%), Gaps = 0/258 (0%)

Query  1    MPLFSLArffslsslgrrhrrgereqrrimrsrssrrVQEVSTVKGVVHIPYMEATSVEF  60
            MPLFSLARFFSLSSLGRRHRRGEREQRRIMRSRSSRRVQEVSTVKGVVHIPYMEATSVEF
Sbjct  1    MPLFSLARFFSLSSLGRRHRRGEREQRRIMRSRSSRRVQEVSTVKGVVHIPYMEATSVEF  60

Query  61   DIRSNRSISSSFYVKGSAACPDHRGLMNSLRSFRAQGPVEVAKKEQKKLRKALERAVKQE  120
            DIRSNRSISSSFYVKGSAACPDHRGLMNSLRSFRAQGPVEVAKKEQKKLRKALERAVKQE
Sbjct  61   DIRSNRSISSSFYVKGSAACPDHRGLMNSLRSFRAQGPVEVAKKEQKKLRKALERAVKQE  120

Query  121  RKEARKMQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQEILAEIWAMRSSSMG  180
            RKEARKMQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQEILAEIWAMRSSSMG
Sbjct  121  RKEARKMQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQEILAEIWAMRSSSMG  180

Query  181  RVSDESMPVVDDKLADTAPMEFLFFTGCPDDNSLDVRHRRARSKARLARYSATPSFTTTV  240
            RVSDESMPVVDDKLADTAPMEFLFFTGCPDDNSLDVRHRRARSKARLARYSATPSFTTTV
Sbjct  181  RVSDESMPVVDDKLADTAPMEFLFFTGCPDDNSLDVRHRRARSKARLARYSATPSFTTTV  240

Query  241  PVKSTLVSNMPPLFVPRF  258
            PVKSTLVSNMPPLFVPRF
Sbjct  241  PVKSTLVSNMPPLFVPRF  258

>PITG_00009
Length=418

 Score = 227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 148/194 (76%), Gaps = 0/194 (0%)

Query  47   VVHIPYMEATSVEFDIRSNRSISSSFYVKGSAACPDHRGLMNSLRSFRAQGPVEVAKKEQ  106
            V   PY +  SVEF +R++R IS   + KG+ AC D  GL  S+RSFRAQ PV++AK +Q
Sbjct  219  VPQAPYTQTPSVEFAMRNSRPISPPTFFKGARACSDRLGLTMSMRSFRAQDPVQIAKNDQ  278

Query  107  KKLRKALERAVKQERKEARKMQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQE  166
            KKLRKALERA KQERKEARK QKLA+KS RS+RERG S NRIALLS ++V DCS+ S++E
Sbjct  279  KKLRKALERAAKQERKEARKKQKLARKSHRSLRERGSSSNRIALLSASSVYDCSITSNEE  338

Query  167  ILAEIWAMRSSSMGRVSDESMPVVDDKLADTAPMEFLFFTGCPDDNSLDVRHRRARSKAR  226
            ILAEIWAMRSS   +VSDE +   DDK A +AP+EFLFF GCPDD+S ++ + RAR K+R
Sbjct  339  ILAEIWAMRSSFTAQVSDEDVSAADDKAASSAPIEFLFFMGCPDDSSREIGYLRARPKSR  398

Query  227  LARYSATPSFTTTV  240
             AR +ATPSF T +
Sbjct  399  SARNTATPSFATAI  412

>PHYKE_5721
Length=317

 Score = 181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 121/167 (72%), Gaps = 10/167 (6%)

Query  96   QGPVEVAKKEQKKLRKALERAVKQERKEARKMQKLAKKSDRSVRERGGS-CNRIALLSTT  154
            + PVE+AK++  KL+KAL+RA +QERK+ RKMQK+A K+    R+RG S  NRIALLS  
Sbjct  139  KNPVELAKRDPNKLQKALDRATQQERKKTRKMQKIANKA---ARQRGSSGSNRIALLSAG  195

Query  155  TVSDCSVMSDQEILAEIWAMRSSSMGRVSDESMPVVDDKLADTAPMEFLFFTGCPDDNS-  213
                CS+ SD++ILAEIWA RS S   ++D+ +P VD+  + +APMEF+FFTGCPDD + 
Sbjct  196  V---CSIASDEDILAEIWASRSPSCDGIADDDLPEVDEDFSQSAPMEFVFFTGCPDDRNL  252

Query  214  --LDVRHRRARSKARLARYSATPSFTTTVPVKSTLVSNMPPLFVPRF  258
              LDV +RR RS  R AR  +T S+ TT+P+K TLVS MPPLFVPR 
Sbjct  253  RELDVGYRRHRSNTRAARCPSTSSYATTIPIKPTLVSKMPPLFVPRL  299

>PHYSO_296552
Length=135

 Score = 166 bits (419),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 4/135 (3%)

Query  127  MQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQEILAEIWAMRSSSMGRVSDES  186
            M+KL    D S   RGGS  RIA+LS  TVSDCS  SD++ILAEIWAMRS  +   S + 
Sbjct  1    MKKLVNNVDISATNRGGS-GRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDD  59

Query  187  MPVVDDKLADTAPMEFLFFTGCPDDNS---LDVRHRRARSKARLARYSATPSFTTTVPVK  243
            +P VDD+L++TAPMEFLFF+GCPDD +   LDV +RR RS  R  RY  TPS+ T+VP+K
Sbjct  60   LPEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPIK  119

Query  244  STLVSNMPPLFVPRF  258
             TLVSNMPPLF PRF
Sbjct  120  PTLVSNMPPLFAPRF  134

>PYVX_15873
Length=552

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 61/115 (53%), Gaps = 12/115 (10%)

Query  155  TVSDCSVMSDQEILAEIWAMRSSSM--GRVSDESMPVVDDKLADTAPMEFLFFTGCPDD-  211
            T +D +VM   + L+E W    +S+   + SD S    D + +   PMEFLFF  CPDD 
Sbjct  435  TSADDAVMP-AKTLSESWESLEASILTTQGSDMSARFSDLRASGPEPMEFLFFPSCPDDL  493

Query  212  --NSLDVRH--RRARSKARLARYSATPSFTT----TVPVKSTLVSNMPPLFVPRF  258
              N+L++    RRA   +  A   + PS  T    ++ V  TLV++MPPLF PR 
Sbjct  494  VVNTLEINQFRRRANIASGGATAQSEPSAATSDLDSIRVGRTLVTDMPPLFTPRL  548

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 75/158 (47%), Gaps = 25/158 (16%)

Query  108  KLRKALERAVKQERKEARKMQK---LAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSD  164
            KL +A+ RA+  E K  RK++K   L K   R+  E     N     +TT   +C  +  
Sbjct  112  KLAEAVHRALHYEPKRKRKLKKGSLLQKLVGRAPAESPPVSN-----TTTEEDECESLE-  165

Query  165  QEILAEIWAMRSSSMGRVSDESMPV-VDDKLADTAPMEFLFFTGCPDDNS---LDVRHRR  220
                        +++  + D+ +    DD+    APMEFLFF+GCPDD++   L++   R
Sbjct  166  ------------AAIMNLPDQGISTQWDDREEWPAPMEFLFFSGCPDDSNLYRLEMNQHR  213

Query  221  ARSKARLARYSATPSFTTTVPVKSTLVSNMPPLFVPRF  258
             R  A     +   S +    ++ +LV +MPP+F PR 
Sbjct  214  RRPDAVSREAADRGSASDAAFLRRSLVYDMPPVFAPRL  251

>PYIW_23489
Length=235

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 90/198 (45%), Gaps = 38/198 (19%)

Query  97   GPVE-VAKKEQKKLRKALERAVKQERKEARKMQKLAKKSDRSVRERGGSCNRIA------  149
            GP + + +KE++KLR+++ R ++ E K+ RK++K  +K  +          ++A      
Sbjct  34   GPAQQLTRKEERKLRRSVARVIRSEEKKLRKLEKANRKRAKQYARADEFFEQVASAPLDV  93

Query  150  --LLSTTTVS--DCSVMSDQEILAEIWAMR------------SSSM---GRVSDESMPVV  190
              L ++ +VS    S   D E     W  +            SSS+   GR   +S+  +
Sbjct  94   SELRTSYSVSRQSESYHFDMEAAESKWHRQQQQHQQRASESLSSSLTHYGRQRSDSVSSL  153

Query  191  DDKLADTAPMEFLFFTGCPDD----NSLDVRHRRARSKARLARYSAT-------PSFTTT  239
                     MEFLFF G PD     N L+V HRR +   R+  Y+++        S T +
Sbjct  154  SRSRGKPPRMEFLFFGGSPDADSNLNELEVGHRRFQPH-RIDYYNSSAASEYPRESCTVS  212

Query  240  VPVKSTLVSNMPPLFVPR  257
            + +  TLV NMP  F PR
Sbjct  213  IKINPTLVRNMPRPFNPR  230

>PYU1_G003224
Length=369

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/198 (27%), Positives = 81/198 (41%), Gaps = 46/198 (23%)

Query  104  KEQKKLRKALERAVKQERKE---------------ARKMQKLAKKSDRSVRERGGSCNRI  148
            KE+K+LRK++ +A++ E K+               AR  +   + +D  +     + NR 
Sbjct  171  KEEKQLRKSVAKAIRTEEKQQKKRDKLDKKRAKQYARAREFFEQTNDDFL---VNNSNRR  227

Query  149  ALLSTTTVSDCSVMSDQEILAEIWA---------MRSSSMGRVS--DESMPVVDDKLADT  197
            +  S T+    S   D E     W            S S+ ++S  +E+      +    
Sbjct  228  SSFSHTSHQSDSYCFDVEAAEAKWHEQQRASLEFQESVSLAQLSPTNENTATWKKQPTVK  287

Query  198  AP--MEFLFFTGCPDDN-----SLDVRHRRARSKARLAR----------YSATPSFTTTV  240
             P  +EFLFF G PD++      L+V HR      + A           YSA  S T  +
Sbjct  288  YPPRLEFLFFGGNPDESESSLMQLEVGHRSRIMNFQTATAPAFANPPADYSAADSRTNAI  347

Query  241  PVKSTLVSNMPPLFVPRF  258
             +  TLV NMP  FVP F
Sbjct  348  KINPTLVRNMPRPFVPTF  365

>PYIR_21217
Length=393

 Score = 37.0 bits (84),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 78/189 (41%), Gaps = 32/189 (17%)

Query  101  VAKKEQKKLRKALERAVKQERKEARKMQKL----AKKSDRSVRERGGSCNRIALLSTTTV  156
            +  KE+KKLRK++ RA++ E K+ +K+ KL    AK+  R+      + N +  +S    
Sbjct  200  LTHKEEKKLRKSVARAIRSEEKKLKKLDKLNKKRAKQYARAEEFFEQTTNIVLDISHFRN  259

Query  157  SDCSVMS-------DQEILAEIWAMRSSSMG------------RVSDESMPVVDDKLADT  197
            S  S+         D E     W  + SS              R SD S   +       
Sbjct  260  SRNSISRQSDSYHFDMEAAESKWHQQRSSESEFLSSSLTQYSRRDSDASTSSLSRSRGKP  319

Query  198  APMEFLFFTGCPDD---NSLDVRHRR------ARSKARLARYSATPSFTTTVPVKSTLVS  248
              MEFLFF G  DD   N L+V H +      A +     R     S   T+ V  TLV 
Sbjct  320  PRMEFLFFGGSVDDYNLNCLEVGHHQFEPDTTAITSNTAERDFQKDSSLITIKVNPTLVH  379

Query  249  NMPPLFVPR  257
            NMP  F PR
Sbjct  380  NMPRPFNPR  388

>PHYSO_414166
Length=86

 Score = 32.3 bits (72),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 28/49 (57%), Gaps = 9/49 (18%)

Query  188  PVVDDKLADTAPMEFLFFTGCPDDNSLDVRHRR-----ARSKARLARYS  231
            PVV   L + AP+E   FTG P  ++LDVR +R     ARSK  +  +S
Sbjct  13   PVV--SLGNCAPVEL--FTGLPAPSALDVREQRCMAAMARSKGTVCNFS  57

>PHYCA_72281
Length=110

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 8/47 (17%)

Query  194  LADTAPMEFLFFTGCPDDNSLDVRHRRARSKARLARYSATPSFTTTV  240
            LA+ AP+E   FTG P  ++LD R R+A+      RY   P +  +V
Sbjct  39   LANRAPIEL--FTGLPCPSALDTRQRQAK------RYRLRPHYEKSV  77

>SPRG_10109
Length=841

 Score = 32.0 bits (71),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 4/88 (5%)

Query  151  LSTTTVSDCSVMSDQEILAEIWAMRSSSMGRVSDESMPVVDDKLADTAPMEFLFFTGCPD  210
            LS T  +    +S   +   I  +R+     V   ++P +    A   P++ +F     D
Sbjct  258  LSPTVYASWHALSQTRLFGHIQKLRALEYLDVGHNALPKLQLAPATLPPIQSIF----AD  313

Query  211  DNSLDVRHRRARSKARLARYSATPSFTT  238
            DN L +R  R  +KA+L   S+ P +  
Sbjct  314  DNHLGLRGARELAKAKLYSTSSRPEWNN  341

>PPTG_16056
Length=615

 Score = 31.2 bits (69),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (48%), Gaps = 1/63 (2%)

Query  85   GLMNSLRSFRAQGPVEVAKKEQKKLRKALERAVKQERKEARKMQKLAKKSDRSVRERGGS  144
            GLM +     A  PV   + + K L + LER   + R   + +    KK DRS  ++GGS
Sbjct  497  GLMGTPGLIAASKPVRAGRSKSKNLGE-LERFTSENRNSYQSIHARQKKGDRSNEKQGGS  555

Query  145  CNR  147
              R
Sbjct  556  LWR  558

>PHALS_08231
Length=160

 Score = 30.4 bits (67),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  71   SFYVKGSAACPDHRGLMNSLRSFRAQGPVEVAKKEQKKLRKALERAVKQER  121
            S++  G+  CPD+  +++ LR    Q   E+A  +Q   R+ LER    ER
Sbjct  46   SYHDPGNQQCPDNEMVIDQLRGELKQKNHEIALLQQTVHRECLERTSLLER  96

>PHYCA_108806
Length=137

 Score = 30.0 bits (66),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  194  LADTAPMEFLFFTGCPDDNSLDVRHRRARSKARLARYSAT  233
            L + AP+E   FTG P  ++LDVR +  R  A +AR S T
Sbjct  70   LGNCAPVEL--FTGLPAPSALDVREQ--RRTAAMARSSGT  105

Lambda      K        H        a         alpha
   0.318    0.128    0.359    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14422153560

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40