Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_1667292862869151e-123
PHYCA_50470692532055942e-75
PITG_0001191601965289e-67
PHYSO_47825391691994654e-57
PHALS_1083592642134371e-51
PHYKE_572092212193887e-45
HYAP_0151392482223498e-39
PYVX_1586391811132182e-20
PYU1_G00322593697227661547e-11
PYIW_234919369721218780.41
PHALS_108371110879740.45
PYIR_15599331474776723.8
PHYCA_1044361018167695.1
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_16672

Length=286
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_16672                                                            357        1e-123
PHYCA_504706                                                          233        2e-75 
PITG_00011                                                            207        9e-67 
PHYSO_478253                                                          183        4e-57 
PHALS_10835                                                           172        1e-51 
PHYKE_5720                                                            154        7e-45 
HYAP_01513                                                            139        8e-39 
PYVX_15863                                                            88.6       2e-20 
PYU1_G003225                                                          63.9       7e-11 
PYIW_23491                                                            34.7       0.41  
PHALS_10837                                                           33.1       0.45  
PYIR_15599                                                            32.3       3.8   
PHYCA_104436                                                          31.2       5.1   

>PPTG_16672
Length=286

 Score = 357 bits (915),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 286/286 (100%), Positives = 286/286 (100%), Gaps = 0/286 (0%)

Query  1    MIQPDTNPCFLAlphspssprqlssslMpatesqsapspaparprappppvpnfppqsap  60
            MIQPDTNPCFLALPHSPSSPRQLSSSLMPATESQSAPSPAPARPRAPPPPVPNFPPQSAP
Sbjct  1    MIQPDTNPCFLALPHSPSSPRQLSSSLMPATESQSAPSPAPARPRAPPPPVPNFPPQSAP  60

Query  61   eaapakeqpapgpVHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEAsqrr  120
            EAAPAKEQPAPGPVHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEASQRR
Sbjct  61   EAAPAKEQPAPGPVHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEASQRR  120

Query  121  tsrwsrwshshrGSFpeaplevaavaapetapIQENESAASSPHPDEPPAKKVKKATVEH  180
            TSRWSRWSHSHRGSFPEAPLEVAAVAAPETAPIQENESAASSPHPDEPPAKKVKKATVEH
Sbjct  121  TSRWSRWSHSHRGSFPEAPLEVAAVAAPETAPIQENESAASSPHPDEPPAKKVKKATVEH  180

Query  181  PTTEKKASPLSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELR  240
            PTTEKKASPLSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELR
Sbjct  181  PTTEKKASPLSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELR  240

Query  241  PSELDDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286
            PSELDDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF
Sbjct  241  PSELDDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286

>PHYCA_504706
Length=253

 Score = 233 bits (594),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 178/205 (87%), Gaps = 1/205 (0%)

Query  82   PTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEAsqrrtsrwsrwshshrGSFpeaple  141
            PTKRK RG+MRAIGGLFKRK+SD DDA  PSDSEASQRRTSRWSRWSHS+RGS PEAPLE
Sbjct  50   PTKRKHRGLMRAIGGLFKRKSSDADDATAPSDSEASQRRTSRWSRWSHSNRGSMPEAPLE  109

Query  142  vaavaapetapIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFNKTKQSPTD  201
            VAAVA PETAPIQENES ASSPH +EPPAKKVKK   E P  E K  P SFN TKQSPTD
Sbjct  110  VAAVAEPETAPIQENESVASSPHMEEPPAKKVKKVKAEKPKKEAKIKPPSFN-TKQSPTD  168

Query  202  PSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKMP  261
            PS L+ + SSD S  EPQR+SFLFFGGSD DSTFQPELRPSE D+LHENDIRPSLQAKMP
Sbjct  169  PSALVASGSSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKMP  228

Query  262  LFFSPPLVEHMRRSSILPDPKEYEF  286
            LFFSPP+VE+MRRSSILPDPKEYEF
Sbjct  229  LFFSPPMVENMRRSSILPDPKEYEF  253

>PITG_00011
Length=160

 Score = 207 bits (528),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 154/196 (79%), Gaps = 36/196 (18%)

Query  91   MRAIGGLFKRKASDVDDAMEPSDSEAsqrrtsrwsrwshshrGSFpeaplevaavaapet  150
            MRAIGGLFKRK SD DDA  PSDSEASQRRTSRWSRWSHSHRGS PEAPL+VAAVAAPET
Sbjct  1    MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSHSHRGSLPEAPLDVAAVAAPET  60

Query  151  apIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFNKTKQSPTDPSELLMADS  210
            APIQEN+S                                    TKQSPTDPS+LL+ADS
Sbjct  61   APIQENDS------------------------------------TKQSPTDPSDLLLADS  84

Query  211  SDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKMPLFFSPPLVE  270
            SDESGAEPQRVSFLFFGGSD DSTFQPELRPSELDDLH+NDIRPSLQAKMPLFFSPPLVE
Sbjct  85   SDESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVE  144

Query  271  HMRRSSILPDPKEYEF  286
            +MRRSSILPDPKEYEF
Sbjct  145  NMRRSSILPDPKEYEF  160

>PHYSO_478253
Length=169

 Score = 183 bits (465),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 148/199 (74%), Gaps = 33/199 (17%)

Query  91   MRAIGGLFKRKASDVDDAMEPSDSEAsqr-rtsrwsrwshshrGSFpeaplevaavaape  149
            MRAIGGLFKRK+ D DD M PSDSEASQR  TSRWSRWS SHR S PEAP+EV AVA PE
Sbjct  1    MRAIGGLFKRKSIDADDPMAPSDSEASQRPSTSRWSRWSQSHRQSLPEAPMEVTAVAVPE  60

Query  150  tapIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFNKTKQSPTDPSELLMA-  208
             APIQENE          PPA                +SP+     KQSPTDPS LL+A 
Sbjct  61   AAPIQENE----------PPAP---------------SSPV-----KQSPTDPSALLLAG  90

Query  209  -DSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKMPLFFSPP  267
             DS DE  AEP RVSFLFFGGSDVDSTFQPELRPSELDDLHEN+IRPSLQ KMPLFFSPP
Sbjct  91   VDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPP  150

Query  268  LVEHMRRSSILPDPKEYEF  286
            LVE+MRRSSILPDPKEYEF
Sbjct  151  LVENMRRSSILPDPKEYEF  169

>PHALS_10835
Length=264

 Score = 172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 135/213 (63%), Gaps = 7/213 (3%)

Query  74   VHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEAsqrrtsrwsrwshshrG  133
            VHAA   PP KRK RG+MRAIGG F+R  SD D    P DSE+SQRRTSRWS        
Sbjct  59   VHAATGRPPKKRKHRGLMRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQSMP  118

Query  134  SFpeaplevaavaapetapIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFN  193
              P   +    +    +    ENE    SPH +E      K    +    +   SP    
Sbjct  119  EAPSTVVVQEILETTRSQNAAENEPLTKSPHTEE--PPVKKVKKDKPKKAKNTPSP----  172

Query  194  KTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIR  253
             T+QSPT+ SE+L A   DE G E QRVSFLFFGGSDVD TFQPELRPSELDDLHENDIR
Sbjct  173  -TEQSPTETSEMLSATLVDELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIR  231

Query  254  PSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286
            PSLQAKMPLF  PPL +++RRSSILPDP+EYEF
Sbjct  232  PSLQAKMPLFLPPPLPKNVRRSSILPDPEEYEF  264

>PHYKE_5720
Length=221

 Score = 154 bits (388),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 146/219 (67%), Gaps = 8/219 (4%)

Query  74   VHAAAAEPPTKRKTRGIMRAIGGLFKRKASDVDDAMEPSDSEAsqrrtsrwsrwshshrG  133
            V  + +EP  +R + G +RAIGGLFKR++SD +    P  S++   + S       S R 
Sbjct  5    VRPSVSEPTKRRHSGGFIRAIGGLFKRRSSDANGLSAP--SDSESSQRSTSRWSRFSLRH  62

Query  134  SFpeaplevaavaapetapIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFN  193
            S PEAP+EV AVAAPE API+EN+S ++      P     KKA       ++K       
Sbjct  63   SLPEAPMEVEAVAAPEAAPIRENDSVSTPSPSPHPEEPPAKKAKKAEKPKKEKKEKKPKP  122

Query  194  KTKQSP---TDPSELLMA---DSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDL  247
             +++S    TD  ELL+A   +S DE GAEP R+SFLFFGGSD +STF P+LRPS+LDDL
Sbjct  123  PSQKSKPSPTDTPELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDL  182

Query  248  HENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286
            HEND+RPSLQAKMP FFSPP+VEHMRRSSILPDP+EYEF
Sbjct  183  HENDLRPSLQAKMPQFFSPPVVEHMRRSSILPDPREYEF  221

>HYAP_01513
Length=248

 Score = 139 bits (349),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 129/222 (58%), Gaps = 18/222 (8%)

Query  77   AAAEPPTKRKT--RGIMRAIGGLFKRKASDVDDAMEPSDSEAsqrrtsrwsrwshshrGS  134
            + ++P  K+K   RG++RA+G  FKRK SD D  + P          +  +R      GS
Sbjct  33   SVSQPTEKKKKPHRGLIRAVGVFFKRKCSDGDATVRP-----PVVSGASPNRMVQWIHGS  87

Query  135  FpeaplevaavaapetapIQENESAAS-SPHPDEPPA----KKVKKATVEHPTTEKKA--  187
                 +    + A + +  QE E+  S  P  +E P     K+VK+ T       +KA  
Sbjct  88   -QRQSMPDMPLEAVDPSLYQERETLTSVCPLMEETPVTITNKRVKQETKADKGERRKAET  146

Query  188  -SPLSFNKTKQSPTDPSELLMADSS--DESGAEPQRVSFLFFGGSDVDSTFQPELRPSEL  244
             + +SF K K SPTD SELL A+SS  +ES  +P RVSFL FGGS+VDSTF+PEL PSE 
Sbjct  147  KANVSFVKAKPSPTDSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEY  206

Query  245  DDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSILPDPKEYEF  286
            DD+H ++IRP LQ KMPLFFS PL E +RRSS   DPKEYE 
Sbjct  207  DDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248

>PYVX_15863
Length=181

 Score = 88.6 bits (218),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 76/113 (67%), Gaps = 11/113 (10%)

Query  176  ATVEHP-TTEKKASPLSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDST  234
            AT++ P  + K+AS  S   +  SP+DP+EL +AD++ E         FLF+GGSDVD  
Sbjct  78   ATMQPPHQSGKQASETSSANSFSSPSDPTELDVADAAPE---------FLFYGGSDVDGA  128

Query  235  FQPELRPSELDDLHENDIRPSLQAKMPLFFSPPLVEHMRRSSIL-PDPKEYEF  286
            F+P+LRPS LD +  + IRP ++  MP+FFS P  E++RRSSIL  DP+EYEF
Sbjct  129  FKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADPREYEF  181

 Score = 31.6 bits (70),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (82%), Gaps = 1/22 (5%)

Query  81   PPTKRKT-RGIMRAIGGLFKRK  101
            P T RK+  GIMRA+GGLF+RK
Sbjct  23   PMTPRKSGAGIMRAVGGLFRRK  44

>PYU1_G003225
Length=227

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 2/66 (3%)

Query  223  FLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKMPLFFSPPL--VEHMRRSSILPD  280
            FLF+ GS  D++F+PE   S + ++  N IRPSL  +MP+FFSPP       RRSSIL D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  281  PKEYEF  286
            P+EYE 
Sbjct  186  PREYEL  191

 Score = 33.5 bits (75),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 17/22 (77%), Gaps = 0/22 (0%)

Query  85   RKTRGIMRAIGGLFKRKASDVD  106
            +KTR  MRA+GG+F R++ D D
Sbjct  20   KKTRNFMRAVGGVFHRRSRDSD  41

>PYIW_23491
Length=212

 Score = 34.7 bits (78),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (89%), Gaps = 0/18 (0%)

Query  86   KTRGIMRAIGGLFKRKAS  103
            KTRG MRAIGG+F RK++
Sbjct  22   KTRGFMRAIGGMFHRKSA  39

 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  220  RVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAK  259
            R  F F+ GS  D++F+PE   S + ++  N IRP   +K
Sbjct  141  RYQFHFYSGSAEDNSFKPERVHSTVAEIDYNTIRPRRGSK  180

>PHALS_10837
Length=108

 Score = 33.1 bits (74),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 21/79 (27%), Positives = 40/79 (51%), Gaps = 1/79 (1%)

Query  190  LSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHE  249
            L+ +K + S ++ S +     S++  +  +R  F+FF GSD  +    +   S  + + E
Sbjct  17   LTTSKERNSKSNISTVFEVCQSNDMSSSTERQQFVFFCGSDASAVPSGDY-ASFHNSILE  75

Query  250  NDIRPSLQAKMPLFFSPPL  268
               +P +  +MP+F  PPL
Sbjct  76   ATAQPVIDHRMPVFIMPPL  94

>PYIR_15599
Length=747

 Score = 32.3 bits (72),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 10/76 (13%)

Query  183  TEKKASPLSFNKTKQSPTDPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPS  242
            T  K  PLSF +T Q+ ++ +     D+ D++ A+P +    FF G D+D   + +LR  
Sbjct  410  TFTKKYPLSFVET-QATSNNNGAATQDAQDQAAAKPTKFGVCFFVGFDID---RRQLRGR  465

Query  243  E------LDDLHENDI  252
            E      +D    ND+
Sbjct  466  EVSIDNSVDYFKHNDL  481

>PHYCA_104436
Length=181

 Score = 31.2 bits (69),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 29/67 (43%), Gaps = 26/67 (39%)

Query  219  QRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIR-------------------PSLQAK  259
            ++V FLF+GGSD  +       P+ +  LH+N  R                   P +  +
Sbjct  84   RQVQFLFYGGSDPPT-------PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHE  136

Query  260  MPLFFSP  266
            MP FFSP
Sbjct  137  MPCFFSP  143

Lambda      K        H        a         alpha
   0.311    0.128    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 17052638484

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40