Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_16671102092098999e-124
PITG_00012101852107261e-97
PHYCA_104436101812096772e-90
PHYSO_554653102202255911e-76
PHYRA_78819102002095794e-75
HYAP_01509102082114605e-57
PHALS_10836102042064422e-54
PHYCA_97367203391912124361e-53
PPTG_07275203391841913901e-46
PYVX_15869103312152624e-26
PYU1_G0032268196820677920.004
PYAP_203999980113563780.17
PYAR_194629980111662760.18
PYIW_1915781968262101780.31
HYAP_015081113257750.33
PHYSO_2965561113668720.90
PYVX_158671118772730.91
SDRG_10804129647147158731.7
PYIR_144998196818662692.8
PYVX_15863918156683.8
PHYRA_788181113473657.1
PHYKE_57191113065657.1
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_16671

Length=209
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_16671                                                            350        9e-124
PITG_00012                                                            284        1e-97 
PHYCA_104436                                                          265        2e-90 
PHYSO_554653                                                          232        1e-76 
PHYRA_78819                                                           227        4e-75 
HYAP_01509                                                            181        5e-57 
PHALS_10836                                                           174        2e-54 
PHYCA_97367                                                           172        1e-53 
PPTG_07275                                                            154        1e-46 
PYVX_15869                                                            105        4e-26 
PYU1_G003226                                                          40.0       0.004 
PYAP_20399                                                            34.7       0.17  
PYAR_19462                                                            33.9       0.18  
PYIW_19157                                                            34.7       0.31  
HYAP_01508                                                            33.5       0.33  
PHYSO_296556                                                          32.3       0.90  
PYVX_15867                                                            32.7       0.91  
SDRG_10804                                                            32.7       1.7   
PYIR_14499                                                            31.2       2.8   
PYVX_15863                                                            30.8       3.8   
PHYRA_78818                                                           29.6       7.1   
PHYKE_5719                                                            29.6       7.1   

>PPTG_16671
Length=209

 Score = 350 bits (899),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 209/209 (100%), Positives = 209/209 (100%), Gaps = 0/209 (0%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60
            MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP
Sbjct  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60

Query  61   SRPPSSLPPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGS  120
            SRPPSSLPPFASSQVGTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDERQVQFLFYGGS
Sbjct  61   SRPPSSLPPFASSQVGTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDERQVQFLFYGGS  120

Query  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180
            DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA
Sbjct  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180

Query  181  PIYSPHLFKISEQRTSRRSTGYYSMRYSR  209
            PIYSPHLFKISEQRTSRRSTGYYSMRYSR
Sbjct  181  PIYSPHLFKISEQRTSRRSTGYYSMRYSR  209

>PITG_00012
Length=185

 Score = 284 bits (726),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 162/210 (77%), Gaps = 26/210 (12%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60
            MGLS+FFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGV RSPQMFNRWEH VKYNIT 
Sbjct  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNIT-  59

Query  61   SRPPSSLPPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGS  120
                                     S   S    +    +    EEE+ERQVQFLFYGGS
Sbjct  60   ------------------------SSRPPSSGSRSDSPSNYSYEEEEEERQVQFLFYGGS  95

Query  121  DPPTPTSAGGLY-SNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMS  179
            DPPTPTS G LY S GYRSDMISNYVEPMSPAASIESPRI+HEMPCFFSPR+TPLQSPMS
Sbjct  96   DPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMS  155

Query  180  APIYSPHLFKISEQRTSRRSTGYYSMRYSR  209
            APIYSPHLFKISEQR SRRSTGYY+MRYSR
Sbjct  156  APIYSPHLFKISEQRMSRRSTGYYNMRYSR  185

>PHYCA_104436
Length=181

 Score = 265 bits (677),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 171/209 (82%), Gaps = 28/209 (13%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60
            MG+S FF  +WD V +PFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWE+DV      
Sbjct  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDV------  54

Query  61   SRPPSSLPPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGS  120
                                QSKTLSSSGSRSGS+++SP NYSYEEEDERQVQFLFYGGS
Sbjct  55   --------------------QSKTLSSSGSRSGSSANSPLNYSYEEEDERQVQFLFYGGS  94

Query  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180
            DPPTP S GGL+ NGYRSDMISNYVEPMSPAASIESPRI+HEMPCFFSPR+TP+QSPMSA
Sbjct  95   DPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSA  154

Query  181  PIYSPHLFKISEQRTSRRSTGYYSMRYSR  209
            PIYSPHLFKI+EQRT+RRS GYY  R+SR
Sbjct  155  PIYSPHLFKIAEQRTTRRSAGYY--RFSR  181

>PHYSO_554653
Length=220

 Score = 232 bits (591),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 162/225 (72%), Gaps = 21/225 (9%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60
            MGLS+FF  +WD V  PFEDCTSCCDVLDPDYYRKTSPGVRR+PQMFNRW+HDVK+++  
Sbjct  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVG-  59

Query  61   SRPPSSLPP-FASSQVGTREHQSKTLsssgsrsgsnsdspsnysy-------------ee  106
            S PPS LPP F+ S V +  H  +T  S  S +  +  SPS+ S              EE
Sbjct  60   SNPPSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEE  119

Query  107  edeRQVQFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPA--ASIESPRINHEMP  164
            EDERQVQFLFYGGSDPPTPT  GG Y +GYRSDMIS Y++P  P   ASI SPRI+HEMP
Sbjct  120  EDERQVQFLFYGGSDPPTPT-GGGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMP  178

Query  165  CFFSPRDTPLQSPMSAPIYSPHLFKISEQRTSRRSTGYYSMRYSR  209
            CFFSPR TP  SPMSAPIYSPHLFKI+EQRT  R+  YY    SR
Sbjct  179  CFFSPRTTPT-SPMSAPIYSPHLFKITEQRT--RNAEYYRRYTSR  220

>PHYRA_78819
Length=200

 Score = 227 bits (579),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 161/209 (77%), Gaps = 9/209 (4%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60
            MG+S+FFHSVWD + RPFE+CTSCCDVLDP+YYRKTSPGVRRSPQMFNR+  DVKY+ + 
Sbjct  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDFSK  59

Query  61   SRPPSSLPPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGS  120
            SRPPSSL     S   +    ++  + S      ++   +    EEE+ER VQFLFYGGS
Sbjct  60   SRPPSSL---PPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGS  116

Query  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180
            DPPTPTSAGG    GYRSDMISNYVEP+SPAA   SPRINHEMPCFFSPR+TP QSPMSA
Sbjct  117  DPPTPTSAGG--PGGYRSDMISNYVEPISPAA-FASPRINHEMPCFFSPRNTPAQSPMSA  173

Query  181  PIYSPHLFKISEQRTSRRSTGYYSMRYSR  209
            PIYSPHLFKI+EQR  R S G+YS RYSR
Sbjct  174  PIYSPHLFKIAEQR-HRHSAGHYS-RYSR  200

>HYAP_01509
Length=208

 Score = 181 bits (460),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 146/211 (69%), Gaps = 11/211 (5%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60
            MG+S+  +++  FVCRPF DC+SC DVLD  YY KTSPGV  SPQMFNRWE+DVK+  T 
Sbjct  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTR  60

Query  61   SRPPSSLPPFA----SSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLF  116
            SRP  S  P      + + G  +  + + S   S S SN+ S  ++  EEE +R+VQFLF
Sbjct  61   SRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLF  120

Query  117  YGGSDPPTPTSAGGL-YSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQ  175
            YGGSDPPTPTS GGL  S GYRSDMIS+ V       SI SP+INHE+PCFFSPRDTP +
Sbjct  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-R  175

Query  176  SPMSAPIYSPHLFKISEQRTSRRSTGYYSMR  206
            S +SA +YSPH+FKI+EQ+  RR+    SMR
Sbjct  176  SSVSASMYSPHVFKITEQK-QRRNARLRSMR  205

>PHALS_10836
Length=204

 Score = 174 bits (442),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 136/206 (66%), Gaps = 7/206 (3%)

Query  3    LSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITPSR  62
            +S F   +WD VC+PFE C +CCDVLDP YYRK SPG RR+PQMFN W++D K  +TPS 
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDND-KNTLTPSY  59

Query  63   PPSSLPPFASSQV--GTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGS  120
            P SS P  +SS +    R + +K ++ S SRS S S +PS  ++EEE E Q+ FLFYGGS
Sbjct  60   PTSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFYGGS  119

Query  121  DPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSA  180
            D  +P + G      YR D+IS+  EP SP  SIESPRI+H+MPCFFS    PLQ PMS 
Sbjct  120  DSLSPKAVG----KRYRRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSD  175

Query  181  PIYSPHLFKISEQRTSRRSTGYYSMR  206
             IYS +L    +Q+  R  TG+ +MR
Sbjct  176  SIYSANLLGDIDQQGQRSGTGHCNMR  201

>PHYCA_97367
Length=191

 Score = 172 bits (436),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 129/212 (61%), Gaps = 31/212 (15%)

Query  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLD----PDYYRKTSPGVRRSPQMFNR--WEHDV  54
            MG+SDFF  VWDFVCRPFEDC SC +VLD    P YY KTSPGVRR+P  F+R  W++D+
Sbjct  1    MGVSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDL  60

Query  55   KYNITPSRPPSSLPPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQF  114
            KY+ + SRPP S  P  S  V          +S                       Q+QF
Sbjct  61   KYDFSLSRPPPSQSPANSRVVFPLSRSRSLSASRSLEED----------------EQIQF  104

Query  115  LFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPL  174
            LFY GSD  T   +  L S+GYRSD IS  ++P++     E PR++HE+PCFFSPRD PL
Sbjct  105  LFYSGSDIST---SDRLCSSGYRSDAISRPLQPIT-----EPPRLSHEIPCFFSPRDAPL  156

Query  175  QSPMSAPIYSPHLFKISEQRTSRRSTGYYSMR  206
             +PMSAPIYSPHLF ISEQR  R  + +YS R
Sbjct  157  MAPMSAPIYSPHLFMISEQR-GRSPSRHYSNR  187

>PPTG_07275
Length=184

 Score = 154 bits (390),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 123/191 (64%), Gaps = 18/191 (9%)

Query  10   VWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNR--WEHDVKYNITPSRPPSSL  67
            +WDF+ RPFEDC S CDVLDP YY KTSPGVRR+P  F+R  WE+D+KY+ +        
Sbjct  1    MWDFLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFS--------  52

Query  68   PPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGSDPPTPTS  127
                S    + +  S            +    ++  +EEE+E+QVQFLFYGGSD  TP S
Sbjct  53   ---LSRPPPSFQSSSSGRMQFTLSRSRSQSRSASVLHEEEEEQQVQFLFYGGSDISTPVS  109

Query  128  AGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPMSAPIYSPHL  187
             G L S+GYRSD+I     PM   +  + PRI+HE+PCFFSPRDTP+ SPMSAPIYSPHL
Sbjct  110  VGKLCSSGYRSDVICT---PMRLVS--QPPRISHEIPCFFSPRDTPMMSPMSAPIYSPHL  164

Query  188  FKISEQRTSRR  198
            F+I+EQR   R
Sbjct  165  FQINEQRWRLR  175

>PYVX_15869
Length=331

 Score = 105 bits (262),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 113/215 (53%), Gaps = 32/215 (15%)

Query  3    LSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITPSR  62
            LS ++ S   F+  PF DC + CD+  P      SPGV   PQ F R + D+KY+ T   
Sbjct  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAG-  199

Query  63   PPSSLPPFASSQVGTREHQSKTLsssgsrsgsnsdspsnysyeeedeRQVQFLFYGGSDP  122
             P S    + S    R  +SKT             S S  SY++  ++  QFLFY GSDP
Sbjct  200  -PISSSAASKSSSPARSTRSKT------------SSDSFLSYDDPYDQPTQFLFYCGSDP  246

Query  123  PTPTSAGGLYSNGYRSDMISNYVEPMSPAASIE--------SPRINHEMPCFFSPRDTPL  174
             TPTSA     NG ++D IS Y    +P A  E        SPRI+H++P FFSPR+ P 
Sbjct  247  LTPTSAQLAARNGLKTDTISGY----TPTAGAEPQVHTPLASPRISHQIPVFFSPRNAP-  301

Query  175  QSPMSAPIYSPHLFKISEQRTSRRSTGYYSMRYSR  209
             SP +AP+YSPHLF+I+E     R    Y MRYSR
Sbjct  302  TSPAAAPLYSPHLFRITE-----REYDPYFMRYSR  331

>PYU1_G003226
Length=206

 Score = 40.0 bits (92),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 38/77 (49%), Gaps = 9/77 (12%)

Query  110  RQVQFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIES--------PRINH  161
            +   F+FY GSD PT  +      NG  S   +      S AA + S        P+I+H
Sbjct  96   KNTDFMFYCGSDTPTSDAGQRNSFNGAASFSSTASASEFSEAAEVASEERAKVATPKISH  155

Query  162  EMPCFFSPRDT-PLQSP  177
            ++P FFSPR+  P+ +P
Sbjct  156  QIPVFFSPRNALPMPTP  172

>PYAP_20399
Length=135

 Score = 34.7 bits (78),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 8/63 (13%)

Query  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEP-----MSPAASIESPRINHEMPCFF  167
            QFLF+ GSD  +  +AG     GY+++   ++         S A+ I++P+I+H++P FF
Sbjct  68   QFLFFCGSDN-SGVAAG--RRTGYQTNHDFSFANAEVQARASRASEIQAPQISHKIPVFF  124

Query  168  SPR  170
            +P+
Sbjct  125  APQ  127

>PYAR_19462
Length=116

 Score = 33.9 bits (76),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (52%), Gaps = 20/62 (32%)

Query  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDT  172
            QFLF+ GSD    TSA        R+ + S         + IE+P I+H MP FF+P++ 
Sbjct  71   QFLFFCGSD----TSAA-------RASLKS---------SKIETPMISHRMPVFFNPQNA  110

Query  173  PL  174
             L
Sbjct  111  ML  112

>PYIW_19157
Length=262

 Score = 34.7 bits (78),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 41/101 (41%), Gaps = 24/101 (24%)

Query  110  RQVQFLFYGGSDPPTPT---SAGGLYS------------NGYRSDMISNYVEPMSPAASI  154
            +   F+FY G D P        GG +S            +G R+ M   +V         
Sbjct  95   KSTDFMFYCGFDTPKSEHGRGEGGGFSFSSSTAPSEFSDDGERASMDRVHVT--------  146

Query  155  ESPRINHEMPCFFSPRDTPLQSPMSAPIYSPHLFKISEQRT  195
             +P+++H++P FFSPR+     P   P   P   +IS  R 
Sbjct  147  -TPKLSHQIPVFFSPRNAVPMLPRPKPREKPRPLRISNTRA  186

>HYAP_01508
Length=132

 Score = 33.5 bits (75),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSP  169
            QFL + GSD  T TS   L S    + + S + +  +P  +   P IN  MP FF P
Sbjct  66   QFLLFCGSD--TATSPAELVSADG-TTLASRFAKLNAPGTAATQPVINRHMPVFFMP  119

>PHYSO_296556
Length=136

 Score = 32.3 bits (72),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDT  172
            QFLF+ G+D     SA    +NG  + + S      +PA +   P I+H MP FF P  +
Sbjct  68   QFLFFCGTDSSGSPSAELTAANG--TTLASRIASMNAPAPA--QPAIDHHMPVFFMPPLS  123

Query  173  PLQSPMSA  180
            P+   + A
Sbjct  124  PVAPELGA  131

>PYVX_15867
Length=187

 Score = 32.7 bits (73),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 10/72 (14%)

Query  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMS---PAASIESPRINHEMPCFFSP  169
            QFLF+ GSD  +  S  G  +N   S  ++  +  ++   PAA    P I+H+MP FF+P
Sbjct  112  QFLFFCGSD--SRDSGRGWKNNSPESTELAQRLTSLNFPMPAA----PAISHKMPVFFTP  165

Query  170  RD-TPLQSPMSA  180
               T   SP++A
Sbjct  166  AQPTQATSPLAA  177

>SDRG_10804
Length=1471

 Score = 32.7 bits (73),  Expect = 1.7, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (47%), Gaps = 7/58 (12%)

Query  122  PPT-----PTSAGGLYSNGYRSDMISNYVEP--MSPAASIESPRINHEMPCFFSPRDT  172
            PPT     P+      S GY+   + +  EP  +SP   + +PR  H++P  F P  T
Sbjct  104  PPTTMANVPSYMRQTVSRGYKEGTLQHPAEPSSVSPPKKVPTPRQAHKVPTSFKPTTT  161

>PYIR_14499
Length=186

 Score = 31.2 bits (69),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (47%), Gaps = 11/62 (18%)

Query  110  RQVQFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSP  169
            ++  F+FY G D P  T+   L    +              A+ + +P+I+  +P FFSP
Sbjct  95   KKTDFMFYCGFDTPNSTAPSDLDEEMHEER-----------ASLVATPKISRNIPVFFSP  143

Query  170  RD  171
            R+
Sbjct  144  RN  145

>PYVX_15863
Length=181

 Score = 30.8 bits (68),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 12/56 (21%)

Query  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFS  168
            +FLFYGGSD              ++ D+  ++++ + P+A    P +   MP FFS
Sbjct  116  EFLFYGGSD----------VDGAFKPDLRPSHLDLVQPSAI--RPVVKQHMPVFFS  159

>PHYRA_78818
Length=134

 Score = 29.6 bits (65),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 38/73 (52%), Gaps = 14/73 (19%)

Query  113  QFLFYGGSDPPTPTSA---GGLYS-NG-YRSDMISNYVEPMSPAASIESPRINHEMPCFF  167
            QFLF+ GSD    TSA   G L S NG   +  ++N   P +PA     P I+H MP FF
Sbjct  66   QFLFFCGSD----TSAFPSGELTSPNGSTLASRLANMTAP-TPA----QPAIDHHMPVFF  116

Query  168  SPRDTPLQSPMSA  180
             P  +P +  + A
Sbjct  117  MPPLSPTRPTLGA  129

>PHYKE_5719
Length=130

 Score = 29.6 bits (65),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query  113  QFLFYGGSDPPTPTSA---GGLYS-NGYRSDMISNYVEPMSPAASIESPRINHEMPCFFS  168
            QFLF+ GSD    TSA   G L S NG  S + S       P  +   P INH MP FF 
Sbjct  69   QFLFFCGSD----TSAFPSGELTSPNG--STLASRLASITCPTPA--QPAINHHMPVFFM  120

Query  169  PRDTP  173
            P  +P
Sbjct  121  PPLSP  125

Lambda      K        H        a         alpha
   0.319    0.134    0.429    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9941854329

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40