Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PPTG_07932828928911661e-161
PHYCA_120807423971341055432e-69
PHYCA_112118416261341055353e-68
PHYCA_13159382542425203e-64
PHYCA_504729440671831504919e-61
PHYCA_70656392411131074266e-52
PITG_0001081841114282e-51
PHYCA_559326453551821354231e-50
PPTG_2167826348104834056e-49
PHYCA_49721384681031024003e-48
PPTG_1466322920146983783e-44
PPTG_06351199722252053009e-32
PPTG_0379119179108732491e-25
PHYCA_53024375282691042583e-25
PHYRA_7808875282611052504e-24
PPTG_2494177543801632556e-24
PPTG_0333875282601042496e-24
PITG_0907275282611042488e-24
PHYSO_36201775282731112481e-23
PYAP_15403984871141072324e-23
PHYRA_7865668103471172254e-20
PITG_0817268103201152245e-20
H310_052931489191431032119e-20
PPTG_1426468103351152184e-19
H257_0615281501042084e-19
H310_097651498671151032029e-19
PHYSO_38364868103191152141e-18
H310_1330668102311022092e-18
PHYCA_51041568103371152089e-18
PHYKE_158868103331102081e-17
H257_076411414641871022001e-17
H310_046841487961081041922e-17
PHALS_0885768103521142043e-17
H310_025611483322561092004e-17
H310_152911516142341021986e-17
H310_14146151053109931871e-16
PYVX_1371968103171091972e-16
H310_152921516152301071932e-16
CCA1434668103251291963e-16
H310_083391495022301061915e-16
H257_191041475292141041905e-16
H257_0943468102571031919e-16
SDRG_15163151732921001911e-15
H310_128941507262571061891e-15
HYAP_1401068103031011902e-15
H310_078491493931921031852e-15
SPRG_088548412961932e-15
SDRG_136788415961913e-15
PHYCA_21476377821341391784e-15
SPRG_14160151733191271851e-14
H310_069331492172591031802e-14
H310_041201486681381031724e-14
SPRG_060301250931961271755e-14
H310_093731497191091001679e-14
H310_117551279882591031751e-13
H310_131061507792131061731e-13
H257_152221279882541041741e-13
H310_147381512712551021723e-13
PYAP_246091013864051011728e-13
SPRG_113201279882741011691e-12
H310_090711496731121101547e-12
H257_15150145202145981551e-11
PHYCA_51060644556741061455e-11
H310_128321475292581011547e-11
H257_15235145259178841517e-11
H310_14414151141169971491e-10
H310_1058115173241971521e-10
H310_033851485332231071512e-10
PHYCA_62751390881161081442e-10
H257_131701441411981081482e-10
H257_18152150419209981483e-10
SPRG_059291250402651001494e-10
H257_140131445542171071459e-10
SDRG_174061264412641081469e-10
SDRG_173901384462641081469e-10
H257_02519139347268981451e-09
CCI4749568102851051461e-09
SPRG_085731264412651041451e-09
H310_149541513621491071392e-09
H257_0625315173237981422e-09
PPTG_11368217821301191363e-09
H257_08032126788251961423e-09
PHYCA_104165408242311011414e-09
PPTG_14366228272831251415e-09
SDRG_12398126788264961415e-09
H257_123251436951911081386e-09
SPRG_09172126788265961406e-09
H257_003771386022231081397e-09
H257_056481406691721001367e-09
H257_180231467631281071321e-08
PHYCA_125686427852901361372e-08
H257_03945139940230871352e-08
PHYCA_96385400091351011302e-08
PHYCA_132727435852611061352e-08
PHYSO_254181462881541151313e-08
H310_04215126788257871353e-08
H257_17402130747149971303e-08
PHYKE_400149474961131373e-08
PHYSO_325763505281571111303e-08
H257_138891445001381001293e-08
H257_07657141475212981334e-08
SPRG_18521133223291921344e-08
H257_18551147094221911334e-08
H257_09054142124151991295e-08
SPRG_05316124701325921345e-08
SDRG_06597124701317921345e-08
PHYSO_47038156438145991286e-08
H310_153691516712091031316e-08
PHYSO_37628053990138991277e-08
PHYSO_37361353883130941259e-08
H310_04124148672811011221e-07
H257_009561387692021001281e-07
PHYSO_5480724947362981292e-07
H310_14154151059178451253e-07
PHYSO_38050554156138981223e-07
H257_19019147462229911263e-07
H257_04778140245147851223e-07
H257_139784945172801234e-07
PPTG_02416186271251071205e-07
PHYKE_61627528201631235e-07
PHYSO_45397655962138991205e-07
H257_166701460131361031205e-07
H257_049481403342471081247e-07
PYU1_G004359940552371011247e-07
H310_15068151450108981178e-07
H257_12998144050141991199e-07
H257_13434144330236971239e-07
PHYSO_43500155628138861189e-07
H310_044741487632101421221e-06
H310_116081503392211041221e-06
H257_19436147818199891211e-06
PHYCA_118350421801561011191e-06
H257_14759144959198971211e-06
PYIW_156371637162721321231e-06
PYAR_24700105891154881181e-06
H257_03208139630105611152e-06
PPTG_002724947436951232e-06
H257_144991448071701551182e-06
H257_14889145060157851172e-06
H310_15319141984227921202e-06
H310_11831150410490921213e-06
H310_13569138769205961173e-06
H310_128211506921791001163e-06
H257_17235146326186911164e-06
H310_151601515142001081174e-06
PHYSO_38959779261881041164e-06
PHYSO_33009751135203931165e-06
HYAP_006304945432931186e-06
H310_04318148723179441147e-06
PHYCA_50383349473131101178e-06
H310_13824150948169441139e-06
H310_127141506653771031161e-05
H257_07755141515181911121e-05
H310_042261440502361001141e-05
PPTG_0906321014273821141e-05
PHYRA_758774947406931151e-05
H257_07182141247209771122e-05
H310_118681504171171001072e-05
H257_16845146121209771112e-05
PPTG_11283217502601021122e-05
PPTG_04601194192601021122e-05
PYIW_26363165685144911073e-05
H257_09852142494165931084e-05
PPTG_06633200572921011114e-05
PITG_0582749473641001124e-05
SDRG_172661383602781101114e-05
H257_04751140229119961054e-05
SDRG_154991378572781101105e-05
H257_04666140196206831085e-05
H257_11942143472232981086e-05
H310_15161144330236931087e-05
PHYRA_748847926241991087e-05
H257_078711415652011081077e-05
PPTG_0584319760169691067e-05
PPTG_062894370240601087e-05
PPTG_0411819262274751097e-05
PHYRA_8661773140241991088e-05
H310_151081514761841531068e-05
H257_08837141984225981071e-04
PHYSO_37873154080138991031e-04
PHYSO_5364564370212621051e-04
H310_062621490902261001052e-04
H257_13212144181153841032e-04
PHYCA_1247124370202621042e-04
H257_18543147089323521062e-04
PHYSO_29581948124193911032e-04
PYU1_G00872895482234851042e-04
HYAP_0677812693224941042e-04
H310_04905148843153681013e-04
PPTG_204182105219971033e-04
H310_140751386022171071033e-04
H257_05272140485133821003e-04
H257_10707142908213521033e-04
SPRG_00310122252254391043e-04
PPTG_1608323457241831033e-04
H310_1384315095311848983e-04
PYIW_2556816510212664993e-04
H257_01994139112222861023e-04
PITG_15738126932271241024e-04
PPTG_2485415132911021034e-04
H310_1489815133914046994e-04
PYAR_2044999737231931024e-04
H310_09278149699156141995e-04
PPTG_22223268533719915e-04
PITG_051314370200481006e-04
PHYKE_69131269012651081046e-04
H257_08669141915212921007e-04
H257_009661387727877937e-04
H257_05356140520224981008e-04
PPTG_1114421711251821008e-04
PPTG_037971918321080998e-04
PYIW_22501126932791151009e-04
PITG_1268610320223122990.001
PITG_19098151732951221000.001
PPTG_169642373910481940.001
PITG_058254945410981000.001
PYVX_178081269323094980.001
PPTG_1528146288148128950.001
PHYRA_84895637315963960.001
PHYCA_389833799521795980.001
PYIW_2565816516814875950.001
PHYCA_609153893415248950.001
PHYCA_989714027529595980.002
PHYCA_48281517329595980.002
PYVX_238859407326129980.002
H257_1341614431723292970.002
PHYSO_2597754673621375960.002
PPTG_002704970924983960.003
SDRG_0465312770024374960.003
H310_143971445277951890.003
H257_1553014539323791950.003
PYAP_1770012693284102950.004
SPRG_1804513278621545940.004
H257_1530212913934449950.004
PPTG_1578723348126107900.004
PYAP_2266110050921881940.005
H257_0883914198615849920.005
PPTG_182961269324894930.006
PHYCA_1002207926265100930.006
H310_03462143096243107930.006
H257_1454614483418772920.006
PPTG_00266494543783940.006
PHYRA_9367812693217116920.007
H257_1043614277152749940.008
PYIW_2587416531620190910.008
PHYRA_758844970943291930.008
H310_1025715001130926930.009
PHYCA_1292304312114148890.009
H310_1187515041917251900.010
H257_1232314369317887900.010
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PPTG_07932

Length=289
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PPTG_07932                                                            453        1e-161
PHYCA_120807                                                          213        2e-69 
PHYCA_112118                                                          210        3e-68 
PHYCA_131593                                                          204        3e-64 
PHYCA_504729                                                          193        9e-61 
PHYCA_70656                                                           168        6e-52 
PITG_00010                                                            169        2e-51 
PHYCA_559326                                                          167        1e-50 
PPTG_21678                                                            160        6e-49 
PHYCA_49721                                                           158        3e-48 
PPTG_14663                                                            150        3e-44 
PPTG_06351                                                            120        9e-32 
PPTG_03791                                                            100        1e-25 
PHYCA_530243                                                          103        3e-25 
PHYRA_78088                                                           100        4e-24 
PPTG_24941                                                            102        6e-24 
PPTG_03338                                                            100        6e-24 
PITG_09072                                                            100        8e-24 
PHYSO_362017                                                          100        1e-23 
PYAP_15403                                                            94.0       4e-23 
PHYRA_78656                                                           91.3       4e-20 
PITG_08172                                                            90.9       5e-20 
H310_05293                                                            85.9       9e-20 
PPTG_14264                                                            88.6       4e-19 
H257_06152                                                            84.7       4e-19 
H310_09765                                                            82.4       9e-19 
PHYSO_383648                                                          87.0       1e-18 
H310_13306                                                            85.1       2e-18 
PHYCA_510415                                                          84.7       9e-18 
PHYKE_1588                                                            84.7       1e-17 
H257_07641                                                            81.6       1e-17 
H310_04684                                                            78.6       2e-17 
PHALS_08857                                                           83.2       3e-17 
H310_02561                                                            81.6       4e-17 
H310_15291                                                            80.9       6e-17 
H310_14146                                                            76.6       1e-16 
PYVX_13719                                                            80.5       2e-16 
H310_15292                                                            79.0       2e-16 
CCA14346                                                              80.1       3e-16 
H310_08339                                                            78.2       5e-16 
H257_19104                                                            77.8       5e-16 
H257_09434                                                            78.2       9e-16 
SDRG_15163                                                            78.2       1e-15 
H310_12894                                                            77.4       1e-15 
HYAP_14010                                                            77.8       2e-15 
H310_07849                                                            75.9       2e-15 
SPRG_08854                                                            79.0       2e-15 
SDRG_13678                                                            78.2       3e-15 
PHYCA_21476                                                           73.2       4e-15 
SPRG_14160                                                            75.9       1e-14 
H310_06933                                                            73.9       2e-14 
H310_04120                                                            70.9       4e-14 
SPRG_06030                                                            72.0       5e-14 
H310_09373                                                            68.9       9e-14 
H310_11755                                                            72.0       1e-13 
H310_13106                                                            71.2       1e-13 
H257_15222                                                            71.6       1e-13 
H310_14738                                                            70.9       3e-13 
PYAP_24609                                                            70.9       8e-13 
SPRG_11320                                                            69.7       1e-12 
H310_09071                                                            63.9       7e-12 
H257_15150                                                            64.3       1e-11 
PHYCA_510606                                                          60.5       5e-11 
H310_12832                                                            63.9       7e-11 
H257_15235                                                            62.8       7e-11 
H310_14414                                                            62.0       1e-10 
H310_10581                                                            63.2       1e-10 
H310_03385                                                            62.8       2e-10 
PHYCA_62751                                                           60.1       2e-10 
H257_13170                                                            61.6       2e-10 
H257_18152                                                            61.6       3e-10 
SPRG_05929                                                            62.0       4e-10 
H257_14013                                                            60.5       9e-10 
SDRG_17406                                                            60.8       9e-10 
SDRG_17390                                                            60.8       9e-10 
H257_02519                                                            60.5       1e-09 
CCI47495                                                              60.8       1e-09 
SPRG_08573                                                            60.5       1e-09 
H310_14954                                                            58.2       2e-09 
H257_06253                                                            59.3       2e-09 
PPTG_11368                                                            57.0       3e-09 
H257_08032                                                            59.3       3e-09 
PHYCA_104165                                                          58.9       4e-09 
PPTG_14366                                                            58.9       5e-09 
SDRG_12398                                                            58.9       5e-09 
H257_12325                                                            57.8       6e-09 
SPRG_09172                                                            58.5       6e-09 
H257_00377                                                            58.2       7e-09 
H257_05648                                                            57.0       7e-09 
H257_18023                                                            55.5       1e-08 
PHYCA_125686                                                          57.4       2e-08 
H257_03945                                                            56.6       2e-08 
PHYCA_96385                                                           54.7       2e-08 
PHYCA_132727                                                          56.6       2e-08 
PHYSO_254181                                                          55.1       3e-08 
H310_04215                                                            56.6       3e-08 
H257_17402                                                            54.7       3e-08 
PHYKE_4001                                                            57.4       3e-08 
PHYSO_325763                                                          54.7       3e-08 
H257_13889                                                            54.3       3e-08 
H257_07657                                                            55.8       4e-08 
SPRG_18521                                                            56.2       4e-08 
H257_18551                                                            55.8       4e-08 
H257_09054                                                            54.3       5e-08 
SPRG_05316                                                            56.2       5e-08 
SDRG_06597                                                            56.2       5e-08 
PHYSO_470381                                                          53.9       6e-08 
H310_15369                                                            55.1       6e-08 
PHYSO_376280                                                          53.5       7e-08 
PHYSO_373613                                                          52.8       9e-08 
H310_04124                                                            51.6       1e-07 
H257_00956                                                            53.9       1e-07 
PHYSO_548072                                                          54.3       2e-07 
H310_14154                                                            52.8       3e-07 
PHYSO_380505                                                          51.6       3e-07 
H257_19019                                                            53.1       3e-07 
H257_04778                                                            51.6       3e-07 
H257_13978                                                            52.0       4e-07 
PPTG_02416                                                            50.8       5e-07 
PHYKE_6162                                                            52.0       5e-07 
PHYSO_453976                                                          50.8       5e-07 
H257_16670                                                            50.8       5e-07 
H257_04948                                                            52.4       7e-07 
PYU1_G004359                                                          52.4       7e-07 
H310_15068                                                            49.7       8e-07 
H257_12998                                                            50.4       9e-07 
H257_13434                                                            52.0       9e-07 
PHYSO_435001                                                          50.1       9e-07 
H310_04474                                                            51.6       1e-06 
H310_11608                                                            51.6       1e-06 
H257_19436                                                            51.2       1e-06 
PHYCA_118350                                                          50.4       1e-06 
H257_14759                                                            51.2       1e-06 
PYIW_15637                                                            52.0       1e-06 
PYAR_24700                                                            50.1       1e-06 
H257_03208                                                            48.9       2e-06 
PPTG_00272                                                            52.0       2e-06 
H257_14499                                                            50.1       2e-06 
H257_14889                                                            49.7       2e-06 
H310_15319                                                            50.8       2e-06 
H310_11831                                                            51.2       3e-06 
H310_13569                                                            49.7       3e-06 
H310_12821                                                            49.3       3e-06 
H257_17235                                                            49.3       4e-06 
H310_15160                                                            49.7       4e-06 
PHYSO_389597                                                          49.3       4e-06 
PHYSO_330097                                                          49.3       5e-06 
HYAP_00630                                                            50.1       6e-06 
H310_04318                                                            48.5       7e-06 
PHYCA_503833                                                          49.7       8e-06 
H310_13824                                                            48.1       9e-06 
H310_12714                                                            49.3       1e-05 
H257_07755                                                            47.8       1e-05 
H310_04226                                                            48.5       1e-05 
PPTG_09063                                                            48.5       1e-05 
PHYRA_75877                                                           48.9       1e-05 
H257_07182                                                            47.8       2e-05 
H310_11868                                                            45.8       2e-05 
H257_16845                                                            47.4       2e-05 
PPTG_11283                                                            47.8       2e-05 
PPTG_04601                                                            47.8       2e-05 
PYIW_26363                                                            45.8       3e-05 
H257_09852                                                            46.2       4e-05 
PPTG_06633                                                            47.4       4e-05 
PITG_05827                                                            47.8       4e-05 
SDRG_17266                                                            47.4       4e-05 
H257_04751                                                            45.1       4e-05 
SDRG_15499                                                            47.0       5e-05 
H257_04666                                                            46.2       5e-05 
H257_11942                                                            46.2       6e-05 
H310_15161                                                            46.2       7e-05 
PHYRA_74884                                                           46.2       7e-05 
H257_07871                                                            45.8       7e-05 
PPTG_05843                                                            45.4       7e-05 
PPTG_06289                                                            46.2       7e-05 
PPTG_04118                                                            46.6       7e-05 
PHYRA_86617                                                           46.2       8e-05 
H310_15108                                                            45.4       8e-05 
H257_08837                                                            45.8       1e-04 
PHYSO_378731                                                          44.3       1e-04 
PHYSO_536456                                                          45.1       1e-04 
H310_06262                                                            45.1       2e-04 
H257_13212                                                            44.3       2e-04 
PHYCA_124712                                                          44.7       2e-04 
H257_18543                                                            45.4       2e-04 
PHYSO_295819                                                          44.3       2e-04 
PYU1_G008728                                                          44.7       2e-04 
HYAP_06778                                                            44.7       2e-04 
H310_04905                                                            43.5       3e-04 
PPTG_20418                                                            44.3       3e-04 
H310_14075                                                            44.3       3e-04 
H257_05272                                                            43.1       3e-04 
H257_10707                                                            44.3       3e-04 
SPRG_00310                                                            44.7       3e-04 
PPTG_16083                                                            44.3       3e-04 
H310_13843                                                            42.4       3e-04 
PYIW_25568                                                            42.7       3e-04 
H257_01994                                                            43.9       3e-04 
PITG_15738                                                            43.9       4e-04 
PPTG_24854                                                            44.3       4e-04 
H310_14898                                                            42.7       4e-04 
PYAR_20449                                                            43.9       4e-04 
H310_09278                                                            42.7       5e-04 
PPTG_22223                                                            39.7       5e-04 
PITG_05131                                                            43.1       6e-04 
PHYKE_6913                                                            44.7       6e-04 
H257_08669                                                            43.1       7e-04 
H257_00966                                                            40.4       7e-04 
H257_05356                                                            43.1       8e-04 
PPTG_11144                                                            43.1       8e-04 
PPTG_03797                                                            42.7       8e-04 
PYIW_22501                                                            43.1       9e-04 
PITG_12686                                                            42.7       0.001 
PITG_19098                                                            43.1       0.001 
PPTG_16964                                                            40.8       0.001 
PITG_05825                                                            43.1       0.001 
PYVX_17808                                                            42.4       0.001 
PPTG_15281                                                            41.2       0.001 
PHYRA_84895                                                           41.6       0.001 
PHYCA_38983                                                           42.4       0.001 
PYIW_25658                                                            41.2       0.001 
PHYCA_60915                                                           41.2       0.001 
PHYCA_98971                                                           42.4       0.002 
PHYCA_4828                                                            42.4       0.002 
PYVX_23885                                                            42.4       0.002 
H257_13416                                                            42.0       0.002 
PHYSO_259775                                                          41.6       0.002 
PPTG_00270                                                            41.6       0.003 
SDRG_04653                                                            41.6       0.003 
H310_14397                                                            38.9       0.003 
H257_15530                                                            41.2       0.003 
PYAP_17700                                                            41.2       0.004 
SPRG_18045                                                            40.8       0.004 
H257_15302                                                            41.2       0.004 
PPTG_15787                                                            39.3       0.004 
PYAP_22661                                                            40.8       0.005 
H257_08839                                                            40.0       0.005 
PPTG_18296                                                            40.4       0.006 
PHYCA_100220                                                          40.4       0.006 
H310_03462                                                            40.4       0.006 
H257_14546                                                            40.0       0.006 
PPTG_00266                                                            40.8       0.006 
PHYRA_93678                                                           40.0       0.007 
H257_10436                                                            40.8       0.008 
PYIW_25874                                                            39.7       0.008 
PHYRA_75884                                                           40.4       0.008 
H310_10257                                                            40.4       0.009 
PHYCA_129230                                                          38.9       0.009 
H310_11875                                                            39.3       0.010 
H257_12323                                                            39.3       0.010 
H257_06101                                                            40.0       0.011 
PHYRA_75881                                                           40.0       0.011 
H310_03851                                                            37.7       0.011 
PYIR_20491                                                            39.7       0.011 
PHYRA_86856                                                           40.0       0.012 
PHYSO_560624                                                          40.0       0.012 
PHYCA_504134                                                          39.3       0.013 
H257_11101                                                            39.7       0.013 
PHYSO_516255                                                          39.7       0.015 
PPTG_07779                                                            38.1       0.015 
PPTG_15516                                                            39.7       0.015 
H257_06895                                                            38.9       0.016 
PITG_02413                                                            38.9       0.016 
H257_19488                                                            36.2       0.016 
PITG_00212                                                            39.7       0.017 
SDRG_17294                                                            36.2       0.017 
H310_04308                                                            38.1       0.017 
PHYCA_14089                                                           38.9       0.017 
PHYSO_317488                                                          39.3       0.019 
PITG_08385                                                            38.5       0.023 
H257_12986                                                            38.9       0.024 
H257_09605                                                            38.5       0.025 
PPTG_06723                                                            37.7       0.025 
PHYSO_389268                                                          37.0       0.026 
HYAP_09695                                                            38.9       0.030 
PYAP_23972                                                            38.9       0.030 
PPTG_08500                                                            38.5       0.033 
H310_14301                                                            38.1       0.035 
PITG_09590                                                            37.7       0.036 
H257_14753                                                            36.2       0.040 
PPTG_15314                                                            37.0       0.043 
H257_18379                                                            37.0       0.046 
H310_14557                                                            37.4       0.059 
H257_09254                                                            36.2       0.065 
H257_18654                                                            36.6       0.069 
H257_01792                                                            36.6       0.069 
PHYSO_474101                                                          36.6       0.076 
H257_01534                                                            36.6       0.083 
H257_13222                                                            36.6       0.087 
PHYSO_354699                                                          36.6       0.11  
PHYRA_72572                                                           37.0       0.11  
PYIW_15058                                                            35.4       0.11  
H310_03463                                                            33.5       0.11  
PPTG_10963                                                            37.0       0.12  
PHYSO_448112                                                          34.7       0.15  
PHYSO_336240                                                          35.4       0.15  
PPTG_19779                                                            36.2       0.19  
H310_10921                                                            34.7       0.19  
PYU1_G010696                                                          36.2       0.19  
PHYSO_492787                                                          34.7       0.21  
PYAR_18387                                                            36.2       0.22  
H257_03272                                                            34.7       0.26  
H310_10580                                                            35.0       0.28  
PHYSO_377140                                                          33.9       0.29  
H257_12985                                                            35.0       0.29  
H257_01598                                                            34.7       0.33  
PHYRA_78761                                                           34.7       0.35  
PHYKE_2287                                                            35.0       0.41  
SPRG_10836                                                            32.7       0.49  
H257_16479                                                            33.5       0.53  
PYU1_G003801                                                          34.3       0.66  
PPTG_19441                                                            33.9       0.79  
SPRG_06424                                                            33.9       0.80  
PYVX_19651                                                            34.3       0.80  
SDRG_08699                                                            33.5       0.89  
H310_02451                                                            33.1       0.96  
H257_00165                                                            34.3       0.96  
SDRG_10998                                                            33.5       1.1   
H257_13960                                                            33.5       1.1   
PPTG_20170                                                            33.5       1.2   
H310_08075                                                            33.1       1.2   
PHYSO_322347                                                          33.1       1.3   
PHYKE_2762                                                            33.5       1.6   
PPTG_13524                                                            30.4       1.9   
PPTG_17030                                                            31.2       1.9   
H257_10999                                                            32.7       2.1   
H257_14496                                                            32.7       2.1   
H257_11329                                                            30.4       2.1   
SPRG_02266                                                            32.7       2.2   
H257_14913                                                            32.0       2.2   
H257_19278                                                            30.8       2.2   
H310_04766                                                            32.0       2.2   
PYU1_G011169                                                          33.1       2.2   
H310_15352                                                            32.0       2.2   
PYIW_27159                                                            31.2       2.3   
H310_04868                                                            32.3       2.4   
H257_13311                                                            32.7       2.5   
PHYSO_340790                                                          32.3       3.0   
PHYSO_340307                                                          32.3       3.5   
SPRG_18357                                                            30.4       3.8   
H310_01591                                                            32.0       4.5   
CCA20079                                                              30.4       4.6   
H257_19337                                                            31.2       5.4   
H310_06640                                                            30.8       5.7   
PHYRA_86817                                                           31.2       6.0   
PHYRA_74556                                                           31.2       6.2   
PYAR_21393                                                            31.2       6.2   
H310_03921                                                            30.0       6.8   
H257_18151                                                            30.4       6.9   
H310_15181                                                            29.6       7.5   
SDRG_10751                                                            30.8       7.7   
SDRG_12223                                                            30.4       7.8   
SDRG_14585                                                            30.4       7.8   
H310_03294                                                            30.4       7.9   
PYAR_15954                                                            31.2       8.7   
PHYKE_8558                                                            29.6       8.9   
SPRG_04833                                                            30.8       9.1   
H310_14152                                                            29.3       9.3   
CCI48126                                                              30.8       9.8   

>PPTG_07932
Length=289

 Score = 453 bits (1166),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%), Gaps = 0/289 (0%)

Query  1    MWEEVRYISSLRTVTTSNNQKRVAREPKKVAWLTKLPASKKTPPSQRKSPAGATDTQSKR  60
            MWEEVRYISSLRTVTTSNNQKRVAREPKKVAWLTKLPASKKTPPSQRKSPAGATDTQSKR
Sbjct  1    MWEEVRYISSLRTVTTSNNQKRVAREPKKVAWLTKLPASKKTPPSQRKSPAGATDTQSKR  60

Query  61   KKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRF  120
            KKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRF
Sbjct  61   KKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRF  120

Query  121  NALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekekkeaerrd  180
            NALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQAKADKTEKEKKEAERRD
Sbjct  121  NALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQAKADKTEKEKKEAERRD  180

Query  181  rasadVVQSAMEGIRRSRSKSPEDDVSTPssskkkkrssTEALVEFLDAKAETRSTREKq  240
            RASADVVQSAMEGIRRSRSKSPEDDVSTPSSSKKKKRSSTEALVEFLDAKAETRSTREKQ
Sbjct  181  RASADVVQSAMEGIRRSRSKSPEDDVSTPSSSKKKKRSSTEALVEFLDAKAETRSTREKQ  240

Query  241  kerqlhleerrlaleeqrlqqdreKTDKLMEMMASQMGLMSKLIEKINK  289
            KERQLHLEERRLALEEQRLQQDREKTDKLMEMMASQMGLMSKLIEKINK
Sbjct  241  KERQLHLEERRLALEEQRLQQDREKTDKLMEMMASQMGLMSKLIEKINK  289

>PHYCA_120807
Length=134

 Score = 213 bits (543),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/105 (96%), Positives = 104/105 (99%), Gaps = 0/105 (0%)

Query  54   TDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG  113
            +D QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGET+VSWSSVAIGLKTALPSCTADG
Sbjct  22   SDAQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETEVSWSSVAIGLKTALPSCTADG  81

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            KACRRRFNALLDVFRRDELESLRASG+AEDFEEREQLLTDCMALV
Sbjct  82   KACRRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMALV  126

>PHYCA_112118
Length=134

 Score = 210 bits (535),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/105 (94%), Positives = 101/105 (96%), Gaps = 0/105 (0%)

Query  54   TDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG  113
            +D QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGE QVSWSSVAIGLKT LPSCT DG
Sbjct  22   SDAQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGEAQVSWSSVAIGLKTTLPSCTGDG  81

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            KACRRRFNALLDVFRRDELESLRASG+AEDFEEREQLLTDCMALV
Sbjct  82   KACRRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMALV  126

>PHYCA_131593
Length=254

 Score = 204 bits (520),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 190/242 (79%), Gaps = 9/242 (4%)

Query  43   PPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL  102
            P          TDT+ KRKKAFRF+PSSD++LLKE +KH PWAAGH +T+ +W  VA G+
Sbjct  22   PGGGGGGGVAGTDTK-KRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGM  80

Query  103  KTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECL  162
            K +LP CTADGKACRRRF  L++VF+R+ELESLRASGT E +EEREQLLTDC  L D+  
Sbjct  81   KASLPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELADK--  138

Query  163  QakadktekekkeaerrdrasadVVQSAMEGIRRSRSKSPEDDVSTPssskkkkrssTEA  222
                  TEKEK++AERR+  SAD+V+SAM+G+R  R+ S + +++TP S+KKKKRSST+A
Sbjct  139  ------TEKEKRDAERREATSADIVRSAMQGMRNKRALSTDTELATPPSTKKKKRSSTDA  192

Query  223  LVEFLDAKAETRSTREKqkerqlhleerrlaleeqrlqqdreKTDKLMEMMASQMGLMSK  282
            L+ FL+ +A +R+ R   KERQLH++ERRLALEEQRLQQD++KTD+++ MM+SQMGLM +
Sbjct  193  LLGFLEDRASSRNNRHSLKERQLHIDERRLALEEQRLQQDKDKTDRMLAMMSSQMGLMVQ  252

Query  283  LI  284
            LI
Sbjct  253  LI  254

>PHYCA_504729
Length=183

 Score = 193 bits (491),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 5/150 (3%)

Query  43   PPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL  102
            PP+  +SP     + SKRKKAFRFVPSSDI+LLKE +KHRPWAA HGET  +W+SVA GL
Sbjct  11   PPNPVRSP-----SISKRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGL  65

Query  103  KTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECL  162
            K AL SCTADGKACRRRFN LL+VFRRDELESLRASG+AED+EEREQLLTDCM L +E  
Sbjct  66   KAALTSCTADGKACRRRFNTLLEVFRRDELESLRASGSAEDYEEREQLLTDCMTLYNEHA  125

Query  163  QakadktekekkeaerrdrasadVVQSAME  192
            QAKADKTEKEK+EAERR+ ASA+VVQ AME
Sbjct  126  QAKADKTEKEKREAERRESASAEVVQRAME  155

>PHYCA_70656
Length=113

 Score = 168 bits (426),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 5/107 (5%)

Query  43   PPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL  102
            PP+  +SP     + SKRKKAFRFVPSSDI+LLKE +KHRPWAA HGET  +W+SVA GL
Sbjct  12   PPNPVRSP-----SISKRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGL  66

Query  103  KTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQ  149
            K AL SCTADGKACRRRFN LL+VFRRDELESLRASG+AED+EEREQ
Sbjct  67   KAALTSCTADGKACRRRFNTLLEVFRRDELESLRASGSAEDYEEREQ  113

>PITG_00010
Length=184

 Score = 169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 2/111 (2%)

Query  49   SPAGATD--TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL  106
            +P  A D   Q KRKKAFRF+PSSD++LLKE +KH PWAAGHG+T+ +W  VA G+K AL
Sbjct  35   APGDAADDSAQKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL  94

Query  107  PSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            P CTADGKACRRRF  L++VF+R+ELESLRASGT ED+EEREQLLTDC  L
Sbjct  95   PLCTADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145

>PHYCA_559326
Length=182

 Score = 167 bits (423),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 0/135 (0%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            SKRKKAF F PSSDI+L KE +K RPWAA HGET  +W+S A  LK AL SCTADG ACR
Sbjct  21   SKRKKAFNFGPSSDIMLFKEVLKRRPWAASHGETLAAWTSFATRLKAALTSCTADGNACR  80

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekekkeae  177
            RRFN LL VF RDELESLRASG+AED+EEREQLLTDCM L +E  QAKADKTEKEK+E+E
Sbjct  81   RRFNTLLGVFCRDELESLRASGSAEDYEEREQLLTDCMTLYNEHAQAKADKTEKEKRESE  140

Query  178  rrdrasadVVQSAME  192
            RR+ AS +VVQ AME
Sbjct  141  RRELASVEVVQIAME  155

>PPTG_21678
Length=104

 Score = 160 bits (405),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 78/83 (94%), Gaps = 0/83 (0%)

Query  54   TDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG  113
            +DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVS SS AIGLKTALPSCTADG
Sbjct  22   SDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSLSSFAIGLKTALPSCTADG  81

Query  114  KACRRRFNALLDVFRRDELESLR  136
            KACRRRFNA LDVFRRDELE  R
Sbjct  82   KACRRRFNAPLDVFRRDELEFRR  104

>PHYCA_49721
Length=103

 Score = 158 bits (400),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 85/102 (83%), Gaps = 0/102 (0%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKA  115
            T+ KRKKAFRF+ SSD++LLKE VKH PW+AGHGETQV+W  VA G+K ALP+C ADGKA
Sbjct  2    TKQKRKKAFRFLQSSDVVLLKEVVKHTPWSAGHGETQVAWEKVASGIKEALPACIADGKA  61

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            CRRRF AL D FRR+E+ESLRA GT+E++ EREQLLTD   L
Sbjct  62   CRRRFGALYDAFRREEMESLRALGTSEEYTEREQLLTDLTEL  103

>PPTG_14663
Length=146

 Score = 150 bits (378),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 80/98 (82%), Gaps = 0/98 (0%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRR  119
            RKKAFRF+PSSD+LLLKE   H PWAA HGET  +W++VA  LK A+ + TAD KACRRR
Sbjct  30   RKKAFRFLPSSDVLLLKEVTAHTPWAAAHGETNTAWTTVANELKNAISASTADDKACRRR  89

Query  120  FNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            F ALLD FRR+E++SLR SGTAE++ EREQLLTDC+ L
Sbjct  90   FTALLDTFRREEMKSLRVSGTAEEYREREQLLTDCLEL  127

>PPTG_06351
Length=225

 Score = 120 bits (300),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 142/205 (69%), Gaps = 14/205 (7%)

Query  88   HGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEER  147
            HG+T V+W  VA G+  ALP+CTADGK CRR F AL D FRR+E ESLRASGT+E++ ER
Sbjct  17   HGKTPVAWEKVASGINAALPACTADGKVCRRPFGALHDAFRREEKESLRASGTSEEYTER  76

Query  148  EQLLTDCMALVDECLQakadktekekkeaerrdrasadVVQSAMEGIRRSRSKSPE-DDV  206
            EQLLTD   L       KADKTEKEK++AE R+ A+A+VV+ A+ G+RR+RS SPE +  
Sbjct  77   EQLLTDRTEL------EKADKTEKEKRDAEAREAATAEVVRDALVGLRRTRSSSPEYEQQ  130

Query  207  STPssskkkkrssTEALVEFLDAKAETRSTREKqkerqlh-------leerrlaleeqrl  259
            +T   SK+ K+S TE   ++L+ KA  R  R + +++Q         +EERRL  E +R 
Sbjct  131  TTTPPSKRSKQSHTERSSDYLEGKAAERKARVEGRQQQHALEERCLDIEERRLNHERERN  190

Query  260  qqdreKTDKLMEMMASQMGLMSKLI  284
            +Q+R++ DK M MM+S+M +M+KLI
Sbjct  191  KQERDRNDKFMAMMSSKMHMMAKLI  215

>PPTG_03791
Length=108

 Score = 100 bits (249),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 57/73 (78%), Gaps = 5/73 (7%)

Query  44   PSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLK  103
            P+  +SP     + SKRKKAFRFVPSSDI+LLKEA+KHRPWAA HGET  +W+SVA GLK
Sbjct  9    PNPARSP-----SISKRKKAFRFVPSSDIMLLKEALKHRPWAAIHGETLAAWTSVATGLK  63

Query  104  TALPSCTADGKAC  116
             AL SC AD KAC
Sbjct  64   VALTSCAADDKAC  76

>PHYCA_530243
Length=269

 Score = 103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 66/104 (63%), Gaps = 0/104 (0%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116
              KR KAFRF   +D LLL+E + H+PW+  HG+   +W  VA+G K  +P  T DG+AC
Sbjct  38   HDKRAKAFRFTTVTDTLLLREVLDHKPWSCSHGDMAKTWDVVAVGFKRLVPWSTNDGRAC  97

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            +RR+ AL + +  ++L+ LR SGT     +RE+LL+ C  L DE
Sbjct  98   KRRYLALAEAYGTEKLQKLRGSGTPAQNAQRERLLSQCQLLTDE  141

>PHYRA_78088
Length=261

 Score = 100 bits (250),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 63/105 (60%), Gaps = 0/105 (0%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116
              KR KAFRF   +DI LL+E + H+PWA  HG+   +W  VA   K  +P  T DG+AC
Sbjct  30   HDKRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWDVVATAFKRIVPWSTNDGRAC  89

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            +RR+ AL + +   +L  LR SGT +   +RE+LL  C AL +E 
Sbjct  90   KRRYLALAEAYGTQKLHKLRGSGTPQMNAQREKLLAQCKALTEEA  134

>PPTG_24941
Length=380

 Score = 102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 127/163 (78%), Gaps = 1/163 (1%)

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekekkeaerrdrasa  184
            D F R+ELESLRASG AED+EEREQLLTDC  L +   Q +     ++K++AERR+ ASA
Sbjct  208  DAFTREELESLRASGAAEDYEEREQLLTDCFELTERHAQ-QKADKTEKKRDAERREAASA  266

Query  185  dVVQSAMEGIRRSRSKSPEDDVSTPssskkkkrssTEALVEFLDAKAETRSTREKqkerq  244
            D+V+SAMEG+R  R+ S + D++TP S+KKKKRS T+AL+ FL+ +A +R+ R+  KERQ
Sbjct  267  DIVRSAMEGMRNKRALSSDTDLATPPSTKKKKRSGTDALLGFLEDRASSRNNRDSLKERQ  326

Query  245  lhleerrlaleeqrlqqdreKTDKLMEMMASQMGLMSKLIEKI  287
            L +EERRL LEE R QQ+++KTD+++ +M S+MGLM++LIE+ 
Sbjct  327  LQVEERRLTLEEHRPQQNKDKTDRMLAIMPSEMGLMAQLIERY  369

>PPTG_03338
Length=260

 Score = 100 bits (249),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 0/104 (0%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116
              KR KAFRF   +DI LL+E + H+PWA+ HG+   +W  VA   K  +P  T DG+AC
Sbjct  27   HDKRAKAFRFTTVTDIALLREVIDHKPWASSHGDMAKTWEVVAAAFKRIVPWSTNDGRAC  86

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            +RR+ AL++ +  ++L+ LR +GT     ER +LL  C  + DE
Sbjct  87   KRRYLALIEAYGSEKLQKLRGAGTPAMNAERAKLLAQCQLMTDE  130

>PITG_09072
Length=261

 Score = 100 bits (248),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (61%), Gaps = 0/104 (0%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116
              KR KAFRF   +DI LL+E + H+PWA  HG+   +W  VA   K  +P  T DG+AC
Sbjct  28   HDKRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWEVVATAFKRIVPWSTNDGRAC  87

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            +RR+ AL++ +  ++L+ LR +GT     ER +LL  C  + DE
Sbjct  88   KRRYLALMEAYGSEKLQKLRGAGTPAMNAERAKLLMQCQIMTDE  131

>PHYSO_362017
Length=273

 Score = 100 bits (248),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 0/111 (0%)

Query  53   ATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD  112
            A     KR KAFRF   +DI LL+E + H+PWA+ HG+   +W  VA   K  +P  T D
Sbjct  39   AVRIHEKRAKAFRFTTVTDIALLREVINHKPWASSHGDMAKTWDVVAAAFKRTVPWSTND  98

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            G+AC+RR+ AL + +   +L+ LR SGT     +RE LL  C A+ +E L+
Sbjct  99   GRACKRRYLALAEAYGTAKLQKLRGSGTPVMNAQRESLLAQCHAMTEEDLR  149

>PYAP_15403
Length=114

 Score = 94.0 bits (232),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 5/107 (5%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG---  113
            Q   ++ FRF PS D+LLL+E  + +PWAA HGET  SW ++     T L     +G   
Sbjct  8    QEANRRTFRFKPSHDVLLLREIARLKPWAALHGETMSSWEAIGQAFNTQLAVVRPNGPEI  67

Query  114  --KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
              +AC+RR+ AL+D F   +L SLR+SG+AE+  ERE+L+ +    V
Sbjct  68   DARACQRRYKALIDSFLSGDLASLRSSGSAEEINEREELIAEVHQAV  114

>PHYRA_78656
Length=347

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 70/117 (60%), Gaps = 9/117 (8%)

Query  53   ATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA-  111
            A D    +++ FRF P+ D++L++E ++  PWAAG+G T+ +W SVA+ ++TAL S    
Sbjct  40   AEDDDGGKRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVALRVQTALESLKGV  99

Query  112  --------DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
                    D    +RR + LLD FR+ E+  LR SG+ E+F+ R +LL     +VDE
Sbjct  100  AFTRGSALDHAIVKRRVDMLLDAFRKSEMSGLRGSGSPEEFDLRNKLLAILARVVDE  156

>PITG_08172
Length=320

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 70/115 (61%), Gaps = 9/115 (8%)

Query  55   DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA---  111
            D    +++ FRF P+ D++L++E ++  PWAAG+G T+ +W +VA  ++TAL S      
Sbjct  12   DAAGGKRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQTALESLKGVVF  71

Query  112  ------DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
                  D    +RR + LL+ FR++EL +LR SGT E+F+ R +LL     +VDE
Sbjct  72   TRGSALDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLLAILARVVDE  126

>H310_05293
Length=143

 Score = 85.9 bits (211),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 62/103 (60%), Gaps = 11/103 (11%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKA--  115
            +KRK AFRF  +SD+ LLKE +  +P+ A +G  +  W  VA  +      C   G    
Sbjct  5    AKRKAAFRFKSASDVDLLKEVIHIQPYDAPYGAVKSRWDEVAANM------CMTYGDGLT  58

Query  116  ---CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCM  155
               CR+RF+ LLD F+R+ + SLRASGT E++ EREQLL D +
Sbjct  59   SVSCRKRFDDLLDAFKRNTISSLRASGTEEEYNEREQLLQDIV  101

>PPTG_14264
Length=335

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 69/115 (60%), Gaps = 9/115 (8%)

Query  55   DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA---  111
            D    +++ FRF P+ D++L++E ++  PWAAG+G T+ +W +VA  ++ AL S      
Sbjct  28   DAAGGKRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQAALESMKGVVF  87

Query  112  ------DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
                  D    +RR + LL+ FR++EL +LR SGT E+F+ R +LL     +VDE
Sbjct  88   TRGSALDHAIVKRRVDMLLEAFRKNELSALRGSGTPEEFDMRNKLLAILARVVDE  142

>H257_06152
Length=150

 Score = 84.7 bits (208),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 58/104 (56%), Gaps = 7/104 (7%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG---KA  115
            + K  FRF   +D+ LLKE +  RP+ A HGE    W+ V       L     DG    A
Sbjct  14   RHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVT----EHLQRLCGDGITVNA  69

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
             R+RF+ L+  F  D + +LRASGT E++EEREQLL D   LVD
Sbjct  70   TRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVD  113

>H310_09765
Length=115

 Score = 82.4 bits (202),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 65/103 (63%), Gaps = 1/103 (1%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            +KRK A+RF  ++D+ LLKE V   P+ AG+G+T   W  +   +++ +         CR
Sbjct  8    TKRKPAYRFTIAADVDLLKEVVLVAPFDAGYGQTTARWDEIGDNMRS-IHGEAVTAICCR  66

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            RRF+ LL  F++  L++LR+SGT E++ +R+QLL D + LV E
Sbjct  67   RRFDELLAAFKKATLKALRSSGTEEEYNDRDQLLQDIVDLVIE  109

>PHYSO_383648
Length=319

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 68/115 (59%), Gaps = 9/115 (8%)

Query  55   DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA---  111
            D    +++ FRF P+ D++L++E ++  PWAAG+G T+ +W SVA  +++ L S      
Sbjct  5    DAAGAKRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVATRVQSTLESMKGVAF  64

Query  112  ------DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
                  D    +RR + LL+ FR++E+  LR SGT E+F+ R +LL     +VDE
Sbjct  65   TRGSALDHAIVKRRVDMLLEAFRKNEMAGLRGSGTPEEFDMRNKLLAILARVVDE  119

>H310_13306
Length=231

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 64/102 (63%), Gaps = 1/102 (1%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            +KRK A+RF  ++D+ LL E V   P+ AG+G+T   W  +   +++ +         CR
Sbjct  8    TKRKPAYRFTNTADVDLLNEVVLVAPFDAGYGQTTARWDEIGDNMRS-IHGEAITAICCR  66

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            RRF+ LL  F++  L++LR+SGT E++ ER+QLL D + L+D
Sbjct  67   RRFDDLLAAFKKATLKALRSSGTEEEYNERDQLLQDIVDLID  108

>PHYCA_510415
Length=337

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 69/115 (60%), Gaps = 9/115 (8%)

Query  55   DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPS------  108
            D    +++ FRF P+ D++L +E +++ PWAAG+G T+ +W +VA  +++ L S      
Sbjct  28   DQAGGKRRLFRFKPAFDVVLAREVIRNFPWAAGYGRTRSAWMAVANRVQSTLESMKGVTF  87

Query  109  ---CTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
                + D    +RR + LL+ +R++E+  LR SGT E+F+ R +LL     +VDE
Sbjct  88   TKGSSLDHAIVKRRVDMLLEAYRKNEMSGLRGSGTPEEFDMRNKLLAILARVVDE  142

>PHYKE_1588
Length=333

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL---------PSCT  110
            +++ FRF P  D++L++E +   PWAAG+G T+ +W +VA  ++  L             
Sbjct  27   KRRLFRFKPRFDVVLVREVICSFPWAAGYGRTRSAWMNVAQRVQAELEDMGSLSFSKGAA  86

Query  111  ADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
             D    +RR + LLD FR++E+  LR SGT EDF+ R +LL   + +VDE
Sbjct  87   LDHAIVKRRVDMLLDAFRKNEMSGLRGSGTPEDFDMRNKLLAILLRVVDE  136

>H257_07641
Length=187

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 57/102 (56%), Gaps = 7/102 (7%)

Query  61   KKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG---KACR  117
            K AFRF   +D+ LLKE +  RP+   HGE +  W+ V       L     DG    A R
Sbjct  16   KTAFRFKGCTDVELLKEVIHVRPYEGPHGEVRKRWTEVT----EHLQRLYGDGITVNATR  71

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            +RF+ L+  F  + + +LRASGT +D+EEREQLL D   L D
Sbjct  72   KRFDDLMTAFHANTMAALRASGTEQDYEEREQLLQDIHDLTD  113

>H310_04684
Length=108

 Score = 78.6 bits (192),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 1/104 (1%)

Query  55   DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK  114
            D   ++K AFR+  S+DI LLKE V   P+ A +G+T   W  +   ++  L   +    
Sbjct  6    DANKRKKTAFRYSVSADIDLLKEVVMVAPYDARYGQTSARWEEICDHMRQ-LHGDSLTTA  64

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            +CR+RF+ LL  F++  L++LRASGT E++ ER+QL+ D   +V
Sbjct  65   SCRKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMV  108

>PHALS_08857
Length=352

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 9/114 (8%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA----  111
            T   +++ FRF P+ D++L++E +   PW+AG+G T+ +W +VA  +++ L         
Sbjct  50   TLGGKRRLFRFKPAFDVVLVREVIHDFPWSAGYGRTRSAWMAVATRVQSTLEEMKGVTFT  109

Query  112  -----DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
                 D    +RR + LL+ FR++EL +LR SGT E+F+ R +LL     +VDE
Sbjct  110  RGSALDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLLGILARVVDE  163

>H310_02561
Length=256

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 2/109 (2%)

Query  55   DTQSKRKK-AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG  113
            D  +KRKK AFR+  S+DI LLKE V   P+ A +G+T   W  +   ++  L   +   
Sbjct  5    DDANKRKKTAFRYSVSADIDLLKEVVMVAPYDAPYGQTSARWEEICDHMRQ-LHGDSLTT  63

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECL  162
             +CR+RF+ LL  F++  L++LRASGT E++ ER+QL+ D   ++D  L
Sbjct  64   ASCRKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMMDVAL  112

>H310_15291
Length=234

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 3/102 (3%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADGKACR  117
            KRK A+RF    DI LLKE +  RP  A +G+T   W  V   ++    P  T  G  CR
Sbjct  8    KRKTAYRFTTQVDIDLLKEVMAVRPHDAPYGQTLARWEEVVEHMREMRGPDLTTAG--CR  65

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            +R + L+  F++D ++SLRA+GT E++ EREQL+ D   ++D
Sbjct  66   KRLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDMMD  107

>H310_14146
Length=109

 Score = 76.6 bits (187),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 1/93 (1%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            ++K AFRF  S+DI LLKE V   P+ A +G+T   W  +   ++ +    T    +CR+
Sbjct  10   RKKTAFRFSVSADIDLLKEVVMIAPFEAAYGQTGAGWEGICEHMRVSHGD-TLTTASCRK  68

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
            RF+ L   F++  L++LRASGT E+++ER+QLL
Sbjct  69   RFDDLYSAFKKATLKALRASGTEEEYQERDQLL  101

>PYVX_13719
Length=317

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 65/109 (60%), Gaps = 8/109 (7%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPS--------CTA  111
            ++  FRF P  DI LL+E +K  PW AG+G T+ +W++VA  ++T L +         + 
Sbjct  25   KRSMFRFRPRYDIALLREVIKRFPWGAGYGHTRAAWTAVAADVQTELEAQGVAFEQGSSL  84

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            D    +RR + LL+ FR+ ++ESLR +G+  + E+R++L      L+DE
Sbjct  85   DHTLAKRRADVLLETFRQGDMESLRGTGSPSEVEKRDKLAAILARLMDE  133

>H310_15292
Length=230

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 62/107 (58%), Gaps = 11/107 (10%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK---  114
            SKRK AF F P+SD  LLK  +  +P+ A +   +  W  VA  +      C   G    
Sbjct  5    SKRKVAFLFKPASDFDLLKVVIHIQPFDAPYEADKTRWEEVAANM------CITHGDTLT  58

Query  115  --ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
              +CR+RF+ L+  F+ D+L SLRASGT E++ EREQL+ D + L++
Sbjct  59   AVSCRKRFDDLIVAFKDDKLNSLRASGTEEEYNEREQLMQDIVDLMN  105

>CCA14346
Length=325

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 64/129 (50%), Gaps = 29/129 (22%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA-------------------  99
            ++KKAFRF P  DI+LL    +  PWAA HG  +  W+S A                   
Sbjct  19   RKKKAFRFKPKHDIVLLNTIKQFMPWAAVHGYVREVWASAADAFSLSMREKFTNLDEYFG  78

Query  100  ----------IGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQ  149
                       GL  +  +   +  AC+RRF+ L+D  RR +LESLRASG+ E+  EREQ
Sbjct  79   EEGNNEISPANGLIGSGSTFHVNHIACKRRFDTLIDAHRRGDLESLRASGSEEECCEREQ  138

Query  150  LLTDCMALV  158
            LL D   L+
Sbjct  139  LLMDIDRLI  147

>H310_08339
Length=230

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 2/106 (2%)

Query  55   DTQSKRKK-AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG  113
            D  ++RKK AFRF  S+DI LLKE V   P+ A +G+T   W  V   ++  L       
Sbjct  5    DEATRRKKTAFRFSVSADIDLLKEVVMVVPFDAAYGQTSARWDEVCEHMRQ-LHGNAMTS  63

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
              CR+RF+ LL  F++  L++LRASGT E++ ER+QL+ D   ++D
Sbjct  64   VCCRKRFDDLLPAFKKSSLKALRASGTEEEYLERDQLMQDISDMMD  109

>H257_19104
Length=214

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 7/104 (7%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG---KA  115
            +RK AFRF   +D+ LLKE +  +P+ A HGE +  W+ V       L     DG    A
Sbjct  14   RRKTAFRFKGCTDVELLKEVIHVQPYEAPHGEVRKRWTEVT----EHLQRLYGDGITVNA  69

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
             R+R + L+  F  + + +L ASGT E++EEREQLL D   LVD
Sbjct  70   TRKRSDDLITAFHANTMAALCASGTDEEYEEREQLLQDIHGLVD  113

>H257_09434
Length=257

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 60/103 (58%), Gaps = 3/103 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADGKAC  116
            +KRK A RF    D+ LLKE +   P  A +G+T   W+ V   ++T    S +A G  C
Sbjct  8    AKRKPAHRFTIPQDVDLLKEVLTICPHDAPYGQTSGRWAEVGDRMRTIHGDSLSATG--C  65

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            R+R + LL  F +D L SLRASGT E   EREQLL D  AL+D
Sbjct  66   RKRCDDLLAAFHKDSLASLRASGTDEQHHEREQLLQDLKALID  108

>SDRG_15163
Length=292

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 2/100 (2%)

Query  63   AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRF  120
            A +F    DI++L+      PWAA HG    +W ++A  L  A         G A + RF
Sbjct  29   ASKFACKHDIVMLRSVGLLEPWAAAHGAVMSTWEAIAESLADASDFGLKNKKGPALKTRF  88

Query  121  NALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
             ++++ F++ E +SLR SGT E++EEREQLLTD  A +D+
Sbjct  89   ESIMNKFKKSEFQSLRKSGTVEEYEEREQLLTDIKARMDD  128

>H310_12894
Length=257

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 3/106 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADGKAC  116
            SKRK A+RF    DI LLKEA+   P  A +G+    W  +A  ++    P  T  G  C
Sbjct  7    SKRKTAYRFTTQVDIDLLKEAMFVCPHDAPYGQASARWEEIAEHMRQLHGPDLTTAG--C  64

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECL  162
            R+R + L+  F++D ++SLRASGT E++ ER+QLL D   +++  +
Sbjct  65   RKRLDDLIAAFKKDTVKSLRASGTEEEYNERDQLLQDLADMMENAV  110

>HYAP_14010
Length=303

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 62/101 (61%), Gaps = 9/101 (9%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA--------  111
            +++ FRF P+ D++L +E ++  PWAAG+G T+ +W +VA  +++ L S           
Sbjct  50   KRRLFRFKPAFDVVLAREVIRCFPWAAGYGRTRSAWMNVAARVQSTLESLKGVAFTRGSA  109

Query  112  -DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
             D    +RR + LL+ FR+ E+ SLR +GT E+F+ R +LL
Sbjct  110  LDHAIVKRRVDMLLEAFRKHEMSSLRGTGTPEEFDMRNKLL  150

>H310_07849
Length=192

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 3/103 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPS-CTADGKAC  116
            +K+K A RF    D+ L+KE +   P  A +G+    W+ V   ++    S  TA G  C
Sbjct  4    AKKKPAHRFTLQQDVDLIKEVISVSPHDAPYGQLSTRWAEVGQNMQAIYASNLTASG--C  61

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            ++R + LL  F +D + SLRASGT E++ EREQLL D   ++D
Sbjct  62   QKRCDELLVAFHKDNIASLRASGTEENYNEREQLLQDLSDMID  104

>SPRG_08854
Length=412

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            KRK AFRF  +SDI LL+E V  +P+AA HG+T   W+ VA  +     S        R+
Sbjct  47   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATQVAQIHGSGITPNN-VRK  105

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDC  154
            RF+ L+  F++D L +LRASG+ E+++ER  LL D 
Sbjct  106  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  141

>SDRG_13678
Length=415

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            KRK AFRF  +SDI LL+E V  +P+AA HG+T   W+ VA  +     S        R+
Sbjct  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN-VRK  111

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDC  154
            RF+ L+  F++D L +LRASG+ E+++ER  LL D 
Sbjct  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147

>PHYCA_21476
Length=134

 Score = 73.2 bits (178),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 98/139 (71%), Gaps = 27/139 (19%)

Query  143  DFEEREQLLTDCMALVDECLQakadktekekkeaerrdrasadVVQSAMEGIRRSRSKSP  202
            +FEEREQLLTDC ALVDECLQAKADKTEKEK+           V++S +   ++  S   
Sbjct  14   NFEEREQLLTDCTALVDECLQAKADKTEKEKRRQSG-------VIESQLMWFKKRSS---  63

Query  203  EDDVSTPssskkkkrssTEALVEFLDAKAETRSTREKqkerqlhleerrlaleeqrlqqd  262
                             TEALVEFLDAKAETRSTREKQKERQLHLEERRLALEEQRLQQD
Sbjct  64   -----------------TEALVEFLDAKAETRSTREKQKERQLHLEERRLALEEQRLQQD  106

Query  263  reKTDKLMEMMASQMGLMS  281
            REKTDKLMEM +S +G +S
Sbjct  107  REKTDKLMEMYSSILGGVS  125

>SPRG_14160
Length=319

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (54%), Gaps = 11/127 (9%)

Query  36   LPASKKTPPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSW  95
            +PA K  PP++ +  A  ++       A +F    DI +L+      PWAA HG    +W
Sbjct  4    VPAIK--PPTEIEEVATGSN-------ASKFACKHDIAMLRTVNLLEPWAAAHGAVMSTW  54

Query  96   SSVAIGLKTA--LPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
             ++A  L  A         G A + RF  +++ F++ E +SLR SGT E++EEREQLLTD
Sbjct  55   DAIAESLADASDFGLKNKKGPALKTRFEIIMNRFKKSEFQSLRKSGTVEEYEEREQLLTD  114

Query  154  CMALVDE  160
              A +D+
Sbjct  115  IKARMDD  121

>H310_06933
Length=259

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 3/103 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADGKAC  116
            +KRK A+RF    DI +LKE +   P  A +G+T   W  V   ++  L P  +A G  C
Sbjct  7    TKRKAAYRFSIPVDIDMLKEVMFACPHDAPYGQTSSRWQEVGEHMRALLGPELSAGG--C  64

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            R+R + L+  F+++ ++S+RASGT E++ EREQLL D   +++
Sbjct  65   RKRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDMIE  107

>H310_04120
Length=138

 Score = 70.9 bits (172),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 59/103 (57%), Gaps = 3/103 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADGKAC  116
             KR+ A+RF+   DI  LKE +   P  A +G+T   W      ++    P  T  G  C
Sbjct  7    GKRRTAYRFITQVDIDFLKEVMAVCPHDAPYGQTLARWEDFVEHMREMHGPDLTTAG--C  64

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            R+R + L+  ++++ ++SLRASGT E++ EREQL+ D   ++D
Sbjct  65   RKRLDDLMAAYKKNTVQSLRASGTEEEYNEREQLIQDQSDMMD  107

>SPRG_06030
Length=196

 Score = 72.0 bits (175),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 67/127 (53%), Gaps = 9/127 (7%)

Query  39   SKKTPPSQRK------SPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQ  92
            +K+ PP+ +K      S  G T   S R+      P SD+ LLKEA    P    HG+T 
Sbjct  2    TKEAPPTTKKAFRFTVSSCGLTSLASLRRSTSG--PHSDVDLLKEAKLVSPHDCPHGQTA  59

Query  93   VSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLT  152
              W  VA  ++ A+         CRRRF+ LL  F+ D + +LRASGT ED ++R++LL 
Sbjct  60   KRWEEVAEHMR-AIHGDLVSIVGCRRRFDDLLTAFKNDTVNALRASGTEEDVKKRDELLH  118

Query  153  DCMALVD  159
            D   L+D
Sbjct  119  DIADLMD  125

>H310_09373
Length=109

 Score = 68.9 bits (167),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 1/100 (1%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            ++K AFRF   +DI LLKE V   P+ A  G+T   W       + +    T    +CR+
Sbjct  10   RKKTAFRFSVVADIDLLKEVVIIAPFEAASGQTGARWEEFCEHKRVSHGD-TLTTASCRK  68

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            R + LL  F++  L++LRASGT E+++ER+QLL D   +V
Sbjct  69   RVDDLLSAFKKATLKALRASGTEEEYQERDQLLQDISDMV  108

>H310_11755
Length=259

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 62/103 (60%), Gaps = 3/103 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADGKAC  116
            +KRK A+RF    DI LLKE +   P  A +G+T   W  V   ++    P  +A G  C
Sbjct  7    TKRKAAYRFSIPVDIDLLKEVMFACPHDAPYGQTSSRWQEVGEHMRALHGPELSAGG--C  64

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            R+R + L+  F+++ ++S+RASGT E++ EREQLL D   +++
Sbjct  65   RKRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDMIE  107

>H310_13106
Length=213

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 58/106 (55%), Gaps = 3/106 (3%)

Query  55   DTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL-PSCTADG  113
            D   KRK A+RF    DI LLKE +   P  A +G+    W  V   ++    P     G
Sbjct  4    DDGVKRKTAYRFTTQVDIDLLKEVMAVCPHEAPYGQILARWEEVVEHIREMHGPDLITAG  63

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
              CR+  + L+  F++D ++SLRA+GT E++ EREQL+ D   ++D
Sbjct  64   --CRKSLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDMMD  107

>H257_15222
Length=254

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 62/104 (60%), Gaps = 3/104 (3%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT-ALPSCTADGKA  115
            + K+K A  F    D+ L+KE +   P  A +G+T   W+ V   ++T  + S +A G  
Sbjct  10   EGKKKPAHGFTTPQDVDLIKEVMSICPHDAPYGQTSARWAEVGEHMRTIHVDSLSATG--  67

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            CR+R + LL  F++  L SLRASGT E+++EREQLL D   ++D
Sbjct  68   CRKRCDDLLVAFQKAMLASLRASGTDEEYDEREQLLQDLSDMID  111

>H310_14738
Length=255

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 1/102 (1%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            SK K A RF    DI LLKE +  RP  A +G+T   W  V   ++ A+   T     CR
Sbjct  7    SKLKPAHRFTVQEDIDLLKEVILVRPHDAPYGQTAGRWEEVGDHMR-AIHGMTTTTVDCR  65

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            +R + L+  F++D ++SLRASGT +   E+EQLL D + + +
Sbjct  66   KRHDDLMVAFKQDTIKSLRASGTEKQNSEQEQLLQDLLGMTN  107

>PYAP_24609
Length=405

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 55/101 (54%), Gaps = 7/101 (7%)

Query  61   KKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR---  117
            KK + F   +D+ LLKE +  RP+ A HG+    + +V   L   L +      ACR   
Sbjct  123  KKKYHFTVKADLALLKEMLNIRPFLAEHGKKGEKYETVTENLNEHLET----NLACRTVK  178

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
             RFN L+D F + E  S R SG AED++E EQLLTD   L+
Sbjct  179  ERFNLLVDKFEKAEASSRRKSGAAEDYDEYEQLLTDISILI  219

>SPRG_11320
Length=274

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 58/101 (57%), Gaps = 1/101 (1%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            +K KK FRF  +SD+ LLKE +   P+ A  G+T   W  V   ++  +         CR
Sbjct  7    TKTKKTFRFSVASDVDLLKEVINVAPYDAPFGQTIARWEEVTEHMR-GIHGEHVTFTGCR  65

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            +RF+ L+  F++D L+++RASGTA +  ER+ LL D   L+
Sbjct  66   KRFDDLMAAFKKDALKAMRASGTAAEVCERDLLLEDISDLM  106

>H310_09071
Length=112

 Score = 63.9 bits (154),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query  53   ATDTQSKRKKAFRFVPSSDILLLKEAVKH-RPWAAGHGETQVSWSSVAIGLKTALPSCTA  111
            A  +  +RK AFRF   +D+ LLKE VKH RP+ A  GE +  W+ V   L+  +     
Sbjct  8    AVQSNQRRKTAFRFKGCTDVDLLKE-VKHVRPFEAPRGEVRKRWTEVTEHLQRII----G  62

Query  112  DG---KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            DG      R+RF+ L+  F  D + +LRASGT E++EEREQLL D   LV
Sbjct  63   DGITVNVTRKRFDDLMTAFHEDTMAALRASGTEEEYEEREQLLQDIHDLV  112

>H257_15150
Length=145

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNA  122
            RF    DILLL+E     P+ A  G+  V WS+VA  +++         DGK  + RF  
Sbjct  8    RFTEDEDILLLREINGRLPFMAKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTL  67

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            LL+  R  + E  RASGT E + E+ QLL D ++  D+
Sbjct  68   LLEGHRHKDEEGKRASGTDEGYGEKFQLLDDLLSAFDD  105

>PHYCA_510606
Length=74

 Score = 60.5 bits (145),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 56/106 (53%), Gaps = 32/106 (30%)

Query  98   VAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            VA GLK AL SCTADGKACRRRFN LL+       E ++A     + E RE         
Sbjct  1    VATGLKAALTSCTADGKACRRRFNTLLEYN-----EHVQAKADKTEKENRE---------  46

Query  158  VDECLQakadktekekkeaerrdrasadVVQSAMEGIRRSRSKSPE  203
                              AERR+ ASA+VVQ AMEG+RRSRS S E
Sbjct  47   ------------------AERRESASAEVVQRAMEGLRRSRSGSSE  74

>H310_12832
Length=258

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 61/101 (60%), Gaps = 1/101 (1%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +R  AFRF   +D+ LLKE    RP+ A +GE +  W+ V+  L+    +      A R+
Sbjct  14   RRNTAFRFKGCTDVELLKEVNHVRPFEAPYGEVRKRWTEVSEHLQRIYGTGIT-VNATRK  72

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            RF+ L+  F+ + + +LRASGT E++EEREQLL D   LVD
Sbjct  73   RFDDLMTAFQEETMAALRASGTEEEYEEREQLLQDNHDLVD  113

>H257_15235
Length=178

 Score = 62.8 bits (151),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 1/84 (1%)

Query  76   KEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESL  135
            +E +  RP+ A HGE +  W+ V   L+  L        A R+RF+ L+  F  D + +L
Sbjct  8    EEVIHVRPYEAPHGEVRKRWTKVTEHLQR-LHGVGITVNATRKRFDDLMTAFHADSMAAL  66

Query  136  RASGTAEDFEEREQLLTDCMALVD  159
            R SGT E++EER QLL D   L D
Sbjct  67   RVSGTDEEYEERAQLLQDIHDLTD  90

>H310_14414
Length=169

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRRRFNAL  123
            +F    DI LL +     P  A HG+   +WS++A  L  ++       G A + RF+ L
Sbjct  24   KFACHHDIKLLLQIAFASPCEADHGKQLQAWSAIADALGQSVTFGLKKKGPAMKARFDVL  83

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            +  F R E  SLR SGTAE+++EREQLL D    +D+
Sbjct  84   MSRFVRGESASLRKSGTAEEYKEREQLLQDIKTRMDD  120

>H310_10581
Length=241

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 53/97 (55%), Gaps = 1/97 (1%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNAL  123
            +F    DI LL +      W A HG+   +WS++A  L ++A       G A + RF+ L
Sbjct  24   KFACHHDIKLLLQITFASRWEADHGKQLQAWSAIADALGQSATFGLKKTGPAIKTRFDVL  83

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            +  F R E  SLR SGTAE++EE EQL+ D    +D+
Sbjct  84   MSRFVRGESASLRKSGTAEEYEEGEQLMQDIKTRMDD  120

>H310_03385
Length=223

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 57/107 (53%), Gaps = 5/107 (5%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGK  114
            +SKR+    F    D+LLL++     P+ A HG     W++VA  L ++        DGK
Sbjct  4    KSKRRN---FSKEEDVLLLRQVASEMPFLARHGLIMDKWTAVAHALASSDEFGRPDFDGK  60

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
                RF+AL++  ++ + E  RASG AED  E++ L+ D +A  D+ 
Sbjct  61   KASNRFSALIEAHKKKKNEFARASGVAEDMTEKDALMDDLIAAYDDA  107

>PHYCA_62751
Length=116

 Score = 60.1 bits (144),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 6/108 (6%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD---  112
            ++SKRKK   F  + D+ LL++     P+ A  G    SW ++A  LKT       D   
Sbjct  2    SKSKRKK---FTKTDDVALLRQVQAELPFKAAKGGVMASWDALANNLKTLKDFSKEDTIT  58

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            GK+ + RFN L+   R+ + +S RASG  + + E+ QLL D ++  DE
Sbjct  59   GKSAQARFNTLVASHRKFDKKSERASGIDQRYAEKRQLLDDLVSQCDE  106

>H257_13170
Length=198

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 12/108 (11%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCT-----AD  112
            +KRKK+       DI+LL++     P+ A HG    +W SVA      L SC+      +
Sbjct  7    TKRKKS---TFDEDIVLLRQVSADLPFEASHGTIGSNWESVA----RTLTSCSTFGRNVN  59

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            GK C+ RFN LLD  +    E+++ASG +ED  E+ QLL D +  + E
Sbjct  60   GKKCQNRFNILLDEQKILRQEAMKASGASEDETEKTQLLDDLLLGMQE  107

>H257_18152
Length=209

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACRRRFNA  122
            RF    D+L+L+E     P+ A  G   V W++VA  +  +        D K  + RF  
Sbjct  8    RFSEYEDVLILREVNARLPFMAKRGLVMVGWAAVAEAVASQEEFSRPGFDAKRAQNRFTL  67

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            LL+  R  + ES+RASG AED+ E+ QLL +  ++ D+
Sbjct  68   LLEGHRVRDDESMRASGVAEDYNEKSQLLDELSSVYDD  105

>SPRG_05929
Length=265

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRR  119
            +K  +RF   +DI LL+E +   P  A +G+T   W  V   ++T L         CR+R
Sbjct  9    KKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRT-LHGEHLTVAGCRKR  67

Query  120  FNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            F+ L+  F+ D +  LRASGT E+  +R  LL +   L++
Sbjct  68   FDDLMAAFKTDNVNGLRASGTEEEMSQRYVLLEEMSDLLE  107

>H257_14013
Length=217

 Score = 60.5 bits (145),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 6/107 (6%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADG  113
            T SKR    RF    D++LL+E     P+ A  G    +W+ VA  L +         D 
Sbjct  3    TASKR----RFTEEEDVMLLREVNARMPFRARRGAVMDAWAEVAAALLSHEDFDRSVFDA  58

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            K    RF  LL+  R D  ES+RASG  E++ E+ QLL + ++  D+
Sbjct  59   KRAHNRFTLLLEGHRGDNRESMRASGVDEEYSEKMQLLDELLSTYDD  105

>SDRG_17406
Length=264

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 2/108 (2%)

Query  52   GATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA  111
            G   T+SK K  +RF   +DI LL+E +   P  A +G+T   W  V   ++T L     
Sbjct  2    GDEPTKSK-KPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRT-LHGEHL  59

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
                CR+RF+ L+  F+ D ++ LRASGT E+  +R  LL +   L++
Sbjct  60   TVAGCRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDLLE  107

>SDRG_17390
Length=264

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 2/108 (2%)

Query  52   GATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA  111
            G   T+SK K  +RF   +DI LL+E +   P  A +G+T   W  V   ++T L     
Sbjct  2    GDEPTKSK-KPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRT-LHGEHL  59

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
                CR+RF+ L+  F+ D ++ LRASGT E+  +R  LL +   L++
Sbjct  60   TVAGCRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDLLE  107

>H257_02519
Length=268

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK--ACRRRFNA  122
            +F    DI+LL++    RPW   +G     W+ VA  L   +P  +   K  A + RF  
Sbjct  17   KFARCHDIMLLQQVSLSRPWEGEYGTVMTIWAEVATEL-NRMPGFSMVKKPGALKTRFEY  75

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            LL    + E  SLR SGT E++ ER+QLLTD    VD+
Sbjct  76   LLAKHEKGESASLRKSGTTEEYSERDQLLTDIKLRVDD  113

>CCI47495
Length=285

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 49/105 (47%), Gaps = 29/105 (28%)

Query  83   PWAAGHGETQVSWSSVAIGLK-------TALPSCTA-DGK--------------------  114
            PWAA HG  +  W+S A           T L  C   DG                     
Sbjct  2    PWAAVHGYVREVWASAADAFSLSMREKFTKLDQCFGEDGNKDFASISALSGIGAVFHVNH  61

Query  115  -ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
             AC+RRF+ LLD  RR +L+SLRASG+ E+  EREQLL D   L+
Sbjct  62   IACKRRFDTLLDAHRRRDLDSLRASGSEEECCEREQLLLDIDRLI  106

>SPRG_08573
Length=265

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 2/104 (2%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKA  115
            T+SK K  +RF   +DI LL+E +   P  A +G+T   W  V   ++ AL         
Sbjct  6    TKSK-KPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMR-ALHGEHLTVAG  63

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            CR+RF+ L+  F+ D +  LRASGT E+  +R  LL +   L++
Sbjct  64   CRKRFDDLMAAFKTDSVNGLRASGTEEEMSQRFVLLEEMSDLLE  107

>H310_14954
Length=149

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 53/107 (50%), Gaps = 5/107 (5%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADG  113
            TQ+KR+    F    DI+LL++     P+   HG+    W++VA  L+ +        D 
Sbjct  3    TQTKRRN---FTEQEDIMLLRQVSLEMPFQTRHGQVMERWAAVASALQGSGEFTRDDIDA  59

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            K    RF  LLD  RR   ES RASG +E+  E+  LL D M   D+
Sbjct  60   KRACNRFMLLLDGHRRINKESQRASGVSEEVGEKTILLDDLMVAYDD  106

>H257_06253
Length=237

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK--ACRRRFNA  122
            +F    DI LLK+    +PW AG+G+   +W  V   +   +P    + K    + RF+ 
Sbjct  23   KFDCFHDIQLLKQVNLSKPWEAGYGKVMAAWVEVCREV-IRIPGFKINKKPEGLKTRFDL  81

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            L+      E+ S+R SGT+ED+ ER+ LLTD  A +D+
Sbjct  82   LIKTHCEGEMASMRKSGTSEDYTERDLLLTDIKARMDD  119

>PPTG_11368
Length=130

 Score = 57.0 bits (136),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 12/119 (10%)

Query  50   PAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC  109
            P+ A   Q +     +F    D++LL+     RPW A  G     ++ +    +     C
Sbjct  16   PSSAEKKQLRHAIRKKFAAVDDVVLLRAVNAFRPWRAPVG----IFNGIMKVFEDIAFQC  71

Query  110  TAD--------GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
             AD        G A R RF  L+  F+RD+  S+R SGT E +EER++L  D    VD+
Sbjct  72   GADPDFGVDKPGVALRTRFGTLMKEFKRDQCRSMRKSGTVEQYEERDRLSVDITTQVDD  130

>H257_08032
Length=251

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNALL  124
            F    DILL +   + +PWAA  GE  + W+++A  L  T   +   DG AC+ RF  ++
Sbjct  30   FCARDDILLCEAVNEVKPWAARSGEIMMYWANIADKLMHTRGFALRKDGPACKTRFEKIV  89

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
             +    E + LR SG+ ++F ERE+L+      +DE
Sbjct  90   KMITGGEQDVLRKSGSEDEFAERERLVMGICMQIDE  125

>PHYCA_104165
Length=231

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 11/101 (11%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA-------DGKACRR  118
            F  + DI+LL+     +PW A  G T    + +    +     C A       DG A R 
Sbjct  28   FTAADDIVLLRSVNLVKPWEAAMGTT----NGIMKAFEVVAAKCRAVDGFPKKDGPALRT  83

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            RF+ L+  FR  +  SLR+SG+ E+++ER++LL D +  +D
Sbjct  84   RFDRLVRTFREAQRASLRSSGSTEEYKERDELLQDIVCRID  124

>PPTG_14366
Length=283

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 10/125 (8%)

Query  43   PPSQRK----SPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSV  98
            PP QR      P     ++SKRKK   F  + D+ LL++     P+ A  G    SW S+
Sbjct  102  PPKQRSFSNAVPPEDIPSKSKRKK---FTNADDVALLRQVQADMPFKAAKGGVMASWDSL  158

Query  99   AIGLKTALPSCTAD---GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCM  155
            A  LKT       D   GK+ + RFN L+  +R+ + +S  AS   + + E+ QLL D +
Sbjct  159  ANNLKTLKNFSKKDTISGKSAQARFNTLVISYRKFDRKSEGASDIDQRYAEKRQLLDDLV  218

Query  156  ALVDE  160
            +  DE
Sbjct  219  SQFDE  223

>SDRG_12398
Length=264

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNALL  124
            F    D+LL +     +PW A  GE  + W+ +A  L +T       DG AC+ RF  +L
Sbjct  41   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  100

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
             +    E E LR +GT ++++ERE+LL +    +D+
Sbjct  101  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYEQIDQ  136

>H257_12325
Length=191

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 5/108 (5%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKA  115
            T SKR+    F    DI+LL++      + A  G     W+SVA  L+T+     +D  A
Sbjct  3    TPSKRRS---FSEEDDIMLLRQVSLEMQFQARRGLVMERWNSVAASLRTSEDFSRSDIDA  59

Query  116  CR--RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
             R   RF  LLD +R+ + +S RASG  E+F E+  LL D +A  D+ 
Sbjct  60   KRLCNRFMLLLDAYRKSDKQSERASGIDEEFTEKSMLLDDLLAAYDDV  107

>SPRG_09172
Length=265

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNALL  124
            F    D+LL +     +PW A  GE  + W+ +A  L +T       DG AC+ RF  +L
Sbjct  42   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  101

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
             +    E E LR +GT ++++ERE+LL +    +D+
Sbjct  102  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYEQIDQ  137

>H257_00377
Length=223

 Score = 58.2 bits (139),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 5/108 (5%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKA  115
            T SKR+    F    DI+LL++     P+ A  G     W+SVA  L+TA     +D  A
Sbjct  3    TPSKRRN---FSEEDDIMLLRQVSLEMPFQARRGLVMERWNSVAASLRTAEDFSRSDIDA  59

Query  116  CR--RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
             R   RF  LLD  R+ + +S RASG  E+  E+  LL D +A  D+ 
Sbjct  60   KRSCNRFMLLLDAHRKSDKQSERASGIDEEVTEKSMLLDDLLAAYDDA  107

>H257_05648
Length=172

 Score = 57.0 bits (136),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT----ALPSCTADGKACRRRF  120
            RF  + DIL+L+E     P+ A  G   ++W++VA  + T    A P    DGK    RF
Sbjct  8    RFSDAEDILILREVNARLPFTAKRGSVMLAWNTVADAVSTKHDFARPGF--DGKRALNRF  65

Query  121  NALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
              L++  R +   S RASG  ED +E+ QLL + +A+ ++
Sbjct  66   TLLMEGHRANNDVSARASGIDEDHDEKTQLLHELLAVYED  105

>H257_18023
Length=128

 Score = 55.5 bits (132),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 52/107 (49%), Gaps = 6/107 (6%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADG  113
            T SKR    RF    D++LL+E     P+    G    +W+ VA  L +         D 
Sbjct  3    TASKR----RFTEEEDVMLLREVNARMPFRVRRGAVMDAWAEVAAALLSHEDFDRPGFDA  58

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            K    RF  LL+  R D  ES+RASG  E++ E+ QLL + ++  D+
Sbjct  59   KRAHNRFTLLLEGHRGDNRESMRASGVDEEYSEKMQLLDELLSAYDD  105

>PHYCA_125686
Length=290

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 14/136 (10%)

Query  36   LPASKKTP---------PSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAA  86
            +P S+K P         PS   +   ++ +++KRKK   F    D++LL++    +P+A+
Sbjct  1    MPTSRKPPKESAQSTEAPSTATTTVSSSKSRTKRKK---FSKHDDLVLLRQVNADQPFAS  57

Query  87   GHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDF  144
              G    +W+S+A  +K           GK+ + RFN L++  R  + +S  ASG +ED+
Sbjct  58   VRGSLMDAWTSLANKVKVVEGFSKQEITGKSAQARFNVLVENHREADKKSAAASGVSEDY  117

Query  145  EEREQLLTDCMALVDE  160
             E +QLL + +  VDE
Sbjct  118  TESQQLLDEIVLAVDE  133

>H257_03945
Length=230

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            D  LLKE V+  P+  GHG+   +W+  A+ +    P+ +  G+ C+ R + +L  F RD
Sbjct  16   DEALLKEVVRLGPFEVGHGKVTATWAKAAVAMHEYDPNLS--GRICQARCDTILHDFARD  73

Query  131  ELESLRASGTAEDFEEREQLLTDCMAL  157
               S+RASG  ED ++  +L  D + +
Sbjct  74   NQASMRASGVYEDDDDMTKLKQDVLDI  100

>PHYCA_96385
Length=135

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 51/101 (50%), Gaps = 11/101 (11%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA-------DGKACRR  118
            F  + DI+L +     +PW A  G T    + +    +     C A       DG A R 
Sbjct  28   FTAADDIVLQRCVNLVKPWEAAMGTT----NGIMKAFEVVAAKCRAVDGFPKKDGPALRT  83

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            RF+ L+  FR  +  SLR+SG+ E+++ER++LL D +  +D
Sbjct  84   RFDRLVRTFREAQRASLRSSGSTEEYKERDELLQDIICRID  124

>PHYCA_132727
Length=261

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 53/106 (50%), Gaps = 10/106 (9%)

Query  63   AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNA  122
             FRF    D  LL+E ++ +P+AA  G T   WS VA  L +A  S   + K  R R   
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAIRGTTLRVWSDVAASLSSAF-SVEVNVKQIRDRLTL  60

Query  123  LLDVFRRDELESLRASGTAE---------DFEEREQLLTDCMALVD  159
            L  +F+  E+ S R SG  E          ++ERE+L+ + +AL D
Sbjct  61   LKQIFKDSEVASARGSGVEEKADAVNIQSHYDEREELVREYVALED  106

>PHYSO_254181
Length=154

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 55/115 (48%), Gaps = 6/115 (5%)

Query  44   PSQ-RKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL  102
            PSQ   +P        +RK   RF    D  L++EA    P+   +G+   +W+ VA  L
Sbjct  4    PSQTHNNPVEEAPPTKRRKTMVRFTDELDFQLIQEAQARYPYGEDYGKKTQAWADVAAAL  63

Query  103  KTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            +  +     DG+ CR R N L+D +   +  S + SG  E++  +++ L + + +
Sbjct  64   EVDV-----DGRRCRERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  113

>H310_04215
Length=257

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 1/87 (1%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNALL  124
            F    DILL     + +PW A  GE  +SW+ +A  L  T   +   DG AC+ RF  +L
Sbjct  24   FCARDDILLCLAVKEIKPWEAPSGEIMMSWAHIAEKLLHTRGFALRKDGPACKTRFEKIL  83

Query  125  DVFRRDELESLRASGTAEDFEEREQLL  151
             +    E + LR SG  E+F ERE+L+
Sbjct  84   KMITGGESDVLRKSGNDEEFAERERLV  110

>H257_17402
Length=149

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 9/97 (9%)

Query  70   SDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNALL  124
             D+ LLK+     P+AA  G+ + +W     GL   L SC       DGK  + RF AL+
Sbjct  14   DDLTLLKQVTADTPFAAEKGQLRKAWQ----GLAETLMSCENFGRVVDGKKVQNRFQALV  69

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            D  R+ +  S R SG+ ++ +E+  LL D + L+D+ 
Sbjct  70   DEHRKFDATSARLSGSDQEEKEKHMLLDDIITLLDDV  106

>PHYKE_4001
Length=496

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 58/113 (51%), Gaps = 8/113 (7%)

Query  44   PSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLK  103
            P  +K+    T  ++ RK+   F  + DI+LL E +  +PWA  H      W  VA+ L+
Sbjct  249  PPHKKATTSPTPGKTSRKQ---FSSADDIVLLTEVLSMKPWAFAH--EMDGWQQVALNLR  303

Query  104  TALPSCTAD--GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDC  154
              L +C  +    AC+ R   LL+  R   + +LR SGT ++F  + +LLT+ 
Sbjct  304  -ELTACRLEKTAGACQSRIMLLLEHLRAGNIAALRKSGTEDEFSRKHELLTEV  355

>PHYSO_325763
Length=157

 Score = 54.7 bits (130),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 6/111 (5%)

Query  44   PSQ-RKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL  102
            PSQ   +P        +RK   RF    D  L++EA    P+   +G+   +W+ VA  L
Sbjct  4    PSQTHNNPVEEAPPTKRRKTMVRFTDELDFQLIQEAQARNPYGKDYGKKTQAWADVAAAL  63

Query  103  KTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
            +  +     DG+ CR R N L+D +   +  S + SG  E++  +++ L +
Sbjct  64   EVDV-----DGRRCRERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAE  109

>H257_13889
Length=138

 Score = 54.3 bits (129),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 2/100 (2%)

Query  62   KAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFN  121
            K   +    ++ +L+EA++  P+AA HGE    W+ VA  +    P  T   +A R    
Sbjct  11   KYIYWTEDIELAILREAIRVEPFAADHGELLARWTLVAAAVAEQEPRVTP--RAAREHVY  68

Query  122  ALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
             LL  F+ D+     +SGTAE+  E+ QLL D    +DE 
Sbjct  69   MLLKKFKADDQAQRLSSGTAEEVTEKVQLLQDIAMRMDEV  108

>H257_07657
Length=212

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 46/98 (47%), Gaps = 2/98 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNAL  123
            F    D++LL++     P+ A  G     W+ VA  L+ A        D K    RF  L
Sbjct  10   FTEDDDVMLLRQVSLEMPFQARRGHVMERWADVASALEMADDFRRSDIDAKRACNRFMLL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            LD  R+   +S RASG AED  E+  LL D +A  D+ 
Sbjct  70   LDAHRKANNQSQRASGVAEDVSEKTVLLDDLLASYDDI  107

>SPRG_18521
Length=291

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK---ACRRRFN  121
            +F  S D+ +L+  ++  PW A HG    +W  VA  +  + P     GK   A + RF 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQS-PDFKLKGKTGAALKSRFE  92

Query  122  ALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
             LL  F  ++++ LR  GT  +F ERE LLTD
Sbjct  93   TLLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>H257_18551
Length=221

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 2/91 (2%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            ++ +L+EA++  P+AA HGE    W+ VA  +    P  T   +A R   + LL  F+ D
Sbjct  20   ELAILREAIRVEPFAADHGELLARWTLVAAAVAEQEPRVTP--RAAREHVHMLLKKFKAD  77

Query  131  ELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            +     +SGTAE+  E+ QLL D    +DE 
Sbjct  78   DQAQRLSSGTAEEVTEKVQLLQDIAMRMDEV  108

>H257_09054
Length=151

 Score = 54.3 bits (129),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRRRFNALL  124
            F  S +I LL      +PW A  G    +W+ +A  LK         DG+ C+ RF+ L 
Sbjct  34   FGCSDNITLLIAVNDAKPWTASSGSLMKTWTDIASDLKANRRFKVDKDGQGCKTRFDKLT  93

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
              +    L ++R SGT E+F E +Q L D ++ V+  ++
Sbjct  94   KAYMERTLTAMRGSGTDEEFGECKQPLEDILSQVNNFVE  132

>SPRG_05316
Length=325

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK---ACRRRFN  121
            +F  S D+ +L+  ++  PW A HG    +W  VA  +  + P     GK   A + RF 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQS-PDFKLKGKTGAALKSRFE  92

Query  122  ALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
             LL  F  ++++ LR  GT  +F ERE LLTD
Sbjct  93   TLLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>SDRG_06597
Length=317

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK---ACRRRFN  121
            +F  S D+ +L+  ++  PW A HG    +W  VA  +  + P     GK   A + RF 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWERVAEDVAQS-PDFKLKGKTGAALKSRFE  92

Query  122  ALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
             LL  F  ++++ LR  GT  +F ERE LLTD
Sbjct  93   TLLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>PHYSO_470381
Length=145

 Score = 53.9 bits (128),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (51%), Gaps = 5/99 (5%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +RK   RF    D  L++EA    P+   +G+   +W+ VA  L+  +     DG+ CR 
Sbjct  9    RRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCRE  63

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            R N L+D +   +  S + SG  E++  +++ L + + +
Sbjct  64   RCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  102

>H310_15369
Length=209

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 64/103 (62%), Gaps = 4/103 (4%)

Query  105  ALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQa  164
            ++   T    +CR+RF+ LL  F++  L++LRASGT E++ ER+QLL D + ++D    A
Sbjct  3    SIHGDTITASSCRKRFDDLLSAFKKATLKALRASGTEEEYNERDQLLQDIVDMID----A  58

Query  165  kadktekekkeaerrdrasadVVQSAMEGIRRSRSKSPEDDVS  207
             A K +  K+  ++R+     + ++A+ G++R  ++  +DDVS
Sbjct  59   AAAKKKASKQVVDKRESDGHMIREAALIGLKRKATEESDDDVS  101

>PHYSO_376280
Length=138

 Score = 53.5 bits (127),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (51%), Gaps = 5/99 (5%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +RK   RF    D  L++EA    P+   +G+   +W+ VA  L+  +     DG+ CR 
Sbjct  9    RRKTMVRFTDERDFQLIQEAQAINPYGEDYGKKTQAWADVAAALEVDV-----DGRRCRE  63

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            R N L+D +   +  S + SG  E++  +++ L + + +
Sbjct  64   RCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  102

>PHYSO_373613
Length=130

 Score = 52.8 bits (125),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +RK   RF    D  L++EA    P+   +G+   +W+ VA  L   +     DG+ CR 
Sbjct  1    RRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALVVDV-----DGRRCRE  55

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLT  152
            R N L+D +   ++ S + SG  E++  +++ L 
Sbjct  56   RCNQLVDAYEAKQMASEKPSGPCEEYAPKKECLA  89

>H310_04124
Length=81

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 46/101 (46%), Gaps = 41/101 (41%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            SKRK AFRF  +SD+ LLKE                                        
Sbjct  5    SKRKVAFRFKSASDVDLLKE----------------------------------------  24

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
             RF+ L+  F+ D+L SLRASGT E++ EREQL+ D + L+
Sbjct  25   -RFDDLIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLM  64

>H257_00956
Length=202

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT----ALPSCTADGKACRRRF  120
            RF  + DIL+L+E     P+ A  G   ++W++VA  + T    A P    DGK    RF
Sbjct  8    RFSDTEDILILREVNARLPFNAKRGSVMLAWNAVADAVSTNHDFAWPGF--DGKRALNRF  65

Query  121  NALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
              L++    +   S RASG  ED +E+ QLL + +A+ ++
Sbjct  66   TLLMEGHCANNDVSARASGIDEDHDEKTQLLDELLAVYED  105

>PHYSO_548072
Length=362

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRR  118
            R +  +FV + DILLL + ++ +PWA  H      W  V   L+            AC+ 
Sbjct  139  RSQRRQFVSADDILLLTQVLETKPWAYPH--VMDGWQEVCDRLRGHSEFHLDKTAGACQA  196

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMA  156
            R   LLD  +   + +LR SGT+E++E + +LLTD  A
Sbjct  197  RVALLLDHLKAGNIAALRKSGTSEEYERKRELLTDVQA  234

>H310_14154
Length=178

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 34/45 (76%), Gaps = 0/45 (0%)

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            +CR+RF+  +  F+ D+L SLRASGT E++ EREQL+ D + L++
Sbjct  13   SCRKRFDDFIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLMN  57

>PHYSO_380505
Length=138

 Score = 51.6 bits (122),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 49/98 (50%), Gaps = 5/98 (5%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRR  119
            RK   RF    D  L++EA    P+   +G+   +W+ VA  L+  +     DG+  R R
Sbjct  10   RKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQTWADVAAALEVDV-----DGRRYRER  64

Query  120  FNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            +N L+D +   +  S + SG  E++  +++ L + + +
Sbjct  65   YNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  102

>H257_19019
Length=229

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (52%), Gaps = 2/91 (2%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            ++ LL+E  +  P+AA HG+    W  VA GL    P     G   R   +A+L  F+++
Sbjct  27   EVELLREVSRIEPFAADHGDLLQRWKLVASGLSAHEPKINYRG--AREHVDAMLKQFKQE  84

Query  131  ELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            +     +SGT ED  E+ QLL D +  +DE 
Sbjct  85   DKVQQLSSGTDEDVTEKVQLLQDLIMRMDEV  115

>H257_04778
Length=147

 Score = 51.6 bits (122),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            D  LL+E V+  P+  GHG+   +W+  A+ +    P+ +A  +AC+   + LL  F +D
Sbjct  16   DEALLREVVRLGPYEVGHGKVTATWTKAALAMHEFDPNISA--RACQTGCDTLLHEFSQD  73

Query  131  ELESLRASGTAEDFEEREQLLTDCM  155
               S+RASG  ED ++  +L  D +
Sbjct  74   NQRSVRASGVEEDDDDIVKLKQDIL  98

>H257_13978
Length=172

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query  82   RPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRRRFNALLDVFRRDELESLRASGT  140
            +PW A  G+   +W+ +A  L+       T DG AC+ RF  L+     D L ++R SGT
Sbjct  27   KPWEAPSGQVMNTWADLAKDLRDNRRFRLTKDGAACKSRFENLIKAHCGDSLAAMRRSGT  86

Query  141  AEDFEEREQLLTDCMALVDE  160
             E+F E +QLL D  + V++
Sbjct  87   DEEFGECDQLLEDISSQVED  106

>PPTG_02416
Length=125

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 49/107 (46%), Gaps = 10/107 (9%)

Query  63   AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNA  122
             FRF    D  LL+E ++ +P+AA  G T   WS VA  L +A      + K  R R   
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAVRGTTLRVWSDVAASLSSAF-GVEVNVKQIRDRLTL  60

Query  123  LLDVFRRDELESLRASGTAE---------DFEEREQLLTDCMALVDE  160
            L   F+  E  S R SG  E          ++ERE L+ + +AL D 
Sbjct  61   LKQSFKDSEATSARGSGIEESVDAVNVQSHYDEREGLVREYVALEDH  107

>PHYKE_6162
Length=201

 Score = 52.0 bits (123),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 1/63 (2%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116
              KR+KAFRF  +SDI+LL++ +   PW+  HGET  +W +VA   +  L  C  +    
Sbjct  24   HEKRRKAFRFQTASDIVLLRQVMARTPWSCPHGETGPAWDAVA-EREQLLARCQFNTDDY  82

Query  117  RRR  119
            RRR
Sbjct  83   RRR  85

>PHYSO_453976
Length=138

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (52%), Gaps = 5/99 (5%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +R+   RF    D  L++EA    P+   +G+   +W+ VA  L+  +     DG+ CR 
Sbjct  9    RRETIVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCRE  63

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            R + L+D +   ++ S + SG  E++  +++ + + + +
Sbjct  64   RCDQLVDAYEAKQMASEKRSGPCEEYTPKDECVAELLEM  102

>H257_16670
Length=136

 Score = 50.8 bits (120),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 45/103 (44%), Gaps = 31/103 (30%)

Query  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116
            + K+K A RF    D+ LLKE +   P  A +G+T   W+  A                 
Sbjct  10   EGKKKPAHRFTTPQDVDLLKEVMSICPHDAPYGQTSARWAEKAT----------------  53

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
                           L SLRASGT E+++EREQLL D   ++D
Sbjct  54   ---------------LASLRASGTDEEYDEREQLLQDLSDMID  81

>H257_04948
Length=247

 Score = 52.4 bits (124),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 53/108 (49%), Gaps = 2/108 (2%)

Query  58   SKRKKAFRFVPSSD-ILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKA  115
            S +K +  FV +SD I LL E    RPW +      ++W  +A  L T    S    G A
Sbjct  12   SDKKPSQSFVSASDDIALLNEVSFSRPWESRRSAAGLAWEKIAKKLTTDTSLSAFKSGPA  71

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
             R+R   LL     +E  SLR SG+ E+++ R QLLTD    + +  Q
Sbjct  72   LRKRTEFLLKKHAANEHASLRKSGSTEEYDVRTQLLTDVATRIADYEQ  119

>PYU1_G004359
Length=237

 Score = 52.4 bits (124),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 46/101 (46%), Gaps = 7/101 (7%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +RK  FRF  + D  LL E V   P+AA HG     W+ VA  +         D + CR 
Sbjct  21   QRKVQFRFSHADDARLLTETVAVNPFAAPHGRVAARWAQVADNM-----GVDVDARRCRE  75

Query  119  RFNALLDVFRRDELESLRASGTAEDFE--EREQLLTDCMAL  157
            R   LL  FR    +  RA+ +A + E    +QLL D   L
Sbjct  76   RVILLLSQFRERGADDSRATDSANEGEADSMQQLLADVATL  116

>H310_15068
Length=108

 Score = 49.7 bits (117),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 44/98 (45%), Gaps = 10/98 (10%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC------TADGKACRRR  119
            F    D+LLL++     P+ A  G     W+  A     AL  C        D K    R
Sbjct  10   FTDEEDLLLLRQVSADMPFLARRGFVMDKWAQTA----QALAGCEEFGRPDFDAKKANNR  65

Query  120  FNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            FNAL++  R+   ES RASG +E+  E+  LL  C  L
Sbjct  66   FNALIEAHRKSNQESSRASGISEEVTEKVMLLNCCRPL  103

>H257_12998
Length=141

 Score = 50.4 bits (119),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNA  122
            +F    DIL L +     P+ A  G+    W SVA  L T         DGK  + RF  
Sbjct  9    QFTERQDILFLTQIRVEMPFLARRGKIMDVWDSVARNLATVGGFDRPQFDGKKAQARFAI  68

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            LL   R D   S+RAS  +ED  E+  +L D    VDE 
Sbjct  69   LLRDHREDNRASMRASCVSEDVTEKAIMLDDIATQVDEA  107

>H257_13434
Length=236

 Score = 52.0 bits (123),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 9/97 (9%)

Query  70   SDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNALL  124
             D+ LLK+     P+AA  G+ + +W     GL   L  C       DGK  + RF AL+
Sbjct  14   DDLTLLKQVAADTPFAAEKGQLRKAWQ----GLAETLMPCENFGRVVDGKKVQNRFLALV  69

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            D  R+ +  S R SG+ ++ +E+  LL D + L+D+ 
Sbjct  70   DEHRKFDATSARLSGSDQEEKEKHMLLDDIITLLDDV  106

>PHYSO_435001
Length=138

 Score = 50.1 bits (118),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 5/86 (6%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +RK   R     D  L++EA    P+   +G+   +W+ VA  L+  +     DG+ CR 
Sbjct  9    RRKMMVRVTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCRE  63

Query  119  RFNALLDVFRRDELESLRASGTAEDF  144
            R N L+D ++  +  S + SG  E++
Sbjct  64   RCNQLVDAYKAKQKASEKQSGPCEEY  89

>H310_04474
Length=210

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 67/142 (47%), Gaps = 0/142 (0%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLD  125
            F    D+LLL +     P+ A  G+    W SVA  L T       DG+  + RF  LL 
Sbjct  10   FSEREDVLLLTQFSAEMPFLARRGQIMDVWDSVARNLATLFDRPQFDGEKAQGRFLILLR  69

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekekkeaerrdrasad  185
              R ++  S RASG  E+  E+  LL D    VD+  Q +  +  +E +EA   +   A 
Sbjct  70   DNRDNKNASRRASGAPENVTEKTILLDDLYKQVDKANQKEDRRMTQEIEEASNVEENGAI  129

Query  186  VVQSAMEGIRRSRSKSPEDDVS  207
            V + AM+   + R+K  +D+ S
Sbjct  130  VREEAMKSQGKRRAKDEDDESS  151

>H310_11608
Length=221

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 46/104 (44%), Gaps = 36/104 (35%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACR  117
            +KRK AFRF  +SDI LLKE                            +P          
Sbjct  5    AKRKAAFRFKSASDIDLLKERF--------------------------VPQA--------  30

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
              F    D F+R+ + SLRASGT E++ EREQ L D + L+D+ 
Sbjct  31   --FRRSTDAFKRNTISSLRASGTEEEYSEREQFLQDIVDLIDQS  72

>H257_19436
Length=199

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 3/89 (3%)

Query  74   LLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK--ACRRRFNALLDVFRRDE  131
            LLK+    +PW AG+ +   +W  V   +   +P    + K    + RF+ L+      E
Sbjct  1    LLKQVNLSKPWEAGYDKVMAAWVEVCREV-NRIPGYKINKKPEGLKTRFDLLIKTHCEGE  59

Query  132  LESLRASGTAEDFEEREQLLTDCMALVDE  160
            + S+R SGT+ED+ E++ LLTD  A +D+
Sbjct  60   VASMRKSGTSEDYTEKDLLLTDIKARMDD  88

>PHYCA_118350
Length=156

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 50/101 (50%), Gaps = 11/101 (11%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTA-------DGKACRR  118
            F  + DI+LL+     +PW A  G T    + +    +     C A       D  A R 
Sbjct  28   FTAADDIVLLRCVNLVKPWEAAMGTT----NGIMKAFEVVAAKCRAVDGFPKKDDPALRT  83

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            RF+ L+  FR  +  SLR+SG+ ++++E ++LL D +  +D
Sbjct  84   RFDRLVRTFREAQRASLRSSGSTQEYKEHDELLQDIVCRID  124

>H257_14759
Length=198

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL--KTALPSCTADGKACRRRFNAL  123
            +    DI+LL++    RP+ A  GE    W  VA  L           D K  + RF+A+
Sbjct  10   YTEQEDIMLLRQVNAERPFEAKKGEFMKVWGLVAKALADHEGFARPQFDAKKAQNRFSAV  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCM-ALVD  159
            +D       ES  ASG AE ++ER  LL + + A VD
Sbjct  70   MDNHVHYNRESAMASGVAETYDERIALLDELLAAFVD  106

>PYIW_15637
Length=272

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 62/132 (47%), Gaps = 14/132 (11%)

Query  41   KTPPSQRKSP-----AGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSW  95
            K+ P+++K        GA +  SKRK    +    DI+LL +     P+++  G    SW
Sbjct  5    KSAPTEQKQTLNAVTPGAMEIPSKRKN---WTDGEDIMLLCQVSADMPFSSRRGSAIDSW  61

Query  96   SSVAIGLKT----ALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
              V     T    ALP    DGK  + RF AL++  R+    S   SG +  + E+ ++L
Sbjct  62   EEVVAKFSTLDAFALPQF--DGKKAQNRFFALMEEHRKYNTASATKSGVSGFYNEKHEVL  119

Query  152  TDCMALVDECLQ  163
             D +A+ DE  Q
Sbjct  120  DDLLAIYDEFEQ  131

>PYAR_24700
Length=154

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 51/88 (58%), Gaps = 5/88 (6%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNAL  123
            F  + DI LL+EA  HRPWA        +W ++A  L+T  + P    DGKA   RFN L
Sbjct  9    FTCADDINLLREASFHRPWA--QPWLMRAWETLAQRLRTYASFPQ-DKDGKALSTRFNLL  65

Query  124  LDVFRRDELESLRASGTAEDFEEREQLL  151
            +  +R + + S+R SG  E+F EREQLL
Sbjct  66   VKKYRENAVHSMRKSGREEEFFEREQLL  93

>H257_03208
Length=105

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)

Query  94   SWSSVAIGLKTALP-SCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLT  152
            +W+ +A GL+       T DG AC+ RF  L+     D L ++R SGT E+F ER+QLL 
Sbjct  3    TWADLAKGLRDNRRFRLTKDGPACKSRFEKLIKAHSGDSLAAMRRSGTGEEFGERDQLLE  62

Query  153  D  153
            D
Sbjct  63   D  63

>PPTG_00272
Length=436

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 3/95 (3%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRRRFNAL  123
            +FV + DILLL + ++ +PWA  + +    W  V   L+     +      AC+ R   L
Sbjct  219  QFVSADDILLLSQVLETKPWA--YPQLMDGWQEVCDQLRQHSDFNLDKTAGACQARVVLL  276

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            LD  R   + +LR SGT++++E + +LLT+  A +
Sbjct  277  LDHLRAGNVAALRKSGTSQEYERKRELLTEVQAKI  311

>H257_14499
Length=170

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 6/155 (4%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADG  113
            T +KR+    F    DI+LL++      + A   +    W+ VA GL TA        D 
Sbjct  3    TPTKRRN---FTEGEDIMLLRQVTLEMLFEARRDQVMERWAEVASGLNTADEFRRTDIDA  59

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekek  173
            K     F  LLD  R+   +S +ASG AED  E+  LL D +A  D+    +A + E  +
Sbjct  60   KKACNHFILLLDAHRKANNQSQQASGVAEDVGEKVVLLDDLLAAYDDVKGTEARRAEANR  119

Query  174  keaerrdrasadVVQSAMEGI-RRSRSKSPEDDVS  207
              AE+ +   + +   A+E + +R R K  +D V+
Sbjct  120  HAAEQMEAMESQIRAEALESVGKRKRDKDGDDTVT  154

>H257_14889
Length=157

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 43/85 (51%), Gaps = 2/85 (2%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            K +K   +    D  LLKE V+  P+  GH +   +W+  A+ +    P+ +  G  C+ 
Sbjct  4    KDRKQILWTDEMDEALLKEVVRLGPFEVGHDKVTATWAKAAVAMHEYDPNLS--GCICQA  61

Query  119  RFNALLDVFRRDELESLRASGTAED  143
            R + +L  F RD   S+RASG  ED
Sbjct  62   RCDTILHDFARDIQASMRASGVYED  86

>H310_15319
Length=227

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 44/92 (48%), Gaps = 2/92 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNAL  123
            +    D++LL++     P+ A HG     W+SVA  L           D K    RF AL
Sbjct  10   YTDEEDLMLLRQVAYEMPFLARHGLIMDKWASVAQALAADENFSRPDFDAKKANNRFAAL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCM  155
            LD  ++   E+ +ASG +E+  E+  LL D +
Sbjct  70   LDAHKKRNKEAEQASGVSEEVTEKVTLLDDLL  101

>H310_11831
Length=490

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA-LPSCTADGKACRRRFNALLDVFRR  129
            D++ L +A   +P+A G G+   +W ++A  L T+   +   DGK  + RF  L+D  RR
Sbjct  15   DMMRLVQAAADQPFATGKGQVSKAWQALAETLMTSDAFTRVVDGKKVQYRFGLLIDEHRR  74

Query  130  DELESLRASGTAEDFEEREQLLTDCMALVDEC  161
             ++ S + SG  E+  E+  +L D +A ++E 
Sbjct  75   FDVASAKLSGVDEEDSEKHMILDDLLARLEEV  106

>H310_13569
Length=205

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 43/96 (45%), Gaps = 2/96 (2%)

Query  61   KKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACRR  118
            K   RF  + D+LL +E     P+ A  G   + W+ VA  +           DGK    
Sbjct  4    KDKLRFTDAEDVLLPREVNAKLPFKAKRGTVIIVWNEVADAVNSNEEFNRVGIDGKRALN  63

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDC  154
            RF  L+D        S RASG  E+++E+ QLL + 
Sbjct  64   RFTLLMDNNHSSNEASSRASGIEEEYDEKTQLLDEL  99

>H310_12821
Length=179

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 13/100 (13%)

Query  68   PSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNA  122
            P  DI LL +    RP+AA  G+ + +W ++A      L +C       DGK  + RF A
Sbjct  12   PEEDITLLIQVAADRPFAAEKGQLKKAWQALA----DTLMACDHFGRVVDGKKVQNRFLA  67

Query  123  LLDVFRRDELESLRASGTAEDFEEREQ--LLTDCMALVDE  160
            L++  +  + ES R SG   D EERE+  LL D + L+D+
Sbjct  68   LVEEHKIFDAESARLSGV--DAEEREKHVLLDDIVNLLDD  105

>H257_17235
Length=186

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 2/91 (2%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            ++ LL+E  +  P+AA HG+    W  V  GL    P     G   R   +A+L  F+++
Sbjct  20   EVELLREVSRIEPFAADHGDLLQRWKLVESGLSDHEPKLNYRG--AREHVDAMLKEFKQE  77

Query  131  ELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            +      SGT ED  E+ QLL D +  +DE 
Sbjct  78   DKVQQLLSGTDEDVTEKVQLLQDLVMRMDEV  108

>H310_15160
Length=200

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 49/108 (45%), Gaps = 5/108 (5%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT--ALPSCTADG  113
            T SKR+    F    DILLL +    RP  A  G     W SVA  L T         DG
Sbjct  3    TPSKRRA---FNEREDILLLTQVSVERPHIARRGRIMDVWDSVARNLNTLDEFNRRHFDG  59

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            K  + RFN LL   +   + S R SG+ E  +ER  LL D  + V+E 
Sbjct  60   KRAQARFNLLLRDHKERNVASNRPSGSDEVVDERVVLLDDLSSQVEEA  107

>PHYSO_389597
Length=188

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 58/104 (56%), Gaps = 6/104 (6%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT-ALPSCTAD-----GKACRRR  119
            F    D+ LL++A+ +RP+    G+T  +W ++A  L + A  S +A      GK  + R
Sbjct  6    FSAEEDLALLRQALSNRPFLKERGKTMAAWDALAAQLVSDANFSRSASRGKLSGKTAQAR  65

Query  120  FNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            F+ L+   R+    +L ASG  E+  E++ LL + +AL+D+ ++
Sbjct  66   FDKLVTQKRQQNAAALAASGVDEEETEKDVLLDELIALIDDHIE  109

>PHYSO_330097
Length=203

 Score = 49.3 bits (116),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/93 (27%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALL  124
            RF    D  L++EA    P+   +G+   +W+ VA  L+        DG+ CR R N L+
Sbjct  3    RFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEV-----DVDGRRCRERCNQLV  57

Query  125  DVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            D +   +  S + SG  E++  +++ L + + +
Sbjct  58   DAYEAKQKASEKRSGPCEEYTPKDECLAELLEM  90

>HYAP_00630
Length=432

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 3/93 (3%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNAL  123
            +FV + DILLL +    +PWA  H      W +V   L K +  +      AC+ R   L
Sbjct  215  QFVSADDILLLTQVKVTKPWAYPH--LMDGWQAVCSELRKHSNFNLEKTAGACQARVALL  272

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMA  156
            LD  R   + +LR SGT E++E++ +LL    A
Sbjct  273  LDHLRAGNVAALRKSGTLEEYEQKRELLVQLQA  305

>H310_04318
Length=179

 Score = 48.5 bits (114),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            CRRRF+ LL  F++  L++LR+SGT E++ +R+QLL   + L+D
Sbjct  14   CRRRFDDLLAAFKQATLKALRSSGTEEEYNKRDQLLQGIVDLID  57

>PHYCA_503833
Length=313

 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 54/110 (49%), Gaps = 6/110 (5%)

Query  48   KSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP  107
            K  A A  T   RK+   FV + DILLL + +  +PWA  + +    W  V   L+    
Sbjct  117  KKAAVAPKTTPGRKQ---FVSADDILLLTQVLITKPWA--YPQLMDGWQEVCEQLREHND  171

Query  108  -SCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMA  156
             +      AC+ R   LLD F    + +LR SGT+E++E + +LL +  A
Sbjct  172  FNLEKTAGACQARMLLLLDHFHAGNVAALRKSGTSEEYERKRELLIEVHA  221

>H310_13824
Length=169

 Score = 48.1 bits (113),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 32/44 (73%), Gaps = 0/44 (0%)

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
            CRRRF+ LL  F++  L++L +SGT E++ E +QLL D + L+D
Sbjct  10   CRRRFDDLLAAFKKATLKALHSSGTEEEYNELDQLLQDIVDLID  53

>H310_12714
Length=377

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 50/103 (49%), Gaps = 18/103 (17%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            ++K AFRF  S+D  LLKE V   P+ A +G+T      +   ++  +           R
Sbjct  10   RKKTAFRFSVSADSDLLKEVVMIAPFEAAYGQTGARGEEICEHMRKTI-----------R  58

Query  119  RFNALLDVFRRDELES--LRASGTAEDFEEREQLLTDCMALVD  159
            RF      F   E  S  LR SGT E+++ER QLL D   ++D
Sbjct  59   RF-----AFSVQESHSKGLRTSGTEEEYQERNQLLQDISDMMD  96

 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 42/95 (44%), Gaps = 22/95 (23%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNALLD  125
            D  LLK+     P+AA  G+ + +W     GL   L +C       DGK  + RF AL+D
Sbjct  272  DYTLLKQVAAGTPFAAEKGQLKRAWQ----GLADTLMACENFGRVVDGKNLQNRFLALVD  327

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
              R+ E             +E+  LL D + L D+
Sbjct  328  EHRKQE-------------KEKHMLLDDIVTLYDD  349

>H257_07755
Length=181

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 48/91 (53%), Gaps = 5/91 (5%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            ++ LL+E  + +P+AA + E    W  VA G    +P    + ++ R   + +L  F++D
Sbjct  21   EVALLREVTRIKPFAADNSELLQRWKLVASG---QVPKI--NYRSAREHVDVMLKDFKKD  75

Query  131  ELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            +    R+SGT E   ER QLL D +  +DE 
Sbjct  76   DDAQKRSSGTEEYVTERVQLLQDLVMRMDEV  106

>H310_04226
Length=236

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 43/100 (43%), Gaps = 2/100 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNAL  123
            F    D+LLL +     P+ A  G+    W SVA  L T         DGK  + RF  L
Sbjct  10   FTEREDVLLLTQVSVEMPFLAHRGKIMDVWESVARNLATIGEFDRPNFDGKKAQARFLIL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            L   R     S RASG AE   E+  LL D    VDE  Q
Sbjct  70   LRDHRDSNNASQRASGAAEHVTEKTVLLDDLCNQVDEAKQ  109

>PPTG_09063
Length=273

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            FRF    D  L++E ++ +P++A  G T   W  VA G+ +A+     + K    R N L
Sbjct  3    FRFKLEHDQELMRELIRLKPFSAKRGTTGHVWEEVAKGVSSAI-QVQLNVKQVPDRLNLL  61

Query  124  LDVFRRDELESLRASGTAEDFE  145
               F+ DEL S RA G  ED  
Sbjct  62   KAKFKADELSSARAIGVEEDLH  83

>PHYRA_75877
Length=406

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (51%), Gaps = 3/93 (3%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRRRFNAL  123
            +FV + DILLL + ++ +PWA  H      W  V+  L+            AC+ R   L
Sbjct  188  QFVSADDILLLTQVLQTKPWAFQH--VMDGWQQVSDQLRAHDEFRLEKTAGACQARVVLL  245

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMA  156
            LD  R     +LR +GT++++E + +LL +  A
Sbjct  246  LDHLRAGNAAALRKAGTSDEYERKRELLVEVQA  278

>H257_07182
Length=209

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 2/77 (3%)

Query  86   AGHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAED  143
            A  G+  V WS+VA  +++         DGK  + RF  LL+  R  + E  RASGT E 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  144  FEEREQLLTDCMALVDE  160
            + E+ QLL D ++  D+
Sbjct  62   YGEKFQLLDDLLSAFDD  78

>H310_11868
Length=117

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNAL  123
            F    D+LLL +     P+ A  G+    W SVA  L T         DGK  + RF  L
Sbjct  10   FTEREDVLLLTQVSAEMPFLARRGKIMDVWDSVARNLATIGEFDRPQFDGKKAQARFLIL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            L   R +   S  ASG AE+  E+  LL +    VDE  Q
Sbjct  70   LRDHRDNSNASRHASGAAENVTEKTILLDNLCNQVDEAKQ  109

>H257_16845
Length=209

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 2/77 (3%)

Query  86   AGHGETQVSWSSVAIGLKT--ALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAED  143
            A  G+  V WS+VA  +++         DGK  + RF  LL+  R  + E  RASGT E 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  144  FEEREQLLTDCMALVDE  160
            + E+ QLL D ++  D+
Sbjct  62   YGEKFQLLDDLLSAFDD  78

>PPTG_11283
Length=260

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 46/102 (45%), Gaps = 3/102 (3%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            FRF    D+ +L+E ++ +P+AA  G T   W SVA  L +AL       K  R R N L
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALKK-EIKVKQIRDRLNLL  61

Query  124  LDVFRRDELESLRASGTAEDFE--EREQLLTDCMALVDECLQ  163
               F+  E  S  ASG  E       +   TD   L+ E  Q
Sbjct  62   KTRFKEKEQLSALASGVEESIHAVNVQTHYTDVDGLIREYTQ  103

>PPTG_04601
Length=260

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 46/102 (45%), Gaps = 3/102 (3%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            FRF    D+ +L+E ++ +P+AA  G T   W SVA  L +AL       K  R R N L
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALKK-EIKVKQIRDRLNLL  61

Query  124  LDVFRRDELESLRASGTAEDFE--EREQLLTDCMALVDECLQ  163
               F+  E  S  ASG  E       +   TD   L+ E  Q
Sbjct  62   KTRFKEKEQLSALASGVEESIHAVNVQTHYTDVDGLIREYTQ  103

>PYIW_26363
Length=144

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 46/91 (51%), Gaps = 6/91 (7%)

Query  74   LLKEAVKHRPWAAGHGETQVSWSSVAIGLKT----ALPSCTADGKACRRRFNALLDVFRR  129
            L +E     P+ AG+     +W++VA  LK      + S TA  K+C  RF AL+++ R 
Sbjct  23   LAREVNAKLPYRAGYNGVMNAWTAVAAALKIIPDLGMASVTA--KSCHSRFKALIELHRC  80

Query  130  DELESLRASGTAEDFEEREQLLTDCMALVDE  160
               ES RAS  +E+  E   +L D +   D+
Sbjct  81   SNRESARASDVSEEITELACVLGDLLGDFDD  111

>H257_09852
Length=165

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (53%), Gaps = 2/93 (2%)

Query  68   PSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVF  127
            P  D  LL+E V+  P+   +G   + W ++A  L T   +      A R R++ ++D F
Sbjct  13   PEMDTALLREVVRVEPYDGEYGTLILRWKAIAGSLSTYFEADIPYHSA-RERYDGMVDQF  71

Query  128  R-RDELESLRASGTAEDFEEREQLLTDCMALVD  159
            + +D+ + L  +G+ E+  E+ QLL D + L D
Sbjct  72   KAKDKAQRLWRTGSDEEVTEQVQLLQDLIDLRD  104

>PPTG_06633
Length=292

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 3/101 (3%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            FRF   +D  L++EA+  +P+AA +G++   W++VA  +  A+     + K  R R   L
Sbjct  3    FRFTNENDKELMREAIAQKPFAAKYGDSARVWATVAERMSAAIQIVVLE-KQVRDRVRLL  61

Query  124  LDVFRRDELESLRASGTAEDFEE-REQLLTDCMA-LVDECL  162
              ++R  EL S   SG  E  E   EQ   D +A LV + L
Sbjct  62   KKIWRAGELRSALGSGIEETLEAVSEQSHYDTLAGLVGQYL  102

>PITG_05827
Length=364

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 3/100 (3%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP-SCTADGKACRR  118
            R +  +FV + DILLL + ++ +PWA  + +    W  V   L+     +      AC+ 
Sbjct  142  RSQRTQFVSADDILLLSQVLETKPWA--YPQIMDGWQEVCRQLRQHSNFNLDKTAGACQA  199

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            R   LLD  R     +LR SGT++++E + +LL +  A +
Sbjct  200  RVVLLLDHLRAGNSIALRKSGTSQEYERKRELLAEVQAKI  239

>SDRG_17266
Length=278

 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 53/110 (48%), Gaps = 13/110 (12%)

Query  49   SPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPS  108
            + +G T+T  +R     +    D++LL++    RP+A  HG  +++W+ VA      L S
Sbjct  19   NDSGTTETTRRRN----WNDEEDVMLLRQISADRPFAQHHGRLRMAWAKVA----NTLMS  70

Query  109  C-----TADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
            C       D K  + RF+ALL+  +     S   SG  ED  E+  LL D
Sbjct  71   CEEFTREVDAKKIQNRFSALLEAHKAFNKGSAAKSGVDEDETEKIMLLDD  120

>H257_04751
Length=119

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 9/96 (9%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNALLD  125
            D +LL +    +P+AA  G+   +W ++A      L +C       DG+  + RF+AL++
Sbjct  15   DKVLLIQPATDKPFAAEKGQLTKAWQALA----NTLLACDHFTRVVDGRKVQNRFSALVE  70

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
              RR    S + SG  E+  E+  LL D +AL+D+ 
Sbjct  71   EHRRFNKASAKLSGDDEEETEKHILLDDIVALLDDV  106

>SDRG_15499
Length=278

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 53/110 (48%), Gaps = 13/110 (12%)

Query  49   SPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPS  108
            + +G T+T  +R     +    D++LL++    RP+A  HG  +++W+ VA      L S
Sbjct  19   NDSGTTETTRRRN----WNDEEDVMLLRQISADRPFAQHHGRLRMAWAKVA----NTLMS  70

Query  109  C-----TADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
            C       D K  + RF+ALL+  +     S   SG  ED  E+  LL D
Sbjct  71   CEEFTREVDAKKIQNRFSALLEAHKAFNKGSAAKSGVDEDETEKIMLLDD  120

>H257_04666
Length=206

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 42/83 (51%), Gaps = 6/83 (7%)

Query  83   PWAAGHGETQVSWSSVAIGLKTA----LPSCTADGKACRRRFNALLDVFRRDELESLRAS  138
            P+ A  G+    W+ VA GL TA    L    A  KAC   F  LLD  R+   +S +AS
Sbjct  2    PFQARRGQVMERWTEVASGLNTADEFRLTDIDAK-KACNC-FILLLDAHRKANNQSQQAS  59

Query  139  GTAEDFEEREQLLTDCMALVDEC  161
            G AED  E+  LL D MA  D+ 
Sbjct  60   GVAEDVGEKVVLLDDLMAAYDDV  82

>H257_11942
Length=232

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNAL  123
            +    D++LL++     P+ A  G     W++VA  L  +        D K    RFNAL
Sbjct  10   YTDEEDLMLLRQVSLELPFLARRGLIMDKWTAVARALVASDEFTRTDLDAKKANNRFNAL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            +D  R+   +S RASG +E+  E+  LL D +A+ D+ 
Sbjct  70   IDSHRKHNKDSERASGVSEEVSEKVLLLDDLLAVFDDA  107

>H310_15161
Length=236

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (52%), Gaps = 9/93 (10%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNALLD  125
            DI LL +    RP+AA  G+ + +W     GL   L +C       DGK  + RF  L +
Sbjct  19   DIALLIQVAADRPFAAEKGQLKKAWQ----GLAETLVACEHFGRVVDGKKVQNRFLFLAE  74

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
              R+ + +S + SG AE+ +E+  LL D + ++
Sbjct  75   EHRKFDAQSAKLSGVAEEEKEKHVLLDDILNVL  107

>PHYRA_74884
Length=241

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD---GKACRRRFNA  122
            +    D+ LL++ +  RP+    G+    W S+A  L  A P  T     GK  + R N 
Sbjct  23   YSEEDDVALLRQVLLDRPFDKPRGKVMQRWDSLAATL-VASPGFTHSKFSGKNAQSRMNQ  81

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            L+   R    ++   SG +E+  ER+QLL + + L+D+ 
Sbjct  82   LVQTHRETMKKAALLSGVSEEITERDQLLNELVVLLDDA  120

>H257_07871
Length=201

 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGK--ACRRRFNA  122
            +F    DI LLK+    RPW   +G+    W+ +A  L   +P  +   K  + + RF  
Sbjct  17   KFACCHDITLLKQVSLSRPWEGEYGKVMTIWAEIAAELNR-MPGFSMVKKPGSLKTRFEY  75

Query  123  LLDVFRRDELESLRASGTAE-------DFEEREQLLTDCMALVDECLQ  163
            LL    + E  SLR SGT E       DF E E +  D      EC++
Sbjct  76   LLAKHEKGESASLRKSGTTEEHQLRVDDFAENEAVRKDAAKRKLECVE  123

>PPTG_05843
Length=169

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query  77   EAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLR  136
            E ++ +P++A  G T   W  VA G+ +A+     + K  R R N L   F+ DEL S R
Sbjct  3    ELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQ-VQLNVKQVRDRLNLLKAKFKADELSSAR  61

Query  137  ASGTAEDFE  145
            ASG  ED  
Sbjct  62   ASGVEEDLH  70

>PPTG_06289
Length=240

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 8/60 (13%)

Query  109  CTAD--------GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            C AD        G A R RF  LL  F+RD+ +S+R S T E F ER++LL D +A  D+
Sbjct  11   CGADPEFGVNKRGAALRTRFATLLREFKRDQCQSMRMSETVEQFRERDRLLLDIIARTDD  70

>PPTG_04118
Length=274

 Score = 46.6 bits (109),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 5/75 (7%)

Query  83   PWAAGHGETQVSWSSVAIGLKTAL---PSCTADGKACRRRFNALLDVFRRDELESLRASG  139
            P+A GHG+    +  +A  L   L   P  +   +  + RF  LLD F++++    + +G
Sbjct  6    PFAGGHGKIGARYQLMADNLSVHLKLDPKLSK--RTVQERFTLLLDEFKQNDQAYRKKTG  63

Query  140  TAEDFEEREQLLTDC  154
             AE++EE +QLL D 
Sbjct  64   VAENYEEHKQLLQDL  78

>PHYRA_86617
Length=241

 Score = 46.2 bits (108),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD---GKACRRRFNA  122
            +    D+ LL++ +  RP+    G+    W S+A  L  A P  T     GK  + R N 
Sbjct  23   YSEEDDVALLRQVLLDRPFDKPRGKVMQRWDSLAATL-VASPGFTHSKFSGKNAQSRMNQ  81

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
            L+   R    ++   SG +E+  ER+QLL + + L+D+ 
Sbjct  82   LVQAHRETMKKAALLSGVSEEITERDQLLNELVVLLDDA  120

>H310_15108
Length=184

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 71/153 (46%), Gaps = 5/153 (3%)

Query  58   SKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKA  115
            SKR+    F    DI+LL++     P+ A  G     W++VA  L+ +        D K 
Sbjct  5    SKRRN---FSDEDDIMLLRQVSLEMPFEARRGLVVERWNAVASALRESDEFSRLEIDAKR  61

Query  116  CRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekekke  175
               +   LLD  R+ + ES  A G  ED  E+  LL D +A  D+  +A   + ++ ++ 
Sbjct  62   ACNQIMLLLDAHRKHDKESALAPGVDEDENEKIVLLDDLLAAYDDAKRADLRRADESREA  121

Query  176  aerrdrasadVVQSAMEGIRRSRSKSPEDDVST  208
            A   +   + V   AME + + + K  +DD S+
Sbjct  122  ANHAEMMGSLVRAEAMEPLDQRKRKKDDDDASS  154

>H257_08837
Length=225

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 2/98 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACRRRFNAL  123
            F    DI+LL++     P+ A  G    +W+++A  +           D K    RF AL
Sbjct  10   FTEEEDIMLLRQVSADMPFLARRGLIMDNWTAIAETLAANEDFGRPDFDAKKANNRFIAL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
             +  R+    S RASG +ED  E+  LL D ++  D+ 
Sbjct  70   AEAHRKIHRVSARASGISEDVGEKVALLDDILSAHDDA  107

>PHYSO_378731
Length=138

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118
            +RK   RF       L++EA    P+   +G+   +W+ VA   +  +     DG+  R 
Sbjct  9    RRKTMVRFTDELHFQLIQEAQARNPYGEDYGKKSQAWADVAAAFEVDV-----DGRRYRE  63

Query  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157
            R N LLD +   +    + SG  E++  +++ L + + +
Sbjct  64   RCNQLLDAYEAKQKAGEKRSGPCEEYTPKDECLAELLEM  102

>PHYSO_536456
Length=212

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (56%), Gaps = 7/62 (11%)

Query  99   AIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            A GLK   P       A R RF  L+  F+ D+ +S+R SGT E++EERE LL + +  +
Sbjct  16   AFGLKKQGP-------AMRTRFTTLMSQFKADQYQSMRKSGTVEEYEEREVLLQNILNQI  68

Query  159  DE  160
             +
Sbjct  69   QD  70

>H310_06262
Length=226

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 43/100 (43%), Gaps = 2/100 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNAL  123
            F    D+LLL +      + A  G+    W SVA  L T         DGK  + RF  L
Sbjct  11   FTEREDVLLLTQVSVEMLFLARRGKIMDVWDSVARNLATIGEFDRPQFDGKKAQARFIIL  70

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            L   R +   S RASG AE+  E+  LL D     DE  Q
Sbjct  71   LRDHRDNNNASRRASGAAENVTEKTILLDDLCNQADEAKQ  110

>H257_13212
Length=153

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 40/84 (48%), Gaps = 2/84 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNAL  123
            +    D++LL++     P+ A  G     W++VA  L  +        D K    RFN L
Sbjct  10   YTDKEDVMLLRQVSLELPFLARRGIIMEKWTAVARALVASDEFTRTDLDAKKANNRFNLL  69

Query  124  LDVFRRDELESLRASGTAEDFEER  147
            +D  R+   +S RASG +E+  E+
Sbjct  70   IDSHRKHNKDSERASGVSEEVSEK  93

>PHYCA_124712
Length=202

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 7/62 (11%)

Query  99   AIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            A GLK         G A R RF  L+  F+ D+ +S+R SGT E++ ERE LL D ++ +
Sbjct  16   AFGLKKP-------GTAMRTRFTNLVSQFKTDQCQSMRKSGTVEEYAEREVLLQDIVSQM  68

Query  159  DE  160
            D+
Sbjct  69   DD  70

>H257_18543
Length=323

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 0/52 (0%)

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            DG+ C  RF+ L   ++   L S+R SGT E+F+E EQLL D ++ V++ ++
Sbjct  68   DGQGCTTRFDKLAKAYKERSLVSIRRSGTDEEFKECEQLLEDILSQVNDFVE  119

>PHYSO_295819
Length=193

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            F F   +D+ L KE +   P+AA HG  +  +  VA  L   L     D +  + R   L
Sbjct  87   FFFTQEADLALFKEMLSLEPYAAEHGFKKQRYQQVADNLSEHLKVKLLD-RTVKDRLELL  145

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDC  154
            L  F+ D+    + SG +E + E ++LL D 
Sbjct  146  LAEFKLDDQSYRKKSGGSEQYTEHKRLLQDI  176

>PYU1_G008728
Length=234

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA------IGLKTALPSCTADGKACRRR  119
            F   +D++LL    +H P  AGHG    +W S+A      +GL     +  A  K  R R
Sbjct  16   FRTENDVILLDLVRRHAPHTAGHGNVAGAWQSIAREYNSRLGLSADAETAVA-WKVLRNR  74

Query  120  FNALLDVFRRDELESLRASGTAEDF  144
               LLD F +  + S+R  G A+ +
Sbjct  75   TGLLLDKFAKGAMHSVRKLGRADMY  99

>HYAP_06778
Length=224

 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 45/94 (48%), Gaps = 2/94 (2%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACR  117
            R +  +F  S D+LLL+   ++ P+ A HG     W +VA  +GL+            CR
Sbjct  8    RGRYAKFNGSMDVLLLEALQENNPFTAKHGTRLQMWQNVAETVGLQGFKNPAAFSWHTCR  67

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
             R  AL+ ++   + + L   GT E+   +E +L
Sbjct  68   DRVTALMKMYTDGKHDKLFKHGTMEENSRKESIL  101

>H310_04905
Length=153

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 2/68 (3%)

Query  95   WSSVAIGLKTA--LPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLT  152
            W++VA  L ++        DGK     F+AL++   +   ES RASG AED  E++ L+ 
Sbjct  4    WTAVAHALASSDKFGRPDFDGKKASNMFSALIEAHMKKNNESARASGVAEDMTEKDALMD  63

Query  153  DCMALVDE  160
            D +A  D+
Sbjct  64   DLIAAYDD  71

>PPTG_20418
Length=219

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL--KTALPSCTADGKACRRRFNAL  123
            F    D+  L++    RP+    G    +W ++A  L      P     GK    RF+ L
Sbjct  10   FTDDEDLAQLRQIHADRPFLRQRGGIMAAWDALATKLVVDENFPRNKVSGKTASGRFDKL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            ++  R    E  +ASG  ED  E+  LL D +A++D+
Sbjct  70   VEAHRAAAEEPAKASGVDEDESEKVILLDDLVAMLDD  106

>H310_14075
Length=217

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 46/107 (43%), Gaps = 5/107 (5%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL--KTALPSCTADG  113
            TQ+ R+    F    DI+LL++     P+ A  G+    W+ VA  L           D 
Sbjct  3    TQTMRRN---FTEQEDIMLLRQVSLEMPFQARRGQVMERWADVASALLGSGEFTRDDIDA  59

Query  114  KACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            K    RF  LLD   R   ES  ASG +++  E+   L D M   D+
Sbjct  60   KRACNRFMLLLDGHHRINKESQCASGVSDEVGEKTNFLDDLMVAYDD  106

>H257_05272
Length=133

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 40/82 (49%), Gaps = 2/82 (2%)

Query  73   LLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNALLDVFRRD  130
            +LL++     P+ A HG     W++VA  L  A        D K     FNAL+D  R+ 
Sbjct  1    MLLRQVSLELPFLARHGLIMDKWATVAWALVAADEFTRTDLDTKKANNGFNALVDGHRKH  60

Query  131  ELESLRASGTAEDFEEREQLLT  152
              E+ RASG +E+  E+  LL 
Sbjct  61   NNEAERASGVSEEVSEKILLLN  82

>H257_10707
Length=213

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (62%), Gaps = 0/52 (0%)

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            DG+ C+ RFN L    +     ++R SGT E+F E EQLL D ++ V++ ++
Sbjct  158  DGQGCKTRFNKLAKANKERSFSAMRRSGTDEEFNECEQLLGDILSQVNDFVE  209

>SPRG_00310
Length=254

 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 0/39 (0%)

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTD  153
             CR+RF+ L+  F +D ++++RASGT E+  ER+ LL D
Sbjct  13   GCRKRFDDLMAAFEKDAVKAMRASGTEEEVSERDMLLQD  51

>PPTG_16083
Length=241

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 7/83 (8%)

Query  53   ATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD  112
            A+    KR++ F F   +D+ LLKE + + P+A GHG+    +  VA  L   L     D
Sbjct  155  ASKADKKRRRKFFFDQKADLALLKEMLANEPFAGGHGKIGARYQLVADNLSAHL---KLD  211

Query  113  GKACRR----RFNALLDVFRRDE  131
             K  +R    RF  LLD F++++
Sbjct  212  QKLSKRTVQERFALLLDEFKQND  234

>H310_13843
Length=118

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 6/48 (13%)

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            G+ CR        V  R+ + SLRASGT E++ E EQLL D + L+D+
Sbjct  2    GRGCREH------VHDRNTISSLRASGTEEEYSEHEQLLQDIVDLIDQ  43

>PYIW_25568
Length=126

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 3/64 (5%)

Query  93   VSWSSVAIGLKTALPSCTAD--GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQL  150
            + W ++A  L+    S  AD  G A + RF  ++ +F   +L SLR SGT E+++ERE L
Sbjct  21   LGWKTIASILREN-QSFIADKGGPALKTRFEKIMKLFMSQDLASLRKSGTQEEYQERELL  79

Query  151  LTDC  154
            L D 
Sbjct  80   LGDI  83

>H257_01994
Length=222

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 46/86 (53%), Gaps = 2/86 (2%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFR-R  129
            D+ LL+E ++  P+   +G   V W ++A  L +    CT   ++ R  F  +L+ F+  
Sbjct  16   DLALLREVLRVEPYDGEYGTLTVRWKTIASKLSSCF-ECTIPYRSARDHFEVMLEGFKVT  74

Query  130  DELESLRASGTAEDFEEREQLLTDCM  155
            D+ + +  +G+ E+  E+ Q+L D +
Sbjct  75   DKAQRMFGTGSEEEVTEQVQILQDIV  100

>PITG_15738
Length=227

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 54/124 (44%), Gaps = 9/124 (7%)

Query  33   LTKLPASKKTPPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQ  92
            L  LP  +   P+ ++ P         R +  +F  + D++LL+    + P+ A HG   
Sbjct  15   LYTLPVERGRTPTAQQKPV-------VRGRYAKFNGTMDVMLLEALQINNPFTAKHGTRL  67

Query  93   VSWSSV--AIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQL  150
              W +V  AIG++            CR R  AL+ ++   + + L   GT E+   +E +
Sbjct  68   QMWQNVAEAIGMQVFKNPAAFSWHTCRDRVTALMKMYTDGKHDKLFKHGTMEENARKETI  127

Query  151  LTDC  154
            L + 
Sbjct  128  LREI  131

>PPTG_24854
Length=291

 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 3/102 (3%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            FRF    D  L++EA+  +P+AA +GE   +W+SVA  + +A+     + K  R R   L
Sbjct  3    FRFTEDHDKELMREAIAQKPFAAKYGEAARAWASVAEHVSSAIKERVLE-KQVRDRVRLL  61

Query  124  LDVFRRDELESLRASGTAEDFEE-REQLLTDCMA-LVDECLQ  163
               +   EL S   SG  E  E   EQ   + +A LV + +Q
Sbjct  62   KKNWHAGELRSSLGSGIEETLEAVNEQSHYETLAGLVGQYIQ  103

>H310_14898
Length=140

 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
             K CR+R + L   F++D + SLRAS T E + ER+QLL D   ++
Sbjct  11   AKGCRKRCDDLHSAFQQDSVASLRASRTDEQYAERDQLLQDLADMI  56

>PYAR_20449
Length=231

 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (51%), Gaps = 5/93 (5%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACRRRFNAL  123
            F    D+LLL+ A    PW A       +W ++A  +G     P    D +A R RF+ L
Sbjct  7    FSCGDDVLLLRAASAATPWQAAR--VMDAWDALAQRLGGYPCFPR-DKDARAVRTRFHLL  63

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMA  156
            L   R ++L S+R +G +++   RE+LL +  A
Sbjct  64   LKKHRANKLASMRTTGDSDELLHRERLLREVDA  96

>H310_09278
Length=156

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/141 (28%), Positives = 64/141 (45%), Gaps = 22/141 (16%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLD  125
            F    DILLL++A+  R    G G                      D K    RFNAL++
Sbjct  10   FTDEEDILLLRQALAGRE---GFGRPDF------------------DAKKANNRFNALIE  48

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQakadktekekkeaerrdrasad  185
              R+   ES RASG +E+  ++  LL + ++ +D+  + +  +    K   E  +  S+ 
Sbjct  49   AHRKSNQESSRASGISEEVIKKVMLLNELLSTLDDAKEEEVQRIASMKNLQEHNENLSSI  108

Query  186  VVQSAMEGIRRSRSKSPEDDV  206
            V + AM+ + + R   P+DDV
Sbjct  109  VREEAMQSLGK-RKVDPDDDV  128

>PPTG_22223
Length=37

 Score = 39.7 bits (91),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)

Query  58  SKRKKAFRFVPSSDILLLK  76
           SKRKKAFRFVPSSDI+LLK
Sbjct  19  SKRKKAFRFVPSSDIMLLK  37

>PITG_05131
Length=200

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 33/48 (69%), Gaps = 0/48 (0%)

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            G A R RF  L++ ++ D+ +S+R SGT E++ ERE LL + + L+++
Sbjct  23   GTAMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREVLLQNIVTLMND  70

>PHYKE_6913
Length=1265

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 51/108 (47%), Gaps = 2/108 (2%)

Query  53   ATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCT  110
            +T  QS R +  +F    D+LLL    +  P+ A HG     W ++A  +G++       
Sbjct  7    STTKQSGRGRYAKFSSEMDMLLLDALQEFNPFTAKHGTRLQMWQNIAEKLGMQVYKNPAM  66

Query  111  ADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
                 CR R +AL+ ++   + + L  +G  E+   +E +L D  A++
Sbjct  67   YSWHTCRDRVSALMKMYADGKHDKLFKNGNMEENSRKESILRDIDAVL  114

>H257_08669
Length=212

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGKACRRRFNALLDVFRR  129
            DI+LL +    +P+AA  G+   +W + A  L ++   +   D +    RF  L+D  RR
Sbjct  15   DIMLLIQVANDKPFAAEKGQVAKAWQTQAETLMESEQFTRVVDARKLLNRFTILVDEHRR  74

Query  130  DELESLRASGTAEDFEEREQLLTDCMALVDEC  161
              + S + SG+ ++ + +  LL D + L+D+ 
Sbjct  75   FAVASAKLSGSDQEEQGKHMLLDDIVCLLDDI  106

>H257_00966
Length=78

 Score = 40.4 bits (93),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADG  113
            T +KR+    F    DI+LL++     P+ A  G+    W+ VA GL TA        D 
Sbjct  3    TPTKRRN---FTEEEDIMLLQQVTLEMPFQARRGQVMERWAEVASGLNTADEFRRTDIDA  59

Query  114  KACRRRFNALLDVFRRD  130
            K     F  LLD  R+D
Sbjct  60   KKACNHFILLLDAHRKD  76

>H257_05356
Length=224

 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 42/98 (43%), Gaps = 2/98 (2%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACRRRFNAL  123
            F    +I LL++     P+ A  G     W ++A  +       S   D K    RF AL
Sbjct  10   FTEEEEITLLRQVSADMPFLARRGLIMDKWVAIAETLAANEDFGSPDFDAKKANNRFIAL  69

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
             +  R+    S RASG +ED  E   LL D ++  D+ 
Sbjct  70   AEAHRKSNRVSARASGISEDVGENVALLDDILSAHDDA  107

>PPTG_11144
Length=251

 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (48%), Gaps = 1/82 (1%)

Query  64   FRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNAL  123
            FRF    D  L+KEA+  +P+AA +GE    W+SVA  + + +     + K  R R   L
Sbjct  3    FRFTDDYDKELMKEAIAQKPFAAKYGEAARVWASVAEHVSSTIKERVLE-KQVRDRVGLL  61

Query  124  LDVFRRDELESLRASGTAEDFE  145
               +   EL S   SG  E  E
Sbjct  62   KKNWHAGELRSSLGSGIEETLE  83

>PPTG_03797
Length=210

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query  63   AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNA  122
             FRF    D  L+ E +K RP+AA +GET   W  VA  +  ++     D K  + R   
Sbjct  2    VFRFSEDMDKELMCEVIKQRPFAAKYGETGTVWVQVATRVSASIKVVVID-KQVQDRVRL  60

Query  123  LLDVFRRDELESLRASGTAE  142
            L   +R  EL +   SG  E
Sbjct  61   LKKNWRAGELRATLGSGIEE  80

>PYIW_22501
Length=279

 Score = 43.1 bits (100),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 53/115 (46%), Gaps = 8/115 (7%)

Query  52   GATDT------QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLK  103
            GATD+      ++ R +  +F  S D+LLL+    H P+ A HG     W S+A  +G +
Sbjct  5    GATDSPQDATQRAVRGRYAKFNGSMDVLLLEAMRAHNPFTAKHGTRLQRWQSIAELVGEE  64

Query  104  TALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
                        CR R  AL+ ++   + E L   GT ++   +E +L +  A +
Sbjct  65   LCKNPEAFSWHTCRDRVTALMKMYGDGKHEKLFKHGTEDENARKEAILRELTASI  119

>PITG_12686
Length=223

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  43   PPSQRKSP----AGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSV  98
            PP+Q+        G +  Q        F  + D++LL+     +PW           S+ 
Sbjct  10   PPAQQNDQENLTVGGSFVQPAGPARKNFTTADDLILLRAVNTIKPWE----------SAK  59

Query  99   AIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
             I  +TA       G A R RF+ L+   R  ++ S R+SGT E++ ER+ LL D +  +
Sbjct  60   DICNETAGFVRDKQGPALRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDVLLQDIVTRM  119

Query  159  DE  160
            D+
Sbjct  120  DD  121

>PITG_19098
Length=295

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  43   PPSQRKSP----AGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSV  98
            PP+Q+        G +  Q        F  + D++LL+     +PW           S+ 
Sbjct  10   PPAQQNDQENLTVGGSFVQPAGPARKNFTTADDLILLRAVNTIKPWE----------SAE  59

Query  99   AIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
             I  +TA       G A R RF+ L+   R  ++ S R+SGT E++ ER+ LL D +  +
Sbjct  60   DICNETAGFVRDKQGPALRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDVLLQDIVTRM  119

Query  159  DE  160
            D+
Sbjct  120  DD  121

>PPTG_16964
Length=104

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query  63   AFRFVPSSDILLLKEAVKHRPWAA-GHGETQVSWSSVAIGLKTALPSCTADGKACRRRFN  121
             FRF    D+ +L E ++ +P+AA   G T   W SV   L +AL     + K  R RFN
Sbjct  2    VFRFTTMEDLEMLWELIRQKPFAAKKRGSTLEMWDSVVAALGSALKK-EINVKQIRDRFN  60

Query  122  ALLDVFRRDELESLRASGTAE  142
             L   F+  E  S  ASG  E
Sbjct  61   LLKARFKEKEQLSALASGVEE  81

>PITG_05825
Length=410

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 45/98 (46%), Gaps = 5/98 (5%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD--GKACRRRFNA  122
             FV S DILLL   +  +PW   +      W  V   L+    S   D    AC+ R + 
Sbjct  197  HFVSSDDILLLTHVLAIKPWTFPY--VMDGWQQVTQNLRRE-ESFRLDKTAGACQARLSL  253

Query  123  LLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            LL  F+ D   +LR SGT ++F+ +  LL +     +E
Sbjct  254  LLSHFKADNTMALRKSGTDDEFDTKCALLAEVTKQTEE  291

>PYVX_17808
Length=230

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 44/94 (47%), Gaps = 2/94 (2%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACR  117
            R +  +F    D+LLL+    H P+ A HG     W S+A  +G + +          CR
Sbjct  25   RGRYAKFNGGMDVLLLEALRSHNPFTAKHGTRLQMWQSIAEIVGEELSKNPEAYSWHTCR  84

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
             R  AL+ ++   + + L   GTAE+   +E +L
Sbjct  85   DRVTALMKMYTDGKHDKLFKHGTAEENARKETIL  118

>PPTG_15281
Length=148

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 56/128 (44%), Gaps = 11/128 (9%)

Query  30   VAWLTKLPASKKTPPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHG  89
            +A   +LP+ + T       PA       +R    RF    D  L++EA    P+   +G
Sbjct  1    MATSNELPSEQHTNSLSDGLPA------KRRNPMVRFTDELDFQLIEEAQARNPFGEDYG  54

Query  90   ETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQ  149
            E   + + VA  +   +  C      CR R N LLD ++  +  S R SG  ED+  +++
Sbjct  55   EKTQARADVAAAVAVVVDGCL-----CRERCNHLLDAYQAKKKASERRSGPCEDYTPKDE  109

Query  150  LLTDCMAL  157
             L + + +
Sbjct  110  CLAEVLEM  117

>PHYRA_84895
Length=159

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 4/63 (6%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALP---SCTADGKACRRRFNA  122
            F    D+LLLK+A+   P++  HG+    W+S+A  L   +P   S    GK  + R NA
Sbjct  10   FSDIEDVLLLKQALADDPYSQEHGKVMERWNSLAATL-VPVPGFLSKNLTGKTAQNRVNA  68

Query  123  LLD  125
            LL+
Sbjct  69   LLE  71

>PHYCA_38983
Length=217

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 10/95 (11%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLD  125
            F  + D++LL+     +PW           S+  I  + A       G A R RF+ L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWE----------SAKDICNEMAGFVRDKQGPALRTRFDKLIR  86

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
              R  ++ S R+SGT E++ ER++LL D +  +D+
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDD  121

>PYIW_25658
Length=148

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (51%), Gaps = 3/75 (4%)

Query  82   RPWAAGHGETQVSWSSVAIGLKTALPSCTAD--GKACRRRFNALLDVFRRDELESLRASG  139
            +PW +       +W ++A  L+    S  A+  G A + RF   + +F   +L SLR SG
Sbjct  3    KPWESSRNSIMKNWETIASTLRDN-QSFIANKGGLAIKTRFEKTMKLFVSQDLASLRKSG  61

Query  140  TAEDFEEREQLLTDC  154
            T E ++ RE LL D 
Sbjct  62   TQEKYQRRELLLKDI  76

>PHYCA_60915
Length=152

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            GK+ + RFN L++  R  + +S  ASG +ED+ E +QLL + +  VDE
Sbjct  10   GKSAQARFNVLVENHRESDKKSAAASGVSEDYTESQQLLDEIVLAVDE  57

>PHYCA_98971
Length=295

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 10/95 (11%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLD  125
            F  + D++LL+     +PW           S+  I  + A       G A R RF+ L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWE----------SAKDICNEMAGFVRDKQGPALRTRFDKLIR  86

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
              R  ++ S R+SGT E++ ER++LL D +  +D+
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDD  121

>PHYCA_4828
Length=295

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 10/95 (11%)

Query  66   FVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLD  125
            F  + D++LL+     +PW           S+  I  + A       G A R RF+ L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWE----------SAKDICNEMAGFVRDKQGPALRTRFDKLIR  86

Query  126  VFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
              R  ++ S R+SGT E++ ER++LL D +  +D+
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDD  121

>PYVX_23885
Length=326

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 54/129 (42%), Gaps = 2/129 (2%)

Query  34   TKLPASKKTPPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQV  93
            T   +  K   S   S AG    Q+  +   RF    D LL  +     P+ A HG    
Sbjct  27   TNTTSKGKVKASAVSSRAGKQAGQNTTRLRQRFGDEEDYLLAVQVNADLPFTAKHGSLGK  86

Query  94   SWSSVAIGLK--TALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
            +W  VA  L   +     T  G   + RF  L++  R  E+ S   SGT E+  E   L+
Sbjct  87   AWDEVAKKLNECSKFMMRTIKGTTAKARFETLIENHRAWEMTSKAKSGTQEEESEYIVLM  146

Query  152  TDCMALVDE  160
            T+ + LVD+
Sbjct  147  TELVNLVDD  155

>H257_13416
Length=232

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query  72   ILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTA--LPSCTADGKACRRRFNALLDVFRR  129
            ++LL++     P+ A  G     W++VA  L  +        D K    RFNAL+D  R+
Sbjct  16   LMLLRQVSLELPFLARRGLIMDKWTAVARALVASDEFTRTDLDAKKANNRFNALIDSHRK  75

Query  130  DELESLRASGTAEDFEEREQLLTDCMALVDEC  161
                S RASG +E+  E+  LL D +A+ D+ 
Sbjct  76   HNKYSERASGVSEEVSEKVLLLDDLLAVFDDA  107

>PHYSO_259775
Length=213

 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/75 (27%), Positives = 39/75 (52%), Gaps = 5/75 (7%)

Query  83   PWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAE  142
            P+   +G+   +W+ VA  L+  +     DG+ CR R N L+D +   +  S + SG  E
Sbjct  31   PYGEDYGKKTPAWADVAADLEVDV-----DGRRCRERCNQLVDAYEAKQKASEKRSGPCE  85

Query  143  DFEEREQLLTDCMAL  157
            ++  +++ L + + L
Sbjct  86   EYTPKDECLVELLEL  100

>PPTG_00270
Length=249

 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 39/83 (47%), Gaps = 5/83 (6%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD--GKACRRRFNA  122
             FV S DILLL + +  +PW   +      W  V   L+ A  S   D    AC+ R N 
Sbjct  35   HFVSSDDILLLTQVLVIKPWTFPY--VMDGWQQVTEKLR-AEESFRLDKTAGACQARLNL  91

Query  123  LLDVFRRDELESLRASGTAEDFE  145
            LL   +     +LR SGT E+F+
Sbjct  92   LLGHLKAGNTTALRKSGTEEEFD  114

>SDRG_04653
Length=243

 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query  51   AGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCT  110
            +GA +   + KK F+F    D+ LL+  +KH P+ A HG     W  +   L  A     
Sbjct  3    SGAKEGVEEVKKRFKFNYEEDMELLRLVLKHEPYNAVHGSVAEKWEQIRTTL-CAYVGKQ  61

Query  111  ADGKACRRRFNALL  124
               +AC+ R+  L+
Sbjct  62   FSARACKDRYGILM  75

>H310_14397
Length=79

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 0/51 (0%)

Query  110  TADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            T DGK   +RF  L++  R+ + +S   SG+ ++  E+ QLL D +ALVD+
Sbjct  21   TLDGKKAAQRFGLLVEAHRKFQAKSKFMSGSNQEENEKTQLLDDLVALVDD  71

>H257_15530
Length=237

 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGL--KTALPSCTADGKACRRRFNALLDVFR  128
            D++LL++    +P+ A HG    +W SVA  L  +        DGK  + RF  LL   R
Sbjct  15   DLMLLRQISDDKPFLARHGRIMEAWESVARALAAQVDFDRPHFDGKKAQSRFAILLRDHR  74

Query  129  RDELESLRA--SGTAEDFEEREQLLTDCMAL  157
             +    +RA  + T ED  E+  LL D   L
Sbjct  75   DNNNAPMRAVSACTGEDSAEKMDLLEDISRL  105

>PYAP_17700
Length=284

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 4/102 (4%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTAL---PSCTADGKAC  116
            R +  +F    D+LLL+    H P+ A HG     W  +A  +  AL   P   +    C
Sbjct  53   RGRYAKFTAGMDVLLLEAMRTHNPFTAKHGTRLQMWQQIAATVGEALLKNPEAFS-WHTC  111

Query  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALV  158
            R R   L+ +F   + + L   GT E+   +E +L +   L+
Sbjct  112  RDRVTTLMKLFADGKHDKLFKHGTVEENTRKEAILREFTLLL  153

>SPRG_18045
Length=215

 Score = 40.8 bits (94),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 0/45 (0%)

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVD  159
             CR+RF+ L+  F+ D +  LRASGT E+  ER  LL +   L++
Sbjct  13   GCRKRFDDLMAAFKTDNVNGLRASGTEEEMRERYVLLEEMSDLLE  57

>H257_15302
Length=344

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            D K  + RF  LL+  R  + ES+RASG AED+ E+ QLL +  ++ D+
Sbjct  192  DAKRTQSRFTLLLEGHRVRDDESMRASGVAEDYSEKSQLLDELSSVYDD  240

>PPTG_15787
Length=126

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 46/107 (43%), Gaps = 10/107 (9%)

Query  63   AFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNA  122
             FRF    D  LL+E +  +P+AA  G T   WS +A  L +A        + C  R   
Sbjct  2    VFRFTNDWDKELLRELIHLKPFAAVRGTTLRVWSDIAASLSSAFGVEVNVKQVC-DRLTL  60

Query  123  LLDVFRRDELESLRASGTAE---------DFEEREQLLTDCMALVDE  160
            L  + +  E  +   SG  E          ++ERE L+ + +AL D 
Sbjct  61   LKQMLKDSEAAAALGSGIEESVDAVNVQSHYDEREGLVREFVALEDH  107

>PYAP_22661
Length=218

 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 5/81 (6%)

Query  83   PWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGT  140
            PWA    +   +WS VA  +G   A  +   D ++CR RF  L+  F+     +LR + T
Sbjct  28   PWA--QAKIMDAWSRVASALGADDAF-NGERDARSCRSRFLLLVKHFKESNHTALRRTAT  84

Query  141  AEDFEEREQLLTDCMALVDEC  161
             ++FE++ QLL   +  +D C
Sbjct  85   DDEFEDKMQLLGTIVDKMDSC  105

>H257_08839
Length=158

 Score = 40.0 bits (92),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 0/49 (0%)

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECLQ  163
            A + RF  LL    + E  SLR SGT E++ ER+QLLT     VDE ++
Sbjct  7    ALKARFEYLLAKHEKGESASLRKSGTTEEYSERDQLLTGIKLRVDEAVR  55

>PPTG_18296
Length=248

 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 25/94 (27%), Positives = 44/94 (47%), Gaps = 2/94 (2%)

Query  60   RKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVA--IGLKTALPSCTADGKACR  117
            R +  +F  + D++LL+    + P+ A HG     W +VA  IG++            CR
Sbjct  35   RGRYAKFNGTMDVMLLEALQVNNPFTAKHGTRLQMWQNVAESIGMQVFKNPGAFSWHTCR  94

Query  118  RRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
             R  AL+ ++   + + L   GT E+   +E +L
Sbjct  95   DRVTALMKMYTDGKHDKLFKHGTMEENARKETIL  128

>PHYCA_100220
Length=265

 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query  42   TPPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIG  101
            T P QR +P          KK   F  S D++LL++     P+ +  G    +WS+VA  
Sbjct  37   TEPLQRVTP---------NKKRKNFSKSDDLMLLRQVNTDHPYKSTRGGVMDAWSAVAAK  87

Query  102  LKTA--LPSCTADGKACRRRFNALLDVFRRDELESLRASG  139
            LK           GK+ + RFN L++  R  +  S  ASG
Sbjct  88   LKKLEDFSKREITGKSAQARFNLLIERHRAYDRTSRAASG  127

>H310_03462
Length=243

 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 3/107 (3%)

Query  56   TQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGL-KTALPSCTADGK  114
            +QS +++ + +    D+ LL +    +P+AA  G+   SW  +A  L ++   +   D +
Sbjct  2    SQSDKRRNWSY--EEDVALLIQVAADQPFAATKGQLTKSWQLLAETLMQSDNFTRVVDSR  59

Query  115  ACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDEC  161
              + RF+ L+D   +   ES + SG  E+  E+  LL D + L+++ 
Sbjct  60   KVQNRFSLLVDEHIKFNSESAKLSGVDEEHREKHILLDDMVTLLEDL  106

>H257_14546
Length=187

 Score = 40.0 bits (92),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 40/72 (56%), Gaps = 6/72 (8%)

Query  93   VSWSSVAIGLKT----ALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEERE  148
            ++W++VA  + T    A P    DGK    RF  L++  R +   S RASG  ED +E+ 
Sbjct  2    LAWNAVADAVSTNHDFARPGF--DGKRALNRFTLLMEGHRANNDVSARASGIEEDHDEKT  59

Query  149  QLLTDCMALVDE  160
            QLL + +A+ ++
Sbjct  60   QLLDELLAVYED  71

>PPTG_00266
Length=437

 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 39/83 (47%), Gaps = 5/83 (6%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTAD--GKACRRRFNA  122
             FV S DILLL + +  +PW   +      W  V   L+ A  S   D    AC+ R N 
Sbjct  223  HFVSSDDILLLTQVLVIKPWTFPY--VMDGWQQVTEKLR-AEESFRLDKTAGACQARLNL  279

Query  123  LLDVFRRDELESLRASGTAEDFE  145
            LL   +     +LR SGT E+F+
Sbjct  280  LLGHLKAGNTTALRKSGTEEEFD  302

>PHYRA_93678
Length=217

 Score = 40.0 bits (92),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (44%), Gaps = 2/116 (2%)

Query  38   ASKKTPPSQRKSPAGATDTQSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSS  97
            A ++  P+  +     T   + R +  +F  + D+LLL+    + P+ A HG     W +
Sbjct  2    ADEEIAPASTERVQTTTQKPAVRGRYAKFNGAMDVLLLEALQVNNPFTAKHGTRLQMWHN  61

Query  98   VA--IGLKTALPSCTADGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLL  151
            VA  +G+             CR R  AL+ ++   + + L   GT E+   +E +L
Sbjct  62   VAESVGVSVFKNPAAYSWHTCRDRVTALMKMYTDGKHDKLFKHGTMEENARKEAIL  117

>H257_10436
Length=527

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 30/49 (61%), Gaps = 0/49 (0%)

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            D K  + RF  LL+  R  + E +RASG AED+ E+ QLL +  ++ D+
Sbjct  343  DAKRTQNRFTLLLEGHRIRDDEYMRASGVAEDYSEKSQLLDELSSVYDD  391

>PYIW_25874
Length=201

 Score = 39.7 bits (91),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 46/90 (51%), Gaps = 13/90 (14%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRRRFNALLDVFRRD  130
            ++ LL++ +  RP+  GHG+   + S ++             GK  + RF+ L+   R +
Sbjct  22   NLALLRQILSVRPFQNGHGKVMAARSKLS-------------GKNAQSRFSQLIHSRRSE  68

Query  131  ELESLRASGTAEDFEEREQLLTDCMALVDE  160
             +E +  SG +E   E +++L + + L+D+
Sbjct  69   NMEVMTLSGVSETVSESDEILDELIELLDD  98

>PHYRA_75884
Length=432

 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query  65   RFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKT-ALPSCTADGKACRRRFNAL  123
             FV S DILLL   +  +PW A +      W  V   ++  A         AC+ R + L
Sbjct  218  HFVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAGACQARLHLL  275

Query  124  LDVFRRDELESLRASGTAEDFEEREQLLTDC  154
            L   +   L +LR +GT ++FE +  LL + 
Sbjct  276  LGHLKAANLTALRKAGTEDEFERKCALLREV  306

>H310_10257
Length=309

 Score = 40.4 bits (93),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)

Query  134  SLRASGTAEDFEEREQLLTDCMALVD  159
            SLRASGT E++EEREQLL D   +VD
Sbjct  3    SLRASGTDEEYEEREQLLQDIHDMVD  28

 Score = 32.3 bits (72),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (49%), Gaps = 5/90 (6%)

Query  71   DILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADG---KACRRRFNALLDVF  127
            D+L     VK     A H   +++     + L+        DG    A R+RF+ L+  F
Sbjct  105  DMLAKANEVKADEAQAQHKSNELAQQK--LELEEKRYRIVGDGITVNATRKRFDDLMTAF  162

Query  128  RRDELESLRASGTAEDFEEREQLLTDCMAL  157
                + +LRASGT E++EEREQLL D   L
Sbjct  163  HEITMAALRASGTEEEYEEREQLLQDIHDL  192

>PHYCA_129230
Length=141

 Score = 38.9 bits (89),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 31/48 (65%), Gaps = 0/48 (0%)

Query  113  GKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDE  160
            G A R RF+ L+   R  ++ S R+SGT E++ ER++LL D +  +D+
Sbjct  27   GPALRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDELLQDIVTRMDD  74

>H310_11875
Length=172

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 0/51 (0%)

Query  112  DGKACRRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMALVDECL  162
            DGK  + RF  L+   +   LES RASG +ED  E+ +LL D + L ++ L
Sbjct  17   DGKRAQNRFLLLVRQHKASNLESARASGVSEDETEKSKLLDDLVPLYNDTL  67

>H257_12323
Length=178

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 11/87 (13%)

Query  68   PSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSC-----TADGKACRRRFNA  122
            P  D++LL +     P+AA   +   SW S+A      L +C       DG+  + RF A
Sbjct  12   PEEDVVLLIQVAADLPFAADKCQVTKSWQSLA----DKLVACEHFDRVVDGRKVQNRFTA  67

Query  123  LLDVFRRDELESLRASGTAEDFEEREQ  149
            L+D  R+ +  S + SG   D EE E+
Sbjct  68   LVDEHRKFDTASAKLSGV--DQEELEK  92

Lambda      K        H        a         alpha
   0.313    0.125    0.352    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 17350068225

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40