Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_184581475874774735520.0
PPTG_171291475874574733030.0
PHYCA_5114151475874475030010.0
PHYRA_810981475874175028760.0
PHYSO_3489031475876676327780.0
PHYKE_839514758142075927300.0
PHALS_064761475872675024550.0
HYAP_071041475872175123520.0
PYIR_134181475874777615870.0
PYIW_199691475873376415730.0
PYU1_G0017331475873275715630.0
PYAP_177631475879452314400.0
PYAR_135711475866659113990.0
PYVX_235901475868979912813e-166
CCI44111147585764989223e-114
CCA22843147585865229225e-114
SPRG_06355147587134706522e-73
SDRG_01763147587364746331e-70
SDRG_045751382110032281678e-11
PYVX_215131382114463801671e-10
SPRG_126211382110031771642e-10
PYAP_222301382111164271606e-10
H257_117731382110263531597e-10
H310_082921382110073531598e-10
PYAR_14788138217953661516e-09
PYIR_141071382111764141501e-08
PHYSO_4705331382110843501445e-08
SPRG_1903013355510001691411e-07
SDRG_079831335559911691401e-07
H257_0193413355510224441392e-07
PITG_172501382110463421312e-06
PPTG_113651382111063501274e-06
PYU1_G002110138219994091203e-05
PYIW_157171382111211441132e-04
PHYSO_5453781252822443820.52
PHYSO_30027248502636157820.89
PYIW_19868167626270122801.1
PITG_0658055211214108811.2
PITG_1522312293920254801.7
PYIR_233601252822772781.7
PYAR_17584122931040122801.8
PPTG_083696573598136791.9
PYU1_G0130318423040189782.0
PPTG_138275521121268792.5
PPTG_13828551795868782.6
PHYCA_133652506620050752.8
HYAP_1225312804121073782.8
PITG_155251252822443753.1
PHYCA_5718411252824175753.3
PYU1_G0122671252821740753.5
PPTG_070251252822443753.6
PYAP_24374122931073112773.6
PHALS_000541252822443744.6
PHYRA_828581252822443745.4
H257_0579012494393774755.6
PYVX_217761252820340735.7
PHYRA_822426573588136755.8
PHYCA_10450557359194110735.9
HYAP_049255521115068756.5
PHYRA_795195521124068756.9
PHYCA_5345035521108968748.6
H310_028731531262933739.0
CCI101751252822240729.3
H257_099931531262933739.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18458

Length=747
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18458                                                            1372       0.0   
PPTG_17129                                                            1276       0.0   
PHYCA_511415                                                          1160       0.0   
PHYRA_81098                                                           1112       0.0   
PHYSO_348903                                                          1074       0.0   
PHYKE_8395                                                            1056       0.0   
PHALS_06476                                                           950        0.0   
HYAP_07104                                                            910        0.0   
PYIR_13418                                                            615        0.0   
PYIW_19969                                                            610        0.0   
PYU1_G001733                                                          606        0.0   
PYAP_17763                                                            559        0.0   
PYAR_13571                                                            543        0.0   
PYVX_23590                                                            498        3e-166
CCI44111                                                              359        3e-114
CCA22843                                                              359        5e-114
SPRG_06355                                                            255        2e-73 
SDRG_01763                                                            248        1e-70 
SDRG_04575                                                            68.9       8e-11 
PYVX_21513                                                            68.9       1e-10 
SPRG_12621                                                            67.8       2e-10 
PYAP_22230                                                            66.2       6e-10 
H257_11773                                                            65.9       7e-10 
H310_08292                                                            65.9       8e-10 
PYAR_14788                                                            62.8       6e-09 
PYIR_14107                                                            62.4       1e-08 
PHYSO_470533                                                          60.1       5e-08 
SPRG_19030                                                            58.9       1e-07 
SDRG_07983                                                            58.5       1e-07 
H257_01934                                                            58.2       2e-07 
PITG_17250                                                            55.1       2e-06 
PPTG_11365                                                            53.5       4e-06 
PYU1_G002110                                                          50.8       3e-05 
PYIW_15717                                                            48.1       2e-04 
PHYSO_545378                                                          36.2       0.52  
PHYSO_300272                                                          36.2       0.89  
PYIW_19868                                                            35.4       1.1   
PITG_06580                                                            35.8       1.2   
PITG_15223                                                            35.4       1.7   
PYIR_23360                                                            34.7       1.7   
PYAR_17584                                                            35.4       1.8   
PPTG_08369                                                            35.0       1.9   
PYU1_G013031                                                          34.7       2.0   
PPTG_13827                                                            35.0       2.5   
PPTG_13828                                                            34.7       2.6   
PHYCA_133652                                                          33.5       2.8   
HYAP_12253                                                            34.7       2.8   
PITG_15525                                                            33.5       3.1   
PHYCA_571841                                                          33.5       3.3   
PYU1_G012267                                                          33.5       3.5   
PPTG_07025                                                            33.5       3.6   
PYAP_24374                                                            34.3       3.6   
PHALS_00054                                                           33.1       4.6   
PHYRA_82858                                                           33.1       5.4   
H257_05790                                                            33.5       5.6   
PYVX_21776                                                            32.7       5.7   
PHYRA_82242                                                           33.5       5.8   
PHYCA_104505                                                          32.7       5.9   
HYAP_04925                                                            33.5       6.5   
PHYRA_79519                                                           33.5       6.9   
PHYCA_534503                                                          33.1       8.6   
H310_02873                                                            32.7       9.0   
CCI10175                                                              32.3       9.3   
H257_09993                                                            32.7       9.5   

>PITG_18458
Length=747

 Score = 1372 bits (3552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/747 (100%), Positives = 747/747 (100%), Gaps = 0/747 (0%)

Query  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60
            MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF
Sbjct  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60

Query  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattpsNYAA  120
            YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAA
Sbjct  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATTPSNYAA  120

Query  121  STPGKFTSTHQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkAIRREVMNELHVT  180
            STPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVT
Sbjct  121  STPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVT  180

Query  181  RYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPDERAALTRQTSTKTSQAT  240
            RYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQAT
Sbjct  181  RYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQAT  240

Query  241  RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAA  300
            RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAA
Sbjct  241  RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAA  300

Query  301  HARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLA  360
            HARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLA
Sbjct  301  HARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLA  360

Query  361  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD  420
            AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD
Sbjct  361  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD  420

Query  421  PLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLA  480
            PLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLA
Sbjct  421  PLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLA  480

Query  481  KRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTK  540
            KRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTK
Sbjct  481  KRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTK  540

Query  541  QALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVV  600
            QALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVV
Sbjct  541  QALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVV  600

Query  601  GAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPAR  660
            GAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPAR
Sbjct  601  GAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPAR  660

Query  661  SEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHASSRPSNRVKTSSKT  720
            SEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSSKT
Sbjct  661  SEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSSKT  720

Query  721  HQRAHTRYEPRTSPDYKPVGILKRNKL  747
            HQRAHTRYEPRTSPDYKPVGILKRNKL
Sbjct  721  HQRAHTRYEPRTSPDYKPVGILKRNKL  747

>PPTG_17129
Length=745

 Score = 1276 bits (3303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/747 (90%), Positives = 706/747 (95%), Gaps = 6/747 (1%)

Query  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60
            MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF
Sbjct  5    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  64

Query  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattpsNYAA  120
            YGRSTSNTSSDMPQYRTTEQ+R NN+TLSALHEDVEASNVSNVSSSFSQFS TTPSNYAA
Sbjct  65   YGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPSNYAA  124

Query  121  STPGKFTSTHQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkAIRREVMNELHVT  180
            STPG F+ST+ G NT  +TTG SRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVT
Sbjct  125  STPGNFSSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVT  184

Query  181  RYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPDERAALTRQTSTKTSQAT  240
            RYDVLKELALLKGAIAQLTATQH AP SVSSTESSSSDPLS +ERAALTRQTSTKTSQAT
Sbjct  185  RYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEERAALTRQTSTKTSQAT  244

Query  241  RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAA  300
            RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPL+PQQINEMFPLID TSELAA
Sbjct  245  RDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAA  304

Query  301  HARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLA  360
            HARGLTPGTRTWALTRVEEWLDAR+N+GNDTLLAVVGEGGTGKS FCGTVAQQFRGNLLA
Sbjct  305  HARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLA  364

Query  361  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD  420
            AHCCQFDRKSKSSPRNVLLSMVHQLVD+LPSFKNQLARLNLKYVLEEADPFLLAGKVLVD
Sbjct  365  AHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVD  424

Query  421  PLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLA  480
            PLNA+EEPMHATF+LVDGIDQCA G NGRNELLE FAQVIPQLPSWVGFL+SSKPSSKLA
Sbjct  425  PLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLA  484

Query  481  KRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTK  540
            KRLPVSSVLDFSAKNGAFVAD SS+VDDIARNFSDDD AEAKKVLKKKSGGNFAYLEFTK
Sbjct  485  KRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTK  544

Query  541  QALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVV  600
            QALSHPG+AAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL+V
Sbjct  545  QALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIV  604

Query  601  GAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPAR  660
            GAAAGPYSP+TEEQAKEHF  T EDLRMLRRSFVDLV+VKHG+YRIESSALCAWLSDPAR
Sbjct  605  GAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPAR  664

Query  661  SEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHASSRPSNRVKTSSKT  720
            SEEQFYFS+DDAL ALRK+RRV      S    +S    ++ +G A+ R S+RVKTSSKT
Sbjct  665  SEEQFYFSIDDALQALRKMRRV------SSSGSSSGHSGSSSDGKATHRASSRVKTSSKT  718

Query  721  HQRAHTRYEPRTSPDYKPVGILKRNKL  747
            HQRAHTR+EPR +PD+KPVGILKRNKL
Sbjct  719  HQRAHTRHEPRANPDFKPVGILKRNKL  745

>PHYCA_511415
Length=744

 Score = 1160 bits (3001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/750 (85%), Positives = 681/750 (91%), Gaps = 9/750 (1%)

Query  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60
            M+R+KNKLRSSRLHKKEGAWALDEDSLRLKQ Q DD VRFDRSTTLADTVNVTDDVEEMF
Sbjct  1    MHRLKNKLRSSRLHKKEGAWALDEDSLRLKQ-QQDDAVRFDRSTTLADTVNVTDDVEEMF  59

Query  61   YGRST--SNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattpsNY  118
            YGR+T  S T+S+MPQYRTTEQ+RGNN+TLSALHE+    + SNVSSSFSQFSATTPSNY
Sbjct  60   YGRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQFSATTPSNY  119

Query  119  AASTPGKF-TSTHQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkAIRREVMNEL  177
            AASTPG    +T+ G ++A  T G SR +S DFELERLRSEVLEVKEEVKAIRREVMNEL
Sbjct  120  AASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNEL  179

Query  178  HVTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPDERAALTRQTSTKTS  237
            HVTRYDVLKEL LLKGAIAQLTA QH +  SVSSTESSSSDPLS +ERAALTRQTSTKTS
Sbjct  180  HVTRYDVLKELTLLKGAIAQLTAAQHSS-PSVSSTESSSSDPLSAEERAALTRQTSTKTS  238

Query  238  QATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSE  297
             ATRDRLAASR N+HKTPPPAARASVRLTQLAPVADNALSTPL+ QQINEMFPLID TS+
Sbjct  239  AATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSD  298

Query  298  LAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGN  357
            LAAHARGLTPG+RTWALTRVEEWLDAR+N+G DTLLAVVGEGGTGKS F GTVAQQFRGN
Sbjct  299  LAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGN  358

Query  358  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKV  417
            LLAAHCCQFDRKSKSSPRNVLLSMVHQLVD+LP FKNQLARLNLKYVLEEADP LLAGKV
Sbjct  359  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKV  418

Query  418  LVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSS  477
            LVDPLNA+EEP+HATF+LVDGIDQC+ G NGRNELL+ FAQVIPQLPSW+GFL+SSKPSS
Sbjct  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478

Query  478  KLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLE  537
            KLAKRLPVSSVLDFSAKNGAFVAD SSLVDDIARNFSDDDAAEAKKVLK KSGGNFAYLE
Sbjct  479  KLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLE  538

Query  538  FTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  597
            FTKQALSHPG+ A SKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ
Sbjct  539  FTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  598

Query  598  LVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSD  657
            LVVGAA+GPYSPVTEEQAKEHF LT EDLRMLRRSFVDLV+VKHGSYRIESSALCAWLSD
Sbjct  599  LVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSD  658

Query  658  PARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHASSRPSNRVKTS  717
            PARSEEQFYFS+DDAL ALRK+RR   + SSSGHS + S   ++   H SSR S+RV  S
Sbjct  659  PARSEEQFYFSIDDALHALRKMRR---NVSSSGHSHSGSSSDSSATHHTSSRASSRVTAS  715

Query  718  SKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747
            SK+ QR+HTR+EPRT+P  KPVGILKR KL
Sbjct  716  SKSQQRSHTRHEPRTNPG-KPVGILKRGKL  744

>PHYRA_81098
Length=741

 Score = 1112 bits (2876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/750 (80%), Positives = 660/750 (88%), Gaps = 16/750 (2%)

Query  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60
            M+R+KNKLR   LHKK+  WALDEDSLRLKQTQDD  +R DRSTTL DTVNVTDDVEEMF
Sbjct  5    MHRLKNKLR---LHKKDANWALDEDSLRLKQTQDD-ALRLDRSTTLTDTVNVTDDVEEMF  60

Query  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattpsNYAA  120
            YG    +T SD+PQYRTTEQLRG ++TLSALHED EASN S+  S FS  + +   NYAA
Sbjct  61   YG--GRSTVSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPS---NYAA  115

Query  121  STPGKFTS--THQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkAIRREVMNELH  178
            STPG   +   +   +TA +TT   RA+S  FELERLRSEV+EVKEEVKAIRREVMNELH
Sbjct  116  STPGHVPNQGAYHDFSTAHSTT---RAISDAFELERLRSEVVEVKEEVKAIRREVMNELH  172

Query  179  VTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdp-lsPDERAALTRQTSTKTS  237
            VTRYDVLKELALLKGAIAQL ATQH++PA+  S+  SSS   LS DERAALTRQTSTKTS
Sbjct  173  VTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTS  232

Query  238  QATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSE  297
             ATR+RLAASR NIHKTPPPAARASVRLTQLAPVADNALSTPL PQQIN+MFPLID TSE
Sbjct  233  SATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSE  292

Query  298  LAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGN  357
            LAAHAR LTPG+RTWALTRVEEWLDAR+N+G+DTLLAVVGEGGTGKS F GTVAQQFRGN
Sbjct  293  LAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGN  352

Query  358  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKV  417
            LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLP FKNQLARLNLKYVLEEADPF+LAGKV
Sbjct  353  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKV  412

Query  418  LVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSS  477
            LVDPLNA+EEPMHATF+LVDGIDQC+ G  GRNELLE FAQVIP LPSWVGF+VSSKPSS
Sbjct  413  LVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSS  472

Query  478  KLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLE  537
            KLAKRLPVSSVLDFSAKNGAFV+D SSLV+D+ARNFSD+DAAEAKKVLK+KSGGNFAYLE
Sbjct  473  KLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLE  532

Query  538  FTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  597
            FTKQALSHPG+AAASKEGAVPL VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ
Sbjct  533  FTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  592

Query  598  LVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSD  657
            L+VGAAAGPYS VTEEQAK+HFNLT EDLRMLR SFVDLV+V+HG+YRIESSALC WLSD
Sbjct  593  LIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSD  652

Query  658  PARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHASSRPSNRVKTS  717
            PARSEEQFYF++DDA+ ALR +RR  SSSS S    +      ++ GH SSR S+RV T+
Sbjct  653  PARSEEQFYFAIDDAIQALRSMRRSVSSSSHSNSGSSDDSPPTSRRGHTSSRASSRV-TT  711

Query  718  SKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747
            SK++QRAHTR++PR + ++KPVGILKRNKL
Sbjct  712  SKSNQRAHTRHDPRATQEFKPVGILKRNKL  741

>PHYSO_348903
Length=766

 Score = 1074 bits (2778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/763 (74%), Positives = 636/763 (83%), Gaps = 25/763 (3%)

Query  1    MNRIKNKLRSSRL--HKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEE  58
            M+RIKNKLRSSRL   KK+ AWALDEDSLRLKQ QDD PVR+DRS TL+DTVNVTDDVE+
Sbjct  6    MHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVED  65

Query  59   MFYGR---STSNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattp  115
            MFYGR   ST++ +SD+PQYRTTEQLR  ++TLSALHED E  + +N  SS     + T 
Sbjct  66   MFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTT  125

Query  116  -sNYAASTPGKF-------------TSTHQGLNTAQTTTGMSRAVSGDFelerlrsevle  161
             SNYAASTPG F             T+  +G +   TT G + A  G+ E  R     ++
Sbjct  126  PSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAEVLEVK  185

Query  162  vkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdpls  221
             + +  AIRREVMNELHVTRYDVLKELALLKGA+AQLTA QH +P SVSST+SSS DPLS
Sbjct  186  EEVK--AIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLDPLS  243

Query  222  PDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLN  281
             D+RA L RQTSTKTS ATR+RLAASR N+ KTPPP ARASVRLTQLAPVAD+ALSTPL 
Sbjct  244  ADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLT  303

Query  282  PQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGT  341
             QQINEMFPLID TSELAAHARGLTPG+RTWALTRVEEWLD+R+N G+D LLAVVGEGGT
Sbjct  304  SQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGT  363

Query  342  GKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNL  401
            GKS FCGTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VD+ P FKNQLARLNL
Sbjct  364  GKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNL  423

Query  402  KYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIP  461
            KYVLEEADP LLA KVLVDPLNA+EEP+ A F++VDGIDQCA G+ GRNELLE FAQ+IP
Sbjct  424  KYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIP  483

Query  462  QLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEA  521
            QLP+WVGFL+SSKPSSKLAKRLPVSSVLDFSA+N AFVAD + LV+DIARNFSDDD  +A
Sbjct  484  QLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKA  543

Query  522  KKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKF  581
            K +LK+KSGGNFAYLEFTKQALSHPG+AAASKEGAVPL VL++LPETLYDIYAEIFEDKF
Sbjct  544  KSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKF  603

Query  582  GQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKH  641
            GQGRARVWGKAKPLLQLVVGAA+GPYSPVTEEQA+EHFNLT EDLRMLRRSFVDLV+V+H
Sbjct  604  GQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRH  663

Query  642  GSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAA  701
            GSYRIESSALCAWLSDPARSEEQFYFS+DDAL ALR++RR    SS S    + S     
Sbjct  664  GSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRS--GSSGSSSGHSGSSSDGT  721

Query  702  KNGHASSRPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKR  744
             +    SR ++R  T  K+H R+H ++EPR +PDYKPVGILKR
Sbjct  722  TSAPTLSRTTSRGAT--KSHHRSHVKHEPRANPDYKPVGILKR  762

>PHYKE_8395
Length=1420

 Score = 1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/759 (72%), Positives = 628/759 (83%), Gaps = 27/759 (4%)

Query  4     IKNKLRSSRLHKKEGAWALDEDSLRL-KQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYG  62
             +KNKLRSS+LHKKEGAWALDEDSLRL KQ QD D  RFDR+T + DTVNV+DDVE+MFYG
Sbjct  674   LKNKLRSSKLHKKEGAWALDEDSLRLNKQQQDAD--RFDRNTAMTDTVNVSDDVEDMFYG  731

Query  63    RSTSNT----SSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattpsNY  118
             RST+ +    +SD+P YRTTEQ+RG N TL+ALHE+          +  +   + + ++ 
Sbjct  732   RSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEE-------EAMTPSASHLSNSFASS  784

Query  119   AASTPGKFTS--THQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkA----IRRE  172
              ASTPG + +  T  G NT  +T G+SR +S D       S +    +EVKA    IRRE
Sbjct  785   YASTPGNYQNPPTFNGFNTTHST-GLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRRE  843

Query  173   VMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPDERAALTRQT  232
             VMNELH+TRYDVLKEL LLKGA+AQL+A Q     SVS + SSSSDPLS ++RAALTR  
Sbjct  844   VMNELHMTRYDVLKELTLLKGAVAQLSAAQ--TTGSVSPSTSSSSDPLSAEDRAALTRVP  901

Query  233   STKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI  292
             S  TS+ T+DRLA SR NIH  PPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI
Sbjct  902   SKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLI  961

Query  293   DSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQ  352
             D TSELAAHARGL PGTRTWALTRVEEWLDAR+N+GNDT+LAVVG+GGTGKS FCGTVAQ
Sbjct  962   DFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQ  1021

Query  353   QFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFL  412
             QFRGNLLAAHCCQFDRKSKS+PRNVLLS VHQLVD+LP FKNQLARLNLKYVLEE+DPFL
Sbjct  1022  QFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFL  1081

Query  413   LAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVS  472
             LA KV VDPLNAVEEP+HATF+LV+G+DQC+ G NGRNELLE  +Q+IPQLPSWVGF++S
Sbjct  1082  LAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMIS  1141

Query  473   SKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGN  532
             SKP SK AKRLPVSSVLDFSAKNGAFV+D SSLVDDIARNFSD+D+AEAK+VLK+KSGGN
Sbjct  1142  SKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGN  1201

Query  533   FAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKA  592
             FAYLEFTKQALSHPG+A ASKEGAVPLEVL +LP++L+DIY EIFEDKFGQGRAR+W KA
Sbjct  1202  FAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKA  1261

Query  593   KPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALC  652
             KPLLQL+VGAAAGPYSPVTE QAKEHF  TTEDLRMLRRSFVDLV VKHG+YR+ESSALC
Sbjct  1262  KPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALC  1321

Query  653   AWLSDPARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKA----AKNGHASS  708
             +WLSDPARSEEQFY SVDDAL ALRK+RR  SS S+S HS + S        +   H  S
Sbjct  1322  SWLSDPARSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTPS  1381

Query  709   RPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747
             R ++    SSK+HQRAHTR+EPR +P++KP+GILKR K+
Sbjct  1382  RATSSRAASSKSHQRAHTRHEPRVNPEFKPMGILKRGKM  1420

>PHALS_06476
Length=726

 Score = 950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/750 (70%), Positives = 596/750 (79%), Gaps = 31/750 (4%)

Query  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60
            M+++KNKLR S L KKE A+ L++DSLR K TQD+  VR DRS TL DTVN+TDDVEEMF
Sbjct  5    MHKLKNKLRGSLLLKKESAYELNDDSLRRKHTQDE-TVRVDRSATLTDTVNMTDDVEEMF  63

Query  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattp-sNYA  119
            Y RST+  +S +PQYRTTEQ+RGNN+ L ALHED E  + ++ +SS     + T  S+YA
Sbjct  64   YNRSTA--TSGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSYA  121

Query  120  ASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkAIRREVMNELHV  179
            ASTPG     H   +T   TT    A+SGDF+LERL SEVL++K EVK IRREVMNELHV
Sbjct  122  ASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELHV  181

Query  180  TRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPD-ERAALTRQTSTKTSQ  238
            TRYDVLKEL LLKGAIAQL +T+ +  +S  S+  SSS       ERAALTRQT TKTSQ
Sbjct  182  TRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAALTRQTPTKTSQ  241

Query  239  ATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSEL  298
            ATRDRLAA R N +K PP A RAS RLTQLAPVAD+ALSTPLN QQINE FPLID TSEL
Sbjct  242  ATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINESFPLIDFTSEL  301

Query  299  AAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNL  358
            AAHAR LTPG+R+WALTR++EWLDAR+++GNDTLLAVVGEGG+GKS FCGTVAQQFRGNL
Sbjct  302  AAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFCGTVAQQFRGNL  361

Query  359  LAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVL  418
            LAAHCCQFDRKSKS PRNVLLSMVHQLVD+LP FKNQLARLNL+YVLEE DPFLLA KVL
Sbjct  362  LAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEETDPFLLANKVL  421

Query  419  VDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSK  478
            +DPLNA+EEP H+TFIL+DGIDQCA GSNGRNELLE  +Q+I  LPSWVGFLVSSKPSSK
Sbjct  422  IDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWVGFLVSSKPSSK  481

Query  479  LAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEF  538
            LAK LPVSSVLDFSAKNGAFVADASSLV+DI++ FSDDDA EAK++L KKSGGNFAYLEF
Sbjct  482  LAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEF  541

Query  539  TKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  598
            TKQALSHPG+A  S  G VPL VL ELPETLYDIYAEIFEDKFGQG AR WGKAKPLLQL
Sbjct  542  TKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHARAWGKAKPLLQL  601

Query  599  VVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDP  658
            +VGAAAGPYS VTEEQAK+  +L  +DLRMLRRSFVD+V+VKH                 
Sbjct  602  IVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-----------------  644

Query  659  ARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHASSRPSNRVKTSS  718
               EEQFYFS++DALLALRK+R   SS SSSG  G SSD  A  +    SR ++R K  +
Sbjct  645  ---EEQFYFSIEDALLALRKMRLNSSSDSSSGDPGISSDKNAPDHNRRLSRANSRGKLPN  701

Query  719  KTHQRAHTRYEPRTS-PDYKPVGILKRNKL  747
            K+      R+EPRT+  +YKPVGILKR KL
Sbjct  702  KSQ-----RHEPRTNFENYKPVGILKRGKL  726

>HYAP_07104
Length=721

 Score = 910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/751 (66%), Positives = 577/751 (77%), Gaps = 34/751 (5%)

Query  1    MNRIKNKLRSSRLHKKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMF  60
            M+R+KNKLR   LHKK+G W LDEDS+RLKQ QD   VR DRS TL DTVN TDDVEEMF
Sbjct  1    MHRLKNKLR---LHKKDGTWDLDEDSMRLKQNQDH-VVRLDRSGTLTDTVNETDDVEEMF  56

Query  61   YGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqfsattpsNYAA  120
            Y  + + +++  PQYR+TEQL G  +TL++L+ED E  +  + +SS     +   ++ ++
Sbjct  57   YSSTQTRSTNGPPQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISS  116

Query  121  STPGKFTSTHQGLNTAQTTTGMSRAVSG-DFelerlrsevlevkeevkAIRREVMNELHV  179
                  TSTH  L T+ +     RAV G   ELE+LR E++EVK+EV AIR+ V+NELHV
Sbjct  117  V---NLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHV  173

Query  180  TRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsP---DERAALTRQTSTKT  236
            TRYDVLKELALLKGAIAQLT T    P + S   S      +P    +R ALTRQTST T
Sbjct  174  TRYDVLKELALLKGAIAQLTGT--FPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMT  231

Query  237  SQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTS  296
            S ATRDRLAASR N +K PPPAARASVRLTQLAPVAD+ALSTPL+  Q+N++FPLID T+
Sbjct  232  SSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTT  291

Query  297  ELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRG  356
            ELAAHAR LTPG+RTWALTR EEWL++R+  G D LLAVVGEGG+GKS FCGTVAQQ+RG
Sbjct  292  ELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRG  351

Query  357  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGK  416
             L+AAHCCQFDRK KSSPRNVLLS+VHQLV +LP FKNQLARLNLKYVLEEADP LLA K
Sbjct  352  QLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASK  411

Query  417  VLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPS  476
            VLVDPLNA+E+P+   F+LVDGIDQC VG  GRNELLE  AQ+IPQLPSW+G +VSSKPS
Sbjct  412  VLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPS  471

Query  477  SKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYL  536
            SKLAKRLPVSSVLDFSAKN AFVAD SSLVD+IA +F  +D  EAK+VLK KSGGNFAYL
Sbjct  472  SKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYL  531

Query  537  EFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLL  596
            EFTKQALS  G+A+ SKEG V ++VL ELPETLYDIYAEIFEDKFG GRARVW KA+ +L
Sbjct  532  EFTKQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVL  589

Query  597  QLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLS  656
            QL +GA AGPYSPVTEEQA+EHF LTTEDLR+LRRSFVDLV+VKHG YRIE+SALCAWL 
Sbjct  590  QLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLC  649

Query  657  DPARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHASSRPSNRVKT  716
            DPAR+EEQFYF++DDAL ALRK+RR      S+  S        + NG A  R       
Sbjct  650  DPARAEEQFYFNIDDALQALRKMRRA-----SASASSGQLTSSGSSNGSAPGR-------  697

Query  717  SSKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747
             S++ Q+       +T  D +PV ILKR ++
Sbjct  698  -SQSPQKV------QTESDCQPVSILKRGRM  721

>PYIR_13418
Length=747

 Score = 615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/776 (46%), Positives = 486/776 (63%), Gaps = 111/776 (14%)

Query  21   ALDEDSLRLKQTQDDDPVRFDRSTTL------ADTVNVTDDVEEMFY-------------  61
            A DE++LR+ +   ++  RF R+TT+      + +  ++DDVEEMFY             
Sbjct  30   ATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSAS  89

Query  62   GRSTSN----TSSDM----------------------PQYRTTEQLRGNNITLSALHEDV  95
             RST N    T+S M                        YRTTEQ+RG N  L  L ED 
Sbjct  90   ARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTN--LMPLQED-  146

Query  96   EasnvsnvsssfsqfsattpsNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFelerl  155
                                       P            ++ TT M+ A +G   ++ L
Sbjct  147  ------------------------EVLPA----------ASRATTTMATASNGGNPIDAL  172

Query  156  rsevlevkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQL-TATQHIAPAsvsstes  214
            R+E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL TA +     S+ ++ +
Sbjct  173  RAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGA  232

Query  215  sssdplsP----DERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAP  270
            +      P    DE   ++R T+  TS+AT++R    R     + P   RAS RLTQLAP
Sbjct  233  AVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAP  288

Query  271  VADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGND  330
            VAD+ALSTPL   QI+EMFPL++ ++EL A A+   P +R WA+ R +EW+D+R+N+G D
Sbjct  289  VADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVD  348

Query  331  TLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLP  390
             LLA+VG+GG+GKST  G +  +F  N++A H C FDRKSKSSPRNVLLS+V+QL+ +LP
Sbjct  349  NLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLP  408

Query  391  SFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRN  450
             FKNQLARLNLKYVLEE DP +LA KVLVDPL A+EEP+ A   + DGIDQC   S GRN
Sbjct  409  LFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--SKGRN  466

Query  451  ELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIA  510
            +LL+  A +IP+LP+WVG  ++SKPS +L  +L ++S+LDFSAKN  ++ D   L++DI 
Sbjct  467  DLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDII  526

Query  511  RNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLY  570
             NFSD D  +A+++LK+KSGGNF +L+FTKQALSHPG+      G +PL+VLH+LPE++Y
Sbjct  527  GNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIY  584

Query  571  DIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLR  630
            +IY EIFEDKFG+GR+R+W K +PLL+L+V AA+GPY+ +TE QA+E F+L+ ED+R +R
Sbjct  585  EIYEEIFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIR  644

Query  631  RSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRRVgssssssg  690
            R+FVD+++V HG+YRIE+SAL  WL DP R+ EQFY  V   +  LR++    SS + S 
Sbjct  645  RAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQDSSDTHSA  704

Query  691  hsgnssdgKAAKNGHASSRPSNRVKTSSKTHQRAHTRYEPRTSP--DYKPVGILKR  744
             S  +S    +    ASS  S  V               P  +P  ++KPVGILK+
Sbjct  705  ASSEASSNNVSNVSTASSHLSYVVP--------------PPAAPKVNFKPVGILKK  746

>PYIW_19969
Length=733

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/764 (46%), Positives = 476/764 (62%), Gaps = 97/764 (13%)

Query  19   AWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT------DDVEEMFY-----------  61
            A A DEDSLR+ +   ++  RF R+TT+  +   +      DDVE+MFY           
Sbjct  28   ATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSS  87

Query  62   -------GRST--SNTSSDMPQ------------YRTTEQLRGNNITLSALHEDVEasnv  100
                   GRST  S  S+D               YRTTEQLRG    L  L ED      
Sbjct  88   VRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGT-ANLIPLQED------  140

Query  101  snvsssfsqfsattpsNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFelerlrsevl  160
                                    + T+T Q       + G S    G  +L+ LR+E+ 
Sbjct  141  -----------------EVLPAASRTTTTSQMPTNGNYSNGNS---GGGSQLDALRTELS  180

Query  161  evkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdpl  220
            E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL                  +  L
Sbjct  181  EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTA-------------LETKGL  227

Query  221  sPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPL  280
            S DE   ++R T+  TS+AT+DR A   T    + P   RAS RLTQLAPVAD ALSTPL
Sbjct  228  STDEINTISRTTALFTSKATKDRRA---TRDESSSPMLVRASSRLTQLAPVADEALSTPL  284

Query  281  NPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGG  340
               QI+EMFPLI+ + EL A +R     +R WA+ R +EW+D+R+N+G D LLA+VGEGG
Sbjct  285  LQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGG  344

Query  341  TGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLN  400
            +GKST  G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ +LP FKNQLARLN
Sbjct  345  SGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLN  404

Query  401  LKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVI  460
            LKYVLEE+DP +LA K+LVDPL A+EEPM A   ++DG+DQC   S GRN+LL+  A +I
Sbjct  405  LKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVII  462

Query  461  PQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAE  520
            P+LP+W+G  ++SKPS +L  RL +SS+LDFSAKN  ++ D   +++DI  +FSD D  +
Sbjct  463  PELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQ  522

Query  521  AKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDK  580
            A+++LK+KSGGNF +L+FTKQALSHPG+      G +PL+VLH+LPE++Y+IY EIFEDK
Sbjct  523  AREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDK  580

Query  581  FGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVK  640
            FG+GR R+W K +PLL+L+V AA+GPY+ +TE QA+E F L+ ED+R +RRSFVD++ V+
Sbjct  581  FGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVR  640

Query  641  HGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKA  700
            HG+YRIE+SAL  WL DP R+ EQFY  V   + ALR++    SS + S  S + S   A
Sbjct  641  HGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHHQDSSETHSVGSSDGSSSNA  700

Query  701  AKNGHASSRPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKR  744
              N             S+ +   ++    P    ++KPVGILK+
Sbjct  701  TSN------------VSTASSHLSYVVPPPVPKVNFKPVGILKK  732

>PYU1_G001733
Length=732

 Score = 606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/757 (46%), Positives = 478/757 (63%), Gaps = 92/757 (12%)

Query  23   DEDSLRLKQTQDDDPVRFDRSTTL------ADTVNVTDDVEEMFYG------RSTSN---  67
            DED+LR+ +   +D  R+ R+TT+      + +  ++DDVE+MFY       RSTS+   
Sbjct  32   DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRSTSDYTT  91

Query  68   --TSSDMPQ---------------YRTTEQLRGNNITLSALHEDVEasnvsnvsssfsqf  110
              T+S M                 YRTTEQLR  N  L  L+ED                
Sbjct  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTN--LMPLNED----------------  133

Query  111  sattpsNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFelerlrsevlevkeevkAIR  170
                        P             +TTTG +     D     LR+E++E+K+E++ IR
Sbjct  134  ---------EVLPAAM----------RTTTGAAGGSEAD----ALRAELVEMKQEMQTIR  170

Query  171  REVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvsst--essssdplsPDERAAL  228
            RE+MNE+HVTRYDVLKE+ +LKG I QL A               +     LSP +   +
Sbjct  171  REMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTI  230

Query  229  TRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEM  288
            TR T+  TS+AT+DRLAA    +   P      + RLTQLAPVAD+ALSTPL   QI++M
Sbjct  231  TRTTAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288

Query  289  FPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCG  348
            FPL+D +++L  HA+   P +R WA  R ++W+D+R+N+G D LLA+VG+GG+GKST  G
Sbjct  289  FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348

Query  349  TVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEA  408
             +  +F  N++A H C+FDRKSKSSPRNVLLS+V+QL+ +LP FKNQLARLNLKYVLEE 
Sbjct  349  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408

Query  409  DPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVG  468
            DP +LA KVLVDPL A+EEP+ A  +LVDGIDQC   S  RN+LL+  A +IP+ P+W+G
Sbjct  409  DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLG  466

Query  469  FLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKK  528
              ++SKPS +L  +L ++S+LDFS KN  ++ D   L++DI  NFSD D +EA+ +LK+K
Sbjct  467  IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  526

Query  529  SGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARV  588
            SGGNF +L+FTKQALSHPG+    + G VPL+VLH+LPE++Y+IY EIFEDKFG+G  R+
Sbjct  527  SGGNFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRL  584

Query  589  WGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIES  648
            W K +PLL L+V AA+GPY+ +TEEQA+E F+L+ +D+RM+RR+F D++ V+HG+YR+E+
Sbjct  585  WKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMET  644

Query  649  SALCAWLSDPARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKN-GHAS  707
            SA+  WL DP RS EQFY ++  ++  LR++ R  S+ + S  S  SS      N   AS
Sbjct  645  SAMYEWLVDPQRSGEQFYVNISASMDILRRLHRKSSTDTHSVASSESSSHHTPSNVSTAS  704

Query  708  SRPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKR  744
            S  S  V   +   Q+ +          +KPVGILK+
Sbjct  705  SYLSLNVPPPAAPAQKVN----------FKPVGILKK  731

>PYAP_17763
Length=794

 Score = 559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/523 (51%), Positives = 379/523 (72%), Gaps = 14/523 (3%)

Query  168  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH---------IAPAsvsstessssd  218
            AI+RE+MNE+H+TRYDVLKE+ +LKG I QL +               A++       ++
Sbjct  196  AIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQAN  255

Query  219  plsPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALST  278
             LSP+E+ AL+R+T+T  S+ T++R+  +R +  + PP     S RLTQLAPV D+ALST
Sbjct  256  ELSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALST  313

Query  279  PLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGE  338
            PL+ +QI++MFPLID ++E+   +R    G+R W   RV+EWLD+R+N+G D +LA+VG+
Sbjct  314  PLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGD  373

Query  339  GGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLAR  398
             G+GK+    +V  ++   ++A H C+FDRK+KSSPRNVLLS+V+QL  SLP FK+QLAR
Sbjct  374  AGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLAR  433

Query  399  LNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQ  458
            LNLKYVLEE D   L+ KVL+DPLNA+EEP+   F++ D IDQC  G  G N+L +  + 
Sbjct  434  LNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSA  492

Query  459  VIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDA  518
            +IP+ P W+GFLVSSKPS + A  +PVSSVLDFSA+N  ++ D   L++DIA  F D+D 
Sbjct  493  IIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQ  552

Query  519  AEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFE  578
            AEAK++LK KSGGN++YLEFTKQALS+PG+  AS  G VP++VLH+LP++LY+IY EIFE
Sbjct  553  AEAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFE  610

Query  579  DKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVS  638
            DKFG+GR RVW KA P+LQL+  AA+GPY+ +TE+   +  + T +++RMLRR+F+D++S
Sbjct  611  DKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIIS  670

Query  639  VKHGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRR  681
            ++HG+Y I SSA+  WL+D  R  EQ++  V+  +  LRK+ R
Sbjct  671  IRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  713

>PYAR_13571
Length=666

 Score = 543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/591 (47%), Positives = 392/591 (66%), Gaps = 62/591 (10%)

Query  168  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPDERAA  227
            AIRRE+MNE+H +RYDVLKE+ +LKG I QL  T                          
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET--------------------------  153

Query  228  LTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA-SVRLTQLAPVADNALSTPLNPQQIN  286
            + R+T+T  S++T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL  +QI+
Sbjct  154  MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQID  210

Query  287  EMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTF  346
            E+FPL+D ++E+   AR    GTR WA  RV+EWLD+R+N+G+D LLA+VG+ GTGK+  
Sbjct  211  ELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268

Query  347  CGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLE  406
                           H C+F+RK KSSPRNVLLS+V+QL  +LP+FK+QLARLNLKYVLE
Sbjct  269  ---------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLE  313

Query  407  EADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSW  466
            E D   LA KVLVDPL ++EEP+ A F+L+DG+DQC V +NG N+LL+  + V+P+ PSW
Sbjct  314  ETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYNDLLDFLSVVVPECPSW  372

Query  467  VGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLK  526
            +GFL+++KPS + A+++PV+S+LDFSAKN A+V D + L+ DI   F  +D A+A ++LK
Sbjct  373  LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432

Query  527  KKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRA  586
             KS GN++YLEFT+QA+S+PG+ A   +G+VP++VLH+LP++LY+IY EIFEDKFG+GR 
Sbjct  433  TKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRT  490

Query  587  RVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRI  646
            R+W KA P+LQL+  AA+GPY+ +TE+   +  +   +D+RMLRR+F+D++S++HG+Y I
Sbjct  491  RLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHI  550

Query  647  ESSALCAWLSDPARSEEQFYFSVDDALLALRKIRRVgssssssghsgnssdgKAAKNGHA  706
             SSAL  WL+DP R  E ++  V   +  LR++ R           G  +  +A     +
Sbjct  551  VSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGTPASERATTTSRS  610

Query  707  SSRPSNRV------------KTSSKTHQRAHTRYEPRTSPDYKPVGILKRN  745
             + P +              KT   +      R+EP  +P  KPVGILKR 
Sbjct  611  PASPESSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRT  661

>PYVX_23590
Length=689

 Score = 498 bits (1281),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 333/799 (42%), Positives = 436/799 (55%), Gaps = 162/799 (20%)

Query  1    MNRIKNKLR----SSRLHK------KEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTV  50
            M ++K KLR    SSR  +       +G    D++SLRL +   +D +RF R TTL+   
Sbjct  1    MTKLKTKLRGGGSSSRRERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSAS  60

Query  51   NVTDD-VEEMFY-------------------GRSTSNTSSDMPQYRTTEQLRGNNITLSA  90
            +   D VEEMFY                    RST+ +      YRTTEQLR     L  
Sbjct  61   SAMSDDVEEMFYGGGPGGHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTG--LEP  118

Query  91   LHEDVEasnvsnvsssfsqfsattpsNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDF  150
            L ED                    P      T G       GL   +      RA +   
Sbjct  119  LAED-------------RVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAET---  162

Query  151  elerlrsevlevkeevkAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvs  210
                            +AIRREVMNELHV RYDVLKE+ +LKGA+AQL A          
Sbjct  163  ----------------QAIRREVMNELHVLRYDVLKEVTVLKGAVAQLLAALA-------  199

Query  211  stessssdplsPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLT-QLA  269
                       P    A +R  S  ++ +     ++S   +     PA RA++ +   LA
Sbjct  200  -----------PGGGDAGSRPGSAGSATSAATTASSSSAELS----PADRAAIGVAPTLA  244

Query  270  PVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGN  329
            PV D ALS PL P+Q++E+FPL+D+++++AA AR   PGTR WA  RV+EWLD+R+N+G 
Sbjct  245  PVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQ  304

Query  330  DTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSL  389
            DTLL VVG  GTGKSTFCG+V    +GN+LA H C+FDRK+KS+PR VLLS+V Q+V +L
Sbjct  305  DTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANL  364

Query  390  PSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNG-  448
            P FK QLARLNLKYVLEE D F+LAGKVL+DPL A EEP+ A  +++DG+DQC     G 
Sbjct  365  PPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGG  424

Query  449  -RNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVD  507
             RNELLE  A V+PQLPSW+G LVSSKP+ +LA +L  +S+LDFS KN  FV DA  LVD
Sbjct  425  VRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVD  484

Query  508  DIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPE  567
            DIA NF+D  AAEA+++L+ K+GGNFAYL+FT+QALS PG+     +G + L++LH+LPE
Sbjct  485  DIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL----DDGELELDMLHDLPE  540

Query  568  TLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLR  627
            +LY+IY EIFED                                            +D+R
Sbjct  541  SLYEIYLEIFED-------------------------------------------NDDMR  557

Query  628  MLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRRVgssss  687
            +++RSFVD+++V+ G YRIESSAL  WLSDPARS E F+F  D  +  LR++++      
Sbjct  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQ------  611

Query  688  ssghsgnssdgKAAKNGHASSRPSNRVKTS-------------------SKTHQRAHTRY  728
                       +A   GH   R S R                       ++T  R  +RY
Sbjct  612  HVAAKAKQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPPPARTSSRVSSRY  671

Query  729  EPRTSPDYKPVGILKRNKL  747
            EP  +P  KPVGILKR +L
Sbjct  672  EPPANPS-KPVGILKRGRL  689

>CCI44111
Length=576

 Score = 359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 196/498 (39%), Positives = 288/498 (58%), Gaps = 9/498 (2%)

Query  169  IRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPAsvsstessssdplsPDERAAL  228
            +R+E++  +  TRYD+LKE+  LKG +A  T +  I     +     +    +    +  
Sbjct  70   VRQELIEAIQCTRYDILKEIVTLKGQVA--TMSIKIDSPINAKINKLNHTTANGSACSEG  127

Query  229  TRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVR---LTQLAPVADNALSTPLNPQQI  285
                   ++  T DR        H T   +  + +R   L  L  + +  LS PL+  +I
Sbjct  128  ADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSKPLSKDEI  187

Query  286  NEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKST  345
            +EMFPLID + ++ ++A  L  GTR WAL  + +W+ + +  GN+ +L +VGEGG GKST
Sbjct  188  DEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKST  247

Query  346  FCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVL  405
              G V Q+F  NL A H  QFDRK  SS R+V+LS+V Q    L  +K QL RLNL+Y+L
Sbjct  248  LAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYIL  307

Query  406  EEADPFLLAGKVLVDPLNAV-EEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLP  464
             E++P ++A K+L+DPL A+ E      F+L DGIDQC V  N  N+LLEL + +  + P
Sbjct  308  AESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV-KNQSNDLLELLSHITERFP  366

Query  465  SWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKV  524
            SW+GF+V+SK     A RL  +SV+     N  F+ D+  L++++   F      EA  +
Sbjct  367  SWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDI  426

Query  525  LKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  584
            L +KSGGN  YL+F  +ALSHP +    ++  + L+VL ELPE++ +I   IF+DKFGQG
Sbjct  427  LMRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELPESVDEIIFTIFDDKFGQG  484

Query  585  RARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSY  644
              RVW  AKP+L+++V AAAGPY  V E Q K+ F L   + RM+ R+F D++      Y
Sbjct  485  HQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGY  544

Query  645  RIESSALCAWLSDPARSE  662
            RI +S+L  WL    RS+
Sbjct  545  RIINSSLYDWLVVEKRSQ  562

>CCA22843
Length=586

 Score = 359 bits (922),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 199/522 (38%), Positives = 303/522 (58%), Gaps = 45/522 (9%)

Query  168  AIRREVMNELHVTRYDVLKELALLKGAIAQL--------------------TATQHIAPA  207
            ++R+E++  +  TRYD++KE+  L+G +  +                    T     A +
Sbjct  76   SVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFS  135

Query  208  svsstessssdplsPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQ  267
              +  +   S  ++P ER+ +    S K+   T +RL         T   +   SV    
Sbjct  136  ESAEDDEIISRFITP-ERSTIVADCSYKSGFVT-ERL--------NTKDSSFSTSV----  181

Query  268  LAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNL  327
              P+ ++ LS PL+  + +EMFP ID  S+L ++A  L  GTR WAL RV+EW+++ +  
Sbjct  182  --PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKS  239

Query  328  GNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD  387
             ND +L ++GEGG+GKST  G + Q+F   L A H CQFDRKS+SS R+V+LS+V Q   
Sbjct  240  ENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFAS  299

Query  388  SLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHAT---FILVDGIDQCAV  444
              P +K QL  LNL+Y+L+E++P ++A K+L++PL A+  P+  +   F+L DGIDQC V
Sbjct  300  KNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLV  357

Query  445  GSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASS  504
              N  N+LL+L + +  + PS +GF+V+SK S     +    S++    +NG F+ D+  
Sbjct  358  -ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRI  416

Query  505  LVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHE  564
            L+++   NF      EA  +L +KSGGN  YL+FT++ALSHP +    +   + L+VL E
Sbjct  417  LMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ERTFLSLDVLDE  474

Query  565  LPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTE  624
            LP+++ DI+  IFEDKFGQG  RVW   KP+L+ +V AAAG +  V E Q K+ F L  E
Sbjct  475  LPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKE  534

Query  625  DLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFY  666
            + RM++RSF D++      YRI +S+L AWL    RS + FY
Sbjct  535  EWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFY  575

>SPRG_06355
Length=713

 Score = 255 bits (652),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 158/470 (34%), Positives = 253/470 (54%), Gaps = 38/470 (8%)

Query  222  PDERAALTRQTSTKTSQATRD--RLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTP  279
            P   + + R++   +S+ +R+  +L+   + I +      R S R     P+ D AL+ P
Sbjct  252  PKRESTVVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTR----QPIKDQALTQP  307

Query  280  LNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEG  339
                 +N+  P +++       A  + P TRTWA+ +  +W           +L VVG  
Sbjct  308  WE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGA  362

Query  340  GTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARL  399
            G GKST    +   +   ++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RL
Sbjct  363  GAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRL  420

Query  400  NLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQV  459
            NL Y+++E DP +LA K+L++PL ++  P+ +  I++D +D+ A  + G N L+ L A V
Sbjct  421  NLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDA-STPGTN-LISLLADV  478

Query  460  IPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAA  519
              + PSWV FL+SS+P   + K LP   VL F  ++  F AD +  V  +      DD  
Sbjct  479  ALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-K  537

Query  520  EAKKVLKKKSGGNFAYLEFTKQALS--HPGIAAASKEGAVPLEVLHELPETLYDIYAEIF  577
                +LK KS G+F YL+F  QA +  H  I A          ++ ELP+TLY+IY ++F
Sbjct  538  NILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAG---------MILELPKTLYEIYDQVF  588

Query  578  EDKFGQGRARVWGKAKPLLQLVVGAA-------AGPYSPVTEEQAKEHFNLTTEDLRMLR  630
            E+K+G+GR RVW K +P+L+ +VGAA       A P+  VTE   +  F L   DL ++ 
Sbjct  589  EEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIA  646

Query  631  RSFVDLVSVKH--GSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRK  678
            RSF D+V+V    G YR++S  L  +L D +RS+E  + +V+  +  L K
Sbjct  647  RSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)

Query  168  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAP  206
             IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H  P
Sbjct  155  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQP  193

>SDRG_01763
Length=736

 Score = 248 bits (633),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 155/474 (33%), Positives = 255/474 (54%), Gaps = 38/474 (8%)

Query  222  PDERAALTRQTSTKTSQATRD--RLAASRTNIHKTPPPAARASVRL----TQLAPVADNA  275
            P   + + R+++  +S+ +R+  +L+   + + +     +R S +L    +   P+ D A
Sbjct  267  PKRESTVFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQA  326

Query  276  LSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAV  335
            L+ P     +N+  P +++       A  + P TRTWA+ +  +W           +L V
Sbjct  327  LTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNV  381

Query  336  VGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQ  395
            VG  G GKST    +   +   ++A+H  ++D +   +P  +L+S+ HQ+   LP ++ Q
Sbjct  382  VGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQ  439

Query  396  LARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLEL  455
            L RLNL Y+++E DP +LA K+L++PL ++  P+ +  I++D +D+  V + G N L+ L
Sbjct  440  LVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGAN-LISL  497

Query  456  FAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSD  515
             A V  + PSWV FL+SS+    + K LP   VL F  ++  F AD +  V  +      
Sbjct  498  LADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGL  557

Query  516  DDAAEAKKVLKKKSGGNFAYLEFTKQALS--HPGIAAASKEGAVPLEVLHELPETLYDIY  573
            DD      +LK KS G+F YL+F  QA S  H  I A          ++ ELP+TL++IY
Sbjct  558  DD-KNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG---------MILELPKTLHEIY  607

Query  574  AEIFEDKFGQGRARVWGKAKPLLQLVVGAA-------AGPYSPVTEEQAKEHFNLTTEDL  626
             ++FE+K+G+GR RVW K + +L+ +VGAA       A P+  VTE   +  F L   DL
Sbjct  608  DQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDL  665

Query  627  RMLRRSFVDLVSVKH--GSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRK  678
             ++ RSF D+V+V    G YR++S  L  +L D ARS+E  + +V+  +  L K
Sbjct  666  ALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)

Query  168  AIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH  203
             IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H
Sbjct  168  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203

>SDRG_04575
Length=1003

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 109/228 (48%), Gaps = 12/228 (5%)

Query  259  ARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVE  318
            A+   RL Q+A      L       ++  +F      ++++ + +G     R W L +++
Sbjct  399  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  319  EWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAH-CCQFDRKSKSSPRNV  377
            +W        +D +  + G+ GTGKS     + Q  R  + A H  C+ D +++S  R  
Sbjct  457  QWKQT-----HDQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  378  LLSMVHQLVDSLPSFKNQLARLN-LKYVLEEADPFLLAGKVLVDPLNAVEEPMHATF-IL  435
            +LS+ +QL   LP + + L + + L+ V+  +    L   +LV PL+A+ EP      IL
Sbjct  510  ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  436  VDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRL  483
            +DG+D         N L+     ++ +LPSWV  +++S+    + ++L
Sbjct  570  LDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>PYVX_21513
Length=1446

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 78/380 (21%), Positives = 153/380 (40%), Gaps = 64/380 (17%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRK  369
            R W   RV++W++   +  +  +  + G+ G+GK++    + Q F   + A H    +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  370  SKSSPRNVLLSMVHQLVDSLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNAVEEP  428
                 R  +LS+ +QL   LP +   L +R  L+ ++  +    L   +LV+PLN ++ P
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRP  556

Query  429  MHATFILVDGIDQCAVGSNGR---------------NELLELFAQVIPQLPSWVGFLVSS  473
                 +L+DG++    G+                    L+ +   ++ +LPSWV  ++ S
Sbjct  557  AKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLS  616

Query  474  KPSSKLAKRLPV---SSVLD-FSAKN--------GAFVADASSLVDDIARNFSDDDAAEA  521
            +    +  RL     S V+D F+ +N        G+ +A   SL D +       +AA A
Sbjct  617  REDHDVMTRLQTYIPSVVIDHFAQENECDIKKFVGSALAPKKSLADIV-------EAATA  669

Query  522  KKVLKKKSGGNFAYLEFTKQALSHPG----------------------IAAASKEGAVPL  559
            +   + +      ++ F +   + PG                      I    +EG V L
Sbjct  670  ETSGRSRLTTLARHVSFIRSPRNRPGATTEQIEMIARRAEGLFLYAANIVQGIEEGRVAL  729

Query  560  EVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHF  619
              L +LP  +     + F+  F     +     +P L+++  A    Y P+T +   +  
Sbjct  730  NELDKLPTGMGGCLRQFFDSHFDDNTYKT--TIRPALEVLCAA----YEPLTMDALAKVL  783

Query  620  NLTTEDLRMLRRSFVDLVSV  639
                 + R +  +F  L+++
Sbjct  784  EWDIYEQREVVATFGSLLTL  803

>SPRG_12621
Length=1003

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 89/177 (50%), Gaps = 10/177 (6%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAH-CCQFDR  368
            R W L ++++W        +D +  V G+ GTGKS     + Q  R  + A H  C+ D 
Sbjct  461  REWVLDQLDQWKQT-----HDQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDE  514

Query  369  KSKSSPRNVLLSMVHQLVDSLPSFKNQLARLN-LKYVLEEADPFLLAGKVLVDPLNAVEE  427
            +++S  R  +LS+ +QL   LP + + L + + L+ V+  +    L   +LV PL A+ E
Sbjct  515  QTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAE  573

Query  428  PMHATF-ILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRL  483
            P      IL+DG+D         N L+     ++ +LPSWV  +++S+    + ++L
Sbjct  574  PATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKL  630

>PYAP_22230
Length=1116

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 97/427 (23%), Positives = 156/427 (37%), Gaps = 103/427 (24%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRK  369
            R W L  + +W++     G+     V G+ G+GK++    + Q     + A H    D  
Sbjct  496  RAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSVAARMVQ-LMPEIAAFHFALQDDD  553

Query  370  SKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPF----LLAGKVLVDPLNAV  425
                 R  +LS+ +QL   LP +      L     LEE  P      L   +LV+PLNA+
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  610

Query  426  EEPM--HATFILVDGIDQ---------------------------------CAVGSNGRN  450
              P       +L+DG++                                  C   S   +
Sbjct  611  ARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGSSD  670

Query  451  E-LLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPV---SSVLDFSAKNG-----AFV--  499
            E L+ L   +I +LP WV  ++ S+    +  +L V   S  LD   +        FV  
Sbjct  671  ECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENEADIREFVEM  730

Query  500  ----------------------------ADASSLVDDIARNFSDDDAAEAKKVLKKKSGG  531
                                          A S+ D+  R  S    AE  +V+ K+S G
Sbjct  731  ALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKIS----AEQVEVITKRSEG  786

Query  532  NFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGK  591
             F Y     QA+         +EG + ++ L  LP  L     + FE  F     +   K
Sbjct  787  LFLYAANIVQAI---------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYKT--K  835

Query  592  AKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSY-RIESSA  650
             +P+L+++  A    Y P+T       F+ +T + + +  SF  L+ V    Y R   S+
Sbjct  836  IRPVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSS  891

Query  651  LCAWLSD  657
            +  W+ D
Sbjct  892  VLEWVQD  898

>H257_11773
Length=1026

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 80/353 (23%), Positives = 146/353 (41%), Gaps = 29/353 (8%)

Query  259  ARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVE  318
             + +VRL QL       L       ++  +F      +E++   +G     R W + ++ 
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  319  EWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVL  378
            EW        +     + G+ GTGK+    +V Q  +  + A H    + +   + R  +
Sbjct  479  EW-----KASSSQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  379  LSMVHQLVDSLPSFKNQLARLN--LKYVLEEADPFLLAGKVLVDPLNAVEEPMHATF-IL  435
            LS+ +QL   LP +   L + +  L+ ++  +    L   +LV PLNA+ +P      IL
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  436  VDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSK--PS--SKLAKRLPVSSV--L  489
            +DG+D     +   N  +   A  +  LP WV ++++S+  PS   KL   +P  ++   
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  490  DFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIA  549
                ++        +LV  +A N   D  A   + + ++S G F Y      ALS     
Sbjct  653  GHQTRDDMLKYLQLALVQFVA-NADKDVPAATLRFIVERSEGLFLYASHIVNALS-----  706

Query  550  AASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGA  602
                +  + L+ L   P  +     + FED+F           +PLL+++  A
Sbjct  707  ----QKRLTLDKLESFPVGMGGYLRQYFEDQFTALHYET--SVRPLLEVLCAA  753

>H310_08292
Length=1007

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 81/353 (23%), Positives = 141/353 (40%), Gaps = 31/353 (9%)

Query  260  RASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEE  319
            + +VR+ QL       L       ++  +F      +E+A   +G     R W + ++ +
Sbjct  407  KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQ  464

Query  320  WLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLL  379
            W              V G+ GTGK+     + Q  +  + A H    D +   +PR  +L
Sbjct  465  W-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCIL  518

Query  380  SMVHQLVDSLPSFKNQLARLN-LKYVLEEADPFLLAGKVLVDPLNAVEEPMHATF-ILVD  437
            S+ +QL   LP++   L +   L+ ++  +    L   +LV PLNA+ +P      IL+D
Sbjct  519  SLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLD  578

Query  438  GIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLP--VSSV-LDFSAK  494
            G+D     +   N  +     ++ +LPSWV  + +S+    + ++L   V  V LD    
Sbjct  579  GLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCVD  638

Query  495  NGAFVADASSLVDDIARNFSDDDAA-----EAKKVLKKKSGGNFAYLEFTKQALSHPGIA  549
              +  AD    +      F   D       E    +  +S G F Y        SH  I 
Sbjct  639  QSS--ADMLKYLQAALVPFVRPDEGAVVPLETLHAIVARSEGLFLY-------ASH--IV  687

Query  550  AASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGA  602
             A  +  + L+ L   P  +     + FED+F           +PLL+++  A
Sbjct  688  HALHQKRLTLDKLESFPVGMGGYLRQFFEDQFSAHHYET--SIRPLLEVLCAA  738

>PYAR_14788
Length=795

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 139/366 (38%), Gaps = 62/366 (17%)

Query  335  VVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKN  394
            V G+ G GK++    + Q     + A H    +       R  +LS+ +QL   LP++  
Sbjct  421  VTGQIGAGKTSVAAKMVQTIP-EIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  395  QLARLNLKYVLEEADPFL----LAGKVLVDPLNAVEEPM--HATFILVDGIDQCAVGSNG  448
                L     LEE  P      L   +L+ PLNA+  P       +L+DG++  A  + G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  449  RNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLP-VSSVLDFSAKNGAFVADASSLVD  507
                + L   +I +LPSWV  ++ S+    +  +L   S  +    +      D    V+
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQENEEDIRGFVE  596

Query  508  ------------------------DIARNFSDDDAA-----------EAKKVLKKKSGGN  532
                                     I  +F++   A           E  +++ K+S G 
Sbjct  597  AALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITKRSEGL  656

Query  533  FAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKA  592
            F Y     Q++         +EG + ++ L  LP  L     + FE  F     +   K 
Sbjct  657  FLYAVNIVQSI---------EEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYKT--KI  705

Query  593  KPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSY-RIESSAL  651
            +P+L+++  A    Y P+T       F+ +T D   +  SF  L  +    Y R   S++
Sbjct  706  RPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFHSSV  761

Query  652  CAWLSD  657
              W+ D
Sbjct  762  LEWVQD  767

>PYIR_14107
Length=1176

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 84/414 (20%), Positives = 166/414 (40%), Gaps = 77/414 (19%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRK  369
            R W   ++E W+ +        +  V G+ G+GK+     + Q     + A H    + +
Sbjct  550  REWLFMQLENWIASP---TATQVFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  605

Query  370  SKSSPRNVLLSMVHQLVDSLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNAVEEP  428
               + R  +LS+ +QL   LP +   L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  429  MHAT--FILVDGIDQCAVGSN--------------------------------GRNELLE  454
                   +L+DG++  + G N                                G   L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  455  LFAQVIPQLPSWVGFLVSSKPSSKLAKRL---PVSSVLDF-----------SAKNGAFVA  500
                ++ +LP+WV  ++ S+    +  +L     S VLD              +N    +
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLDSLKSESQQDIKRYVENMLGES  785

Query  501  DASSLVDDI--------ARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAAS  552
             A++L   I        A  FS+  + E   ++ K+S G F Y     Q++         
Sbjct  786  PATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI---------  836

Query  553  KEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTE  612
            +E  + ++ L  LP  +   + + F+  F + + +     +P+L+++  +    + P + 
Sbjct  837  EEKRLAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLEVLCAS----FEPFSL  890

Query  613  EQAKEHFNLTTEDLRMLRRSFVDLVSV-KHGSYRIESSALCAWLSDPARSEEQF  665
                   N    D + +  SF  L+S+   G+ R   S++C W+ DPA + + F
Sbjct  891  WNIVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>PHYSO_470533
Length=1084

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 76/350 (22%), Positives = 139/350 (40%), Gaps = 64/350 (18%)

Query  310  RTWALTRVEEWLDARY---------NLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLA  360
            R W   R ++W+              L N  +  +VG+ G+GK++    + Q     + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTC-PEIAA  530

Query  361  AHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLV  419
             H  + + +   + R  +LS+ +QL   LP + + L +   L+ ++  A    L  ++L+
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLI  590

Query  420  DPLNAVEEP--MHATFILVDGID--------------QCAVGSNGRNELLELFAQVIPQL  463
             PLNA+  P    +  +L+DGI+                + GS     L+ +   +  +L
Sbjct  591  GPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRL  650

Query  464  PSWVGFLVSSKPS----SKLAKRLPVSSVLD-FSAKNGAFV------------------A  500
            P WV  +V S+      SKL    P   ++D F  +N   +                  A
Sbjct  651  PDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFA  710

Query  501  DASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLE  560
             AS    D+  N  +    +  +++ ++S G F Y     QA++         EG + L 
Sbjct  711  KASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT---------EGRLRLH  761

Query  561  VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPV  610
             L ELP  +     + F   F         + +P+L+++  A    Y P+
Sbjct  762  ELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLCAA----YEPL  806

>SPRG_19030
Length=1000

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 71/169 (42%), Gaps = 17/169 (10%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRK  369
            R W L + + W+          +  V G  G+GKS     + Q  R  + A H    +  
Sbjct  450  REWVLAKYDAWVQTP---NGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEED  505

Query  370  SKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAV  425
               S R  +LS+V+QL   LP + N    LN +  LEE  P      L   +L+ PL+A+
Sbjct  506  QTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSAI  562

Query  426  EEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSK  474
              P     +L+DGI+    G       +      +   PSWV F+  ++
Sbjct  563  AHPASILVLLIDGIECFEPG------FVATLTAHMDLWPSWVRFVFGTR  605

>SDRG_07983
Length=991

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 71/169 (42%), Gaps = 17/169 (10%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRK  369
            R W L + + W+          +  + G  G+GKS     + Q  R  + A H    +  
Sbjct  442  REWVLAKYDAWVQTP---NGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEED  497

Query  370  SKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFL----LAGKVLVDPLNAV  425
               S R  +LS+V+QL   LP + N    +N +  LEE  P      L   +L+ PL+A+
Sbjct  498  QTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSAI  554

Query  426  EEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSK  474
              P     +L+DGID    G       +      +   PSWV F+  ++
Sbjct  555  AHPASILVLLIDGIDCFEPG------FVATLTAHMDLWPSWVRFVFGTR  597

>H257_01934
Length=1022

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 99/444 (22%), Positives = 179/444 (40%), Gaps = 56/444 (13%)

Query  249  TNIHKTPPPA--ARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDS---TSELAAHAR  303
            ++ H TP     AR S R  QL    +  +      QQ   +F L+      S+++   +
Sbjct  400  SSFHTTPWTLHDARYSTRREQLIAALNGRVGLDQEGQQ-ARLFSLLSPFSFQSQISTATQ  458

Query  304  GLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHC  363
            G     R W L   +EW+ +  +      L + G  G+GK+     + Q  R  ++A H 
Sbjct  459  GYC--GRAWVLHEFDEWVTSPPSNARRVFL-LTGVIGSGKTALAAHIIQN-RPEVVAFHL  514

Query  364  CQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEE-------ADPFLLAGK  416
               + +   + R  +L++V+QL   LP++ N L   + K  LEE       AD   L  +
Sbjct  515  ASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLAD---LVQE  569

Query  417  VLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPS  476
            +L+ PL  +  P     IL+DGI +C   ++  + L+ +    + + P+W+ F+ +S+  
Sbjct  570  LLIAPLERIATPPSTMVILIDGI-ECFPCAD--DNLVAILTASLNRWPAWMRFVFTSRED  626

Query  477  SKLAKRL------PVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKV---LKK  527
             ++   L      P++  LD +        D    +D    +  D        V   L  
Sbjct  627  PRVLSLLQAYMLPPIA--LDLACAQSK--RDVRQYLDTALGSHFDISPPMPPHVIDLLVD  682

Query  528  KSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFG-QGRA  586
            ++ G F Y      ++S          G   L+ L  +P T+     + F  +F    + 
Sbjct  683  RTQGLFLYARHLVDSIS---------SGQWNLDNLDNVPTTMGGFLHQNFATQFPVVDKY  733

Query  587  RVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRI  646
            +V    +P+L++V  A    + P+T +      +      + L+  F  L     G   +
Sbjct  734  KV--DVRPVLEVVCAA----HEPLTLDALSAIMHFDVYQAQKLQSDFGSLFHAGEGGVIL  787

Query  647  ESS-ALCAWLSDPARSEEQFYFSV  669
                +L  WL DP RS   ++  V
Sbjct  788  PFHLSLLDWLQDP-RSAGDYFVDV  810

>PITG_17250
Length=1046

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 74/342 (22%), Positives = 140/342 (41%), Gaps = 56/342 (16%)

Query  310  RTWALTRVEEWLD----ARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQ  365
            R W     + W+     +   L N  +  V+G+ G+GKS+    + Q     + A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQAC-PEIAAFHFAT  508

Query  366  FDRKSKSSPRNVLLSMVHQLVDSLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNA  424
             + +   + R  +LS+ +QL   LP + + L +   L+ ++  A    L   +L+ PLNA
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  425  VEEP--MHATFILVDGID-----QCAVGSNG-----RNE--LLELFAQVIPQLPSWVGFL  470
            +  P    +  +L+DG++      C   + G     ++E  L+ +   ++ +LP WV  +
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  471  VSSKPSSKLAKRL-----PVSSVLDFSAKNGA----FVADASSLVDDIARNF--------  513
            + S+    +  +L     P   +  F  +N      F++ + S ++    +F        
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIG  688

Query  514  SDDDAAE-----AKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPET  568
            S  D  E       +++ ++S G F Y     QA+S         EG + L  L ELP  
Sbjct  689  SGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS---------EGRLRLHELAELPVG  739

Query  569  LYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPV  610
            +     + F   F         + +P+L++   A    Y P+
Sbjct  740  MGAYLHQFFASHFADHDVYK-HRIRPVLEVCCAA----YEPL  776

>PPTG_11365
Length=1106

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 73/350 (21%), Positives = 135/350 (39%), Gaps = 65/350 (19%)

Query  310  RTWALTRVEEWLDARY------NLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHC  363
            R W   + + W+           L N  +  VVG+ G+GK++    + Q     + A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSC-PEIAAFHL  561

Query  364  CQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPL  422
               + +   + R  +LS+ +QL   LP + + L +   L+ ++  A    L   +L+ PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  423  NAVEEP--MHATFILVDGIDQC------------AVGSNGRNELLELFAQVIP----QLP  464
             A+  P    +  +L+DG++              + GS   N+  E F  ++P    +LP
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  465  SWVGFLVSSKPSSKLAKRL-----PVSSVLDFSAKNG-------------------AFVA  500
             WV  ++ S+    +  +L     P  ++  F  +N                     F  
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEK  741

Query  501  DASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLE  560
             A+ +  D   N  +    +  +++ ++S G F Y     QA+S         EG + L 
Sbjct  742  AAAQIGTDSGNN-HEFGMEQVVELIARRSEGLFLYAVNVVQAIS---------EGRLHLH  791

Query  561  VLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPV  610
             L ELP  +     + F   F         + +P+L++   A    Y P+
Sbjct  792  ELAELPVGMGAYLQQFFASHFAD-HDMYKHRVRPVLEVCCAA----YEPL  836

>PYU1_G002110
Length=999

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 87/409 (21%), Positives = 162/409 (40%), Gaps = 59/409 (14%)

Query  290  PLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGT  349
            P     S+LA+   G     R W + ++ +W+D+        +  V G+ G+GK+     
Sbjct  417  PFQQQISKLASRFVG-----RKWLIAQLTKWIDSP---TASQMFWVTGQIGSGKTALAAR  468

Query  350  VAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEAD  409
            + Q     + A H    + +   + R  +LS+ +QL   L   K+  A L  +  LEE  
Sbjct  469  LVQTI-PEIKAFHFAFEEDEQTQNARRCVLSLAYQLTTQL---KDYAAFLQAREPLEELV  524

Query  410  PFL----LAGKVLVDPLNAVEEPMHAT---FILVDGIDQCAVGSNGRNELLEL-----FA  457
            P      L   +L+ PLN + +         +L+DG++  + G +  + L  +     FA
Sbjct  525  PVSTFNELVTHLLIKPLNEIAQLQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFA  584

Query  458  Q--------VIPQLPSWVGFLVSSKP----SSKLAKRLPVSSVLDFSAKNGAFVAD--AS  503
            Q        ++ QLP WV  +V S+     ++KL    P   +  +  +N   +      
Sbjct  585  QCLVSALPSLVSQLPKWVRVIVLSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEK  644

Query  504  SLVDDIARNFSDDDAAEAKKV--LKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEV  561
            SL    +   S        ++  + ++S G F Y     Q+L     A            
Sbjct  645  SLCSSASTGLSSGKTLPPDQIDLIVERSEGLFLYAANVVQSLEEKWFAVG----------  694

Query  562  LHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNL  621
               LP  +     + F   FG  + +     +P+L+++  A    + P++         L
Sbjct  695  -QSLPIGMNGYLYDFFVSHFGAKQYK--RLIRPVLEVLCAA----FEPLSLPTIASILKL  747

Query  622  TTEDLRMLRRSFVDLVSV-KHGSYRIESSALCAWLSDPARSEEQFYFSV  669
             T + + +  +F  L+S+   GS R   S++  W+ +  +S + FY  V
Sbjct  748  QTNEQQEIATAFGSLLSIGADGSVRPFHSSVLNWVQE-LQSVDPFYVDV  795

>PYIW_15717
Length=1121

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%), Gaps = 8/144 (6%)

Query  310  RTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRK  369
            R W   ++E W+ +        +  V G+ G+GK+     + Q     + A H    + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLIP-EIAAFHFALQEDE  580

Query  370  SKSSPRNVLLSMVHQLVDSLPSFKNQL-ARLNLKYVLEEADPFLLAGKVLVDPLNAVEEP  428
               + R  +LS+ +QL   LP + + L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARP  640

Query  429  MHAT---FILVDGIDQCAVGSNGR  449
              AT    +L+DG++      N +
Sbjct  641  QTATKPLVLLIDGLEHLVSDKNAQ  664

>PHYSO_545378
Length=224

 Score = 36.2 bits (82),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query  313  ALTRVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +  +++EWL D ++++G+D +LAVVG      STF  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQF  141

>PHYSO_300272
Length=636

 Score = 36.2 bits (82),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 64/157 (41%), Gaps = 28/157 (18%)

Query  247  SRTNIHKTPPPAARASVRLTQ---LAPVADNALSTPLNPQQINEMFPLIDSTSELAAHAR  303
            S   I   PPP    +V+L      +P      ++ L P     + PL+    E   H  
Sbjct  92   SEAKIGVAPPPVIW-TVQLVHKGTRSPFNKIGPASILAPPGYKTVGPLLAKVHEQCHH--  148

Query  304  GLTPGTRTWALTRVEEWLDARYN-LGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAH  362
                       T V++W + ++N + N+ L  +VG  GTGKS  C  +A  +  N     
Sbjct  149  -----------TFVDQWNEMKWNSVDNEALQWIVGPPGTGKS--CTALAFAYALNASVWD  195

Query  363  CCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARL  399
                D +        L +++ QLVDSL S ++ L  L
Sbjct  196  VLWMDFR--------LQTLLQQLVDSLSSTRSTLVFL  224

>PYIW_19868
Length=270

 Score = 35.4 bits (80),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 36/122 (30%)

Query  326  NLGNDTLLAVVGEGGTGKSTFCGTVAQQFRG------------NLLAAHCCQFD------  367
            +  N  ++ ++GE GTGK+TF   +A   +             +LL A   ++D      
Sbjct  22   DFTNSEIICMLGENGTGKTTFIRMLAGLLKSDEMEMAEATGDQDLLDACALRYDSSTISY  81

Query  368  RKSKSSP-----------RNVLLSMVHQLVDSLPSFKNQLAR-LNLKYVLEEADPFLLAG  415
            +  K +P           R +  S+VH      P F   + R LNL  ++++A PFL  G
Sbjct  82   KPQKIAPKFQGTVRELLHRRIRESIVH------PQFATDVTRPLNLDNIIDQAVPFLSGG  135

Query  416  KV  417
            ++
Sbjct  136  EL  137

>PITG_06580
Length=1214

 Score = 35.8 bits (81),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 45/108 (42%), Gaps = 10/108 (9%)

Query  326  NLGNDTLLAVVGEGGTGKSTFCGTVAQQFR----------GNLLAAHCCQFDRKSKSSPR  375
            +L +D  L +V    T  S+   +V Q             GNLL+A     D   K+ P 
Sbjct  441  DLLDDISLKIVNSSRTMSSSKFASVQQALERLMAKYTTLYGNLLSADVHSADDVGKTMPL  500

Query  376  NVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLN  423
            NV +   H  V SL  F+++  R N        +   LA + L+ P+N
Sbjct  501  NVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFIKLACRSLLQPVN  548

>PITG_15223
Length=920

 Score = 35.4 bits (80),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 54/254 (21%), Positives = 99/254 (39%), Gaps = 37/254 (15%)

Query  241  RDRLA-ASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELA  299
            RDRL   ++ + HK     +RA    +    V D   + PL  Q ++ + PLI     L 
Sbjct  534  RDRLPRTTKHHFHKPTSIQSRAISLSSSFFSVGDTMCAAPLMQQALDHLTPLILREQRLV  593

Query  300  AH----ARGLTPGTR------TWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGT  349
            A     A   T G +      T+ +  V E L  R N   D         GT  +    +
Sbjct  594  ASLFFPATPSTTGGKHEPEDLTFMMENVFEKLLKRMNEFGDA-------AGTRNTLDALS  646

Query  350  VAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEAD  409
            +     G L A       R+  +   NV++           SF+ Q+ R+ +K+  E+ +
Sbjct  647  LVVLVNGKLEAC------RQQSAFLYNVMV-----------SFQLQMKRMLIKFT-EDQE  688

Query  410  PFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGF  469
             +++A  V    +  V  P      L+  +++   G +  + L+ ++  ++P    W+  
Sbjct  689  AWIIAQSVDTK-MAGVLGPTKKIVNLIARMEESVAGKSSDSTLVSIYNMIVPATMHWIDK  747

Query  470  LVSSKPSSKLAKRL  483
            +  ++P      RL
Sbjct  748  VADTRPKYAPLTRL  761

>PYIR_23360
Length=227

 Score = 34.7 bits (78),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (56%), Gaps = 2/72 (3%)

Query  316  RVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSP  374
            +V+EWL D R+++G+D +LA+VG      S+F    AQQF    + A   +   K+    
Sbjct  109  KVKEWLQDLRHHVGDDIVLAIVGNKCDVASSFNFAKAQQF-AQEIGALVFRTSAKTGDGV  167

Query  375  RNVLLSMVHQLV  386
            +N+  S+  QL+
Sbjct  168  QNLFESVAVQLL  179

>PYAR_17584
Length=1040

 Score = 35.4 bits (80),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query  385  LVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDP-LNAVEEPMHATFILVDGIDQCA  443
            L ++L SF+ Q+ RL +K+  + A    +      D  +  V  P+  T  +V  +D+C 
Sbjct  752  LYNTLVSFQLQMKRLLIKFTDDHAS--WIQNHTHTDTRMAGVLSPISKTLTMVARLDECV  809

Query  444  VGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADAS  503
                    L  LF +++P    W+  +  +KP      RL   + L       A +A +S
Sbjct  810  GSKTDDATLALLFHRMVPATLQWLDKISETKPKYTALTRL--ENYLFIYDTLSAIIAPSS  867

Query  504  SL  505
            SL
Sbjct  868  SL  869

>PPTG_08369
Length=598

 Score = 35.0 bits (79),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (45%), Gaps = 18/136 (13%)

Query  321  LDARYNLGNDTLLAVVGEGGTGKSTFCGTV-----AQQFRGNLLAAHCCQFDRKSKSSPR  375
            L  +Y L  D +   VG  G+GK+ F   +      QQ RG L A+  C+    S  + R
Sbjct  94   LPPKYELQPDDVHCFVGLNGSGKTQFLARLQDHVKGQQARGELPAS--CRLSSLSLDAHR  151

Query  376  NVLLSMVHQLVDSL------PSFKNQLARLNLKYVLEEADPFLLAGKV--LVDPLNAVEE  427
              +    H++V  +      P+ ++ + RL L  V E+    L  G++  L+  +  +E 
Sbjct  152  EFVAENGHRVVADVLGGIGSPTARDLIVRLGLFPVWEQRVRHLSTGEMRKLLLAVALLET  211

Query  428  PMHATFIL---VDGID  440
            P  +  IL    DG+D
Sbjct  212  PRASVLILDQPFDGLD  227

>PYU1_G013031
Length=401

 Score = 34.7 bits (78),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (44%), Gaps = 23/89 (26%)

Query  384  QLVDSLPSF------KNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVD  437
            +LVD  PSF      +N L  L   Y L+E   + L+G +  D                 
Sbjct  79   KLVDGFPSFSQLAVAENDLNMLTFLYHLQEDPYYALSGMIAFD----------------Q  122

Query  438  GIDQCAVGSNGRNELLELFAQVIPQLPSW  466
             + +CAV + GR ELL   +++IP   +W
Sbjct  123  DLFRCAV-AFGRLELLIYLSELIPDYATW  150

>PPTG_13827
Length=1212

 Score = 35.0 bits (79),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  356  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAG  415
            GNLL+A     D   K+ P NV +   H  V SL  F+++  R N        +   LA 
Sbjct  481  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  540

Query  416  KVLVDPLN  423
            + L+ P+N
Sbjct  541  RSLLQPVN  548

>PPTG_13828
Length=958

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  356  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAG  415
            GNLL+A     D   K+ P NV +   H  V SL  F+++  R N        +   LA 
Sbjct  227  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVVSLLEFEDKFNRKNFSARYRVKNFLKLAC  286

Query  416  KVLVDPLN  423
            + L+ P+N
Sbjct  287  RSLLQPVN  294

>PHYCA_133652
Length=200

 Score = 33.5 bits (75),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 0/50 (0%)

Query  36   DPVRFDRSTTLADTVNVTDDVEEMFYGRSTSNTSSDMPQYRTTEQLRGNN  85
            + V++ RS TL D + V  D +     R  S+ + D P+YR+ +  R  N
Sbjct  102  EEVQYRRSATLTDAITVALDYDRSHAHRGRSDNARDKPRYRSYDSKRSKN  151

>HYAP_12253
Length=1210

 Score = 34.7 bits (78),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query  244   LAASRTNIHKTPPPAARASVRLTQLAPVADNA-LSTPLNPQQINEMFPLIDSTSELAAHA  302
             L AS  +   +PPP A  S      +   D A +   L P   + M P + S  EL+A+A
Sbjct  970   LDASSISKFTSPPPVAPRSRSFNFCSSSGDGAAVGRGLTPHFRSSMTPFVVSAEELSANA  1029

Query  303   RGLTPGTRTWALT  315
                TPGT   A T
Sbjct  1030  MWTTPGTENAAET  1042

>PITG_15525
Length=224

 Score = 33.5 bits (75),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  313  ALTRVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +  +++EWL D ++++G+D +LAVVG      S F    AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQF  141

>PHYCA_571841
Length=241

 Score = 33.5 bits (75),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 42/75 (56%), Gaps = 2/75 (3%)

Query  313  ALTRVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSK  371
            +  +++EWL D ++++G+D +LAVVG      S F  + AQQF  + + A   +   KS 
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFSKAQQF-ADEIGALVFRTSAKSG  157

Query  372  SSPRNVLLSMVHQLV  386
               +++  S+  QL+
Sbjct  158  EGVQSLFESLAVQLL  172

>PYU1_G012267
Length=217

 Score = 33.5 bits (75),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 1/40 (3%)

Query  316  RVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +++EWL D R+++ +D +LAVVG      S+F    AQQF
Sbjct  104  KIKEWLQDLRHHVADDIVLAVVGNKCDVASSFNFAKAQQF  143

>PPTG_07025
Length=224

 Score = 33.5 bits (75),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  313  ALTRVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +  +++EWL D ++++G+D +LAVVG      S F    AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQF  141

>PYAP_24374
Length=1073

 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 23/112 (21%), Positives = 52/112 (46%), Gaps = 5/112 (4%)

Query  376  NVLLSMVHQ----LVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHA  431
            N LL M  Q    L +++ SF+ Q+ R+ +K+  E+ + ++ +       +  V  P+  
Sbjct  781  NPLLPMYQQQSSFLYNAILSFQLQMKRMLIKFT-EDQETWIHSHNHTDTRMAGVLSPIQK  839

Query  432  TFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRL  483
            T +++  +++   G      L  ++ +++P    W+  +  +KP      RL
Sbjct  840  TIVMIGRLEESVCGKTNDETLAIIYNRMMPTTMLWLDKISENKPKYTALTRL  891

>PHALS_00054
Length=224

 Score = 33.1 bits (74),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query  313  ALTRVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +  +++EWL D ++++G+D +LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFSKAQQF  141

>PHYRA_82858
Length=224

 Score = 33.1 bits (74),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 1/43 (2%)

Query  313  ALTRVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +  +++EWL D ++++G+D +LAVVG      S F    AQQF
Sbjct  99   SFDKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSDFDFAKAQQF  141

>H257_05790
Length=937

 Score = 33.5 bits (75),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 36/74 (49%), Gaps = 2/74 (3%)

Query  435  LVDGIDQCAVGSNGRNELLELFA-QVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSA  493
            LVDG+ QCA+  NG   L+  FA  +I  + ++V  L+  K + K AK +      D  A
Sbjct  59   LVDGLGQCALSGNGWTVLIVAFALNLIVPVIAFVTHLLHRKQAEK-AKAVLAKEAADLEA  117

Query  494  KNGAFVADASSLVD  507
              GA     S  +D
Sbjct  118  SEGAGAKYKSYFID  131

>PYVX_21776
Length=203

 Score = 32.7 bits (73),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  316  RVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            +++EWL D + ++G D +LAVVG      S+F    AQQF
Sbjct  106  KIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQF  145

>PHYRA_82242
Length=588

 Score = 33.5 bits (75),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (45%), Gaps = 18/136 (13%)

Query  321  LDARYNLGNDTLLAVVGEGGTGKSTFCGTV-----AQQFRGNLLAAHCCQFDRKSKSSPR  375
            L  +Y L  D +   VG  G+GK+ F   +      QQ +G L A+  C+    S  + R
Sbjct  85   LPPKYQLLPDDVHCFVGLNGSGKTQFLAKLQDHVKVQQAKGELPAS--CRLASLSLDAHR  142

Query  376  NVLLSMVHQLVDSL------PSFKNQLARLNLKYVLEEADPFLLAGKV--LVDPLNAVEE  427
              +    H++V  +      P+ ++ + RL L  V E+    L  G++  L+  +  +E 
Sbjct  143  EFVAKNGHRVVADVLGGIGSPTARDLIVRLGLFPVWEQRVKHLSTGEMRKLLLAVALLET  202

Query  428  PMHATFIL---VDGID  440
            P  +  IL    DG+D
Sbjct  203  PKASVLILDQPFDGLD  218

>PHYCA_104505
Length=194

 Score = 32.7 bits (73),  Expect = 5.9, Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 12/110 (11%)

Query  478  KLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVL---KKKSGGNFA  534
            +LA+R  + ++ +   K GA    +S  + +  +NF  + AAE  +++   K K+G N+A
Sbjct  88   RLAERRNLEAIRNGDWKTGA---ASSGKLANPGKNFFLELAAECIRLVNLEKDKNGDNWA  144

Query  535  YLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  584
                 +  L  P      ++G   LE L +  + +  IY E FE+ + QG
Sbjct  145  KKSMIQCGLDVP------RDGVWNLEQLSKELQDVIAIYPEAFEEGYKQG  188

>HYAP_04925
Length=1150

 Score = 33.5 bits (75),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 0/68 (0%)

Query  356  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAG  415
            GNLL+A     D   K+ P NV +   H  V SL +F+      N        +   LAG
Sbjct  413  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLNFEGTFNGKNFSAHYRVKNFLKLAG  472

Query  416  KVLVDPLN  423
            + L+ P N
Sbjct  473  RSLLHPFN  480

>PHYRA_79519
Length=1240

 Score = 33.5 bits (75),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 0/68 (0%)

Query  356  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAG  415
            GNLL+A     D   K+ P NV +   H  V SL  F+ +  + N        +   LA 
Sbjct  501  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLEFEEKFNKKNFSARYRVKNFIKLAC  560

Query  416  KVLVDPLN  423
            + L+ P+N
Sbjct  561  RSLLQPIN  568

>PHYCA_534503
Length=1089

 Score = 33.1 bits (74),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 32/68 (47%), Gaps = 0/68 (0%)

Query  356  GNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAG  415
            GNLL+A     D   K+ P NV +   H  V SL  F+++  R N        +   LA 
Sbjct  608  GNLLSADVHTADDVGKTMPLNVFVYSFHVFVISLLEFEDKFNRKNFSARYRVKNFLKLAC  667

Query  416  KVLVDPLN  423
            + L+ P++
Sbjct  668  RSLLQPIS  675

>H310_02873
Length=629

 Score = 32.7 bits (73),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  329  NDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAA  361
            N  +L ++GE GTGK+TF   +A Q + + L A
Sbjct  385  NSEILCMLGENGTGKTTFIRMLANQLKSDELEA  417

>CCI10175
Length=222

 Score = 32.3 bits (72),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  316  RVEEWL-DARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQF  354
            ++ EWL D R+++ ND +LAVVG      S F  + AQ F
Sbjct  102  KIIEWLQDLRHHVSNDIVLAVVGNKSDCASQFDFSKAQAF  141

>H257_09993
Length=629

 Score = 32.7 bits (73),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  329  NDTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAA  361
            N  +L ++GE GTGK+TF   +A Q + + L A
Sbjct  385  NSEILCMLGENGTGKTTFIRMLANQLKSDELEA  417

Lambda      K        H        a         alpha
   0.315    0.129    0.368    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 60068934432

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40