Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_18457147571170117054840.0
PPTG_17128147571177117948490.0
PHYSO_321157147571180117245070.0
PHYRA_95901147571075117441330.0
PHALS_06477147571166118137640.0
PHYCA_344751475769272429280.0
PYIR_13453147571186122427790.0
PYIW_1879314757997103524990.0
PYAP_17746147571169117523990.0
PYU1_G0017341475780081823130.0
H310_09212147571113120218670.0
SDRG_0176414757109279316210.0
SPRG_063541475788479716120.0
H257_0630514757109981315310.0
CCA1889814757114776313361e-163
CCI4512214757110576413294e-163
PHYKE_8394147574282228506e-102
PYAR_13581147577303057468e-84
SDRG_017141398812331211010.010
H310_112724789179940910.13
PYVX_2107866641475117860.57
SPRG_21044139881132150860.59
CCI4663810613198948831.2
CCI49118161986198948831.2
PHYRA_96309343297445802.4
PHYSO_3074523432121448793.9
PYAR_23813495109723784.6
PHYSO_51769810613191157775.7
PPTG_1622114050125943776.1
CCA14389151856118796777.0
PYVX_21490799342926134777.5
PYIR_2016511179116377768.0
CCA1843410613198549768.6
CCA18292153450198549768.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18457

Length=1170
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18457                                                            2117       0.0   
PPTG_17128                                                            1872       0.0   
PHYSO_321157                                                          1740       0.0   
PHYRA_95901                                                           1596       0.0   
PHALS_06477                                                           1454       0.0   
PHYCA_34475                                                           1132       0.0   
PYIR_13453                                                            1075       0.0   
PYIW_18793                                                            967        0.0   
PYAP_17746                                                            928        0.0   
PYU1_G001734                                                          895        0.0   
H310_09212                                                            723        0.0   
SDRG_01764                                                            629        0.0   
SPRG_06354                                                            625        0.0   
H257_06305                                                            594        0.0   
CCA18898                                                              519        1e-163
CCI45122                                                              516        4e-163
PHYKE_8394                                                            332        6e-102
PYAR_13581                                                            291        8e-84 
SDRG_01714                                                            43.5       0.010 
H310_11272                                                            39.7       0.13  
PYVX_21078                                                            37.7       0.57  
SPRG_21044                                                            37.7       0.59  
CCI46638                                                              36.6       1.2   
CCI49118                                                              36.6       1.2   
PHYRA_96309                                                           35.4       2.4   
PHYSO_307452                                                          35.0       3.9   
PYAR_23813                                                            34.7       4.6   
PHYSO_517698                                                          34.3       5.7   
PPTG_16221                                                            34.3       6.1   
CCA14389                                                              34.3       7.0   
PYVX_21490                                                            34.3       7.5   
PYIR_20165                                                            33.9       8.0   
CCA18434                                                              33.9       8.6   
CCA18292                                                              33.9       8.6   

>PITG_18457
Length=1170

 Score = 2117 bits (5484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1170/1170 (100%), Positives = 1170/1170 (100%), Gaps = 0/1170 (0%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSLPEPWERHFGIHHGRLMRKKTTQHCRLLPSV  180
             KPRQMDASSIPVEFFREQFRNNSVEIRQSLPEPWERHFGIHHGRLMRKKTTQHCRLLPSV
Sbjct  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSLPEPWERHFGIHHGRLMRKKTTQHCRLLPSV  180

Query  181   NKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQRATRIY  240
             NKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQRATRIY
Sbjct  181   NKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQRATRIY  240

Query  241   NRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrrstrrssALQG  300
             NRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRSTRRSSALQG
Sbjct  241   NRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRSTRRSSALQG  300

Query  301   PNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFsdddisdeeqes  360
             PNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSDDDISDEEQES
Sbjct  301   PNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSDDDISDEEQES  360

Query  361   dendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQEL  420
             DENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQEL
Sbjct  361   DENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQEL  420

Query  421   WGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVL  480
             WGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVL
Sbjct  421   WGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVL  480

Query  481   RRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLK  540
             RRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLK
Sbjct  481   RRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLK  540

Query  541   ARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNL  600
             ARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNL
Sbjct  541   ARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNL  600

Query  601   QLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRF  660
             QLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRF
Sbjct  601   QLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRF  660

Query  661   PAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqal  720
             PAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQAL
Sbjct  661   PAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQAL  720

Query  721   pllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDV  780
             PLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDV
Sbjct  721   PLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDV  780

Query  781   GEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEI  840
             GEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEI
Sbjct  781   GEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEI  840

Query  841   FPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQ  900
             FPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQ
Sbjct  841   FPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQ  900

Query  901   NVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEK  960
             NVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEK
Sbjct  901   NVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEK  960

Query  961   SNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTANSGRKSESG  1020
             SNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTANSGRKSESG
Sbjct  961   SNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTANSGRKSESG  1020

Query  1021  SATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTL  1080
             SATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTL
Sbjct  1021  SATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTL  1080

Query  1081  GTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrsvasrs  1140
             GTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSPSRSVASRS
Sbjct  1081  GTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSPSRSVASRS  1140

Query  1141  GNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170
             GNFAQILSAIRVSTGGGKSDRLGKMRQRQR
Sbjct  1141  GNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170

>PPTG_17128
Length=1177

 Score = 1872 bits (4849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1022/1179 (87%), Positives = 1086/1179 (92%), Gaps = 11/1179 (1%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+KVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+AIVTTAEVQAFN
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             AILQQTETELR+KAELVLNGMVNSS++A+NNQ QSG  LPAVTVAA PS  HRSGY+ AN
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL---PEPWERHFGIHHGRLMRKKTTQHCRLL  177
             KPRQMDASSIP+EFFREQFRN+SVEIRQSL   PEPW+RHFG+HHGRLMRKKTTQHCRLL
Sbjct  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180

Query  178   PSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSG---TSDGSGGGVMKQ  234
             PSVNK DPS P PELREEDAKHGVLNLVTRGFLPAYADLTP F+G   TS+GS GG+MKQ
Sbjct  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240

Query  235   RATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL---RapptpppvvpeatfpDsttrrrs  291
             RATRIY+RSEQ VRSTPFTQSTGYNLASLKFDL     PP P P   +   P+STTRRRS
Sbjct  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTRRRS  300

Query  292   trrssALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFsdd  351
              R+SSA+QGPN  T S P S +K+KN RSAH TSLMSAAVAAFTNQGED +NNR RFSDD
Sbjct  301   VRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFSDD  360

Query  352   disdeeqesdendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFV  411
             D+SDE+QE+DEN KDE AEME+LGANVDKIRGYNELLD YSLHQFLIHKGRTMRDTPEF+
Sbjct  361   DVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI  420

Query  412   SFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  471
             SFRRV QELWGSVEEALRALE LL QYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV
Sbjct  421   SFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  480

Query  472   NEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWR  531
             NEDQ+MSVLRRPGQRYKGRDRKRRAATT++AC+RMWLVRRRYAR+RASD NA+KIQLAWR
Sbjct  481   NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540

Query  532   AYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGA  591
             AYSCHT+LK RLREV  EKLEKWEKRM  LKS W QIA RRRVVVHVPSLSLDEH RL A
Sbjct  541   AYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA  600

Query  592   ENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKL  651
             ENFA+QQNLQLTRVCA ALDSNV+LL+YVSPFELT+DV QYFLKLLQLGGLVDS PRVK 
Sbjct  601   ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660

Query  652   VFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpi  711
             VFPEQ+TRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLA+ALDLPI
Sbjct  661   VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPI  720

Query  712   lgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLI  771
             LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHE+CAALAKLAIAHMDQP+WLI
Sbjct  721   LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780

Query  772   KLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLAR  831
             KLDYDPL VGEAVVDLSN+QAMRELRREKRTPEYWRQPGPRDAAAK+ILAELERPGMLAR
Sbjct  781   KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR  840

Query  832   IATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPD  891
             +A PM +E+FP WR++IDAVGHFGCV+EAVPPTAIAAS EAST LVEPAYVRANLFVDPD
Sbjct  841   LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD  900

Query  892   GSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSL  951
             GSVH++STQNVLA GGGGLNRKTVAFTFPQTAAP+EAIKGACNAAGKLLVETNVWGYVSL
Sbjct  901   GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL  960

Query  952   DFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTA  1011
             DFVVFQDEKSN APRLWALAVHPFLTDSA SFACFHLLARGVLDTNSG YRVA+KSLTT 
Sbjct  961   DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTV  1020

Query  1012  NSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHG  1071
              +GR   SG  TDLLLREA LAK SL GA RCFV CSYVFHPHV TMQYTAFFHACRLHG
Sbjct  1021  -TGRNG-SGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHG  1078

Query  1072  VCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvass  1131
             VCFDVERTLGTLFLLADSLTAGVFG+LSIGET EGALAFLRTALEVIGREAGSTI++ SS
Sbjct  1079  VCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSS  1138

Query  1132  psrsvasrsGNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170
             PSR V+ RSGNFAQ+LSA+R STGGGKSDRLGKM++R+R
Sbjct  1139  PSRPVSGRSGNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177

>PHYSO_321157
Length=1180

 Score = 1740 bits (4507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1172 (81%), Positives = 1044/1172 (89%), Gaps = 14/1172 (1%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+KVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+A+VTTAEVQAFN
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             AILQQTE ELRAKAELVLNGMVNSSSSA+NNQ+QSGTLLPAVTVAA PS  HRSGY K  
Sbjct  61    AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL-PEPW--ERHFGIHHGRLMRKKTTQHCRLL  177
               + MDASSIP+EFFREQFRN+SVE+RQ+L P P   +RH GIHHGRLMRKKTTQHCRLL
Sbjct  121   VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180

Query  178   PSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVF---SGTSDGSGGGVMKQ  234
             PSVNK DPS PTPELREEDAKHGVLNLVTRGFLPAYADLTP F   SG +DGSGGGVMKQ
Sbjct  181   PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGVMKQ  240

Query  235   RATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrrstrr  294
             RATRI++RSEQ VR TPFTQSTGYNLA+LKFDLRAP TPPP  PE++ P + T RR + R
Sbjct  241   RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPPAPESSPPATATTRRRSTR  300

Query  295   ssAL-QGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFsdd--  351
               +   GP+  T S P S+   K+GRS   +SL+SAA+AAFTNQ +D E+NR+RFS+   
Sbjct  301   RGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSEQPD  360

Query  352   -disdeeqesdendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEF  410
              +ISDEEQE DEN+KDE AEME+LGANVDKIRGYNELLD YSLHQFLIHKGRTMRDTPEF
Sbjct  361   EEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEF  420

Query  411   VSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCI  470
             VSFRRV QELWGSVEEALRALETLL QYFVPLAY DGQRLL+LA TGQPRFSKRELLSCI
Sbjct  421   VSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCI  480

Query  471   VNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAW  530
             VNE+QVM+VLRRPGQRYKGRDRKRRAATTI+ACVRMW +RRRY R+RASDF+A+KIQLAW
Sbjct  481   VNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAW  540

Query  531   RAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLG  590
             RA+SCH +LKARLRE+  E+L+ WE +M++LK+ W QIAGRRRVVVHVPSLSLDEHSRL 
Sbjct  541   RAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLS  600

Query  591   AENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVK  650
             AENFA+QQNLQLTR+CAAALDSNV+LL+YV+PFELT+DVS YFLKLLQLGGL DSRPRVK
Sbjct  601   AENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVK  660

Query  651   LVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlp  710
             LVFPEQ  RFPAHFSLSS+LLYSPHCLRRIRHYT GK+AYLVMGLPG EDQRLA+ALDLP
Sbjct  661   LVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLP  720

Query  711   ilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWL  770
             ILGAPP QALPLLTRSGGKRLLIRADVNVP GTYELYDEHE+ AALAKLA+AHMDQPRWL
Sbjct  721   ILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWL  780

Query  771   IKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLA  830
             +KLDYDPL VGEAVVDLS MQAMRELRREK+TPEYWRQPGPRDAA+KL+LAELERPG+LA
Sbjct  781   LKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLA  840

Query  831   RIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDP  890
             R+ATPM TEIFP WRE+ +A+ HFGCVVEAVPPT+  AS E ++  VEPAYVRANLF+DP
Sbjct  841   RLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP  900

Query  891   DGSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVS  950
             DG+VHI+STQNVLA+ GGGLNRKTVAFTFPQT AP+EA+KGAC AAGKLLVETNVWGYVS
Sbjct  901   DGTVHITSTQNVLAS-GGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVS  959

Query  951   LDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV--ANKSL  1008
             LDFVVFQD+KS  APRLWALAVHPFLTDSA SFACFHLLARGVLD +SG YR+  AN +L
Sbjct  960   LDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTL  1019

Query  1009  TTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACR  1068
                NS  +S  G  TDLLLREA LAK +  G  RC+V CSYVFHPHV TMQYTAFFHACR
Sbjct  1020  AAVNS-GRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACR  1078

Query  1069  LHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsv  1128
             LHGVCFDVERTLGTLFLL DSLTAGVFG+LS+GETT+GALAF+RTALEVIGREAG+T+ +
Sbjct  1079  LHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEM  1138

Query  1129  asspsrsvasrsGNFAQILSAIRVSTGGGKSD  1160
             A+SPSR  ++RSGNFAQ+LSA+R STGGGK D
Sbjct  1139  ATSPSRPGSARSGNFAQVLSAVRASTGGGKGD  1170

>PHYRA_95901
Length=1075

 Score = 1596 bits (4133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 868/1174 (74%), Positives = 962/1174 (82%), Gaps = 103/1174 (9%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+KVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+A+VTTAEVQAFN
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             AILQQTE ELRAKAELVL GMVNSSSSA+ NQ+QSGTLLP VTVAA PS  HRSGY    
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYG---  117

Query  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL---PEPWERHFGIHHGRLMRKKTTQHCRLL  177
                  DASSIP+EFFREQF N+SVE+RQSL   P+ W+RH GI HGRL+RKKTTQHCRLL
Sbjct  118   -----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLL  172

Query  178   PSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQRAT  237
             PSVNK DP+ PTPELREEDAKHGVLNLVTR             SGT DGSG  VMKQRAT
Sbjct  173   PSVNKVDPTAPTPELREEDAKHGVLNLVTRS------------SGTKDGSG--VMKQRAT  218

Query  238   RIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrrstrrssA  297
             RIY+RSEQ  R+T                                               
Sbjct  219   RIYDRSEQPARAT-----------------------------------------------  231

Query  298   LQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFsdddisdee  357
                  PFT+S   + + +K         L S          +D E NR+    +   +++
Sbjct  232   -----PFTQSTGYNLAALK-------FDLRSTGTGKNDRSNDDMEGNREHIDGEISDEDQ  279

Query  358   qesdendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVT  417
               +D +  +E AEME+LGANVDKIRGYN+LLD YSLHQFLIHKGR+MRDTPEFVSFRRV 
Sbjct  280   GGADNDKDEE-AEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVA  338

Query  418   QELWGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVM  477
             QELWGSVEEALRALETLL QYFVPLAYVDGQRLL+LA TGQPRFSK ELL+CIVNE+QVM
Sbjct  339   QELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVM  398

Query  478   SVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHT  537
             SVLRRPGQRYKGRDRKRRAATTI+ACVRMW +RRRY R+RASD +A++IQLAWR+YSCH 
Sbjct  399   SVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHA  458

Query  538   SLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQ  597
             +LK RLREV  E+LE+WE RM +L++ WPQIAGRRRVVVHVPSLSLDEHSRL AENFA+Q
Sbjct  459   ALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQ  518

Query  598   QNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQT  657
             QNLQLTR+CAAALDS+V+LL+YVSPFELT+DVSQYFLKLLQLGGL DSRPRVKLVFPEQ 
Sbjct  519   QNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQA  578

Query  658   TRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappa  717
              RFP HFSLSSLLLYSPHCLRRIRHYT GKEAYLVMGLPGAEDQRLA+ALDLPILGAPPA
Sbjct  579   ARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPA  638

Query  718   qalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDP  777
             QALPLLTRSGGKRLLIRADVNVP GTYELYDEHE+ AALAKLA+AHM+QP+WL+KLDYDP
Sbjct  639   QALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDP  698

Query  778   LDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQ  837
             L +GEAVVDLS MQAMRELRREKRTPEYWRQPGPRDAAAKL+LAELERPG+LAR+ATPM 
Sbjct  699   LGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMH  758

Query  838   TEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHIS  897
             TEIFP WR+F +A+GHFGCV+EAVPP  IAA+ E+S++LVEPAYVRANLFV PDG     
Sbjct  759   TEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDG-----  813

Query  898   STQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQ  957
               +NVLA+ GGGLNRKTVAFTFPQTAAP+EA++GAC+A GKLLVET+VWGYVSLDFVVFQ
Sbjct  814   --KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQ  871

Query  958   DEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV-ANKSLTTANSGRK  1016
             DEK+  +PRLWALAVHPFLTDSA SFACFHLLAR       G YRV A+ S+  AN GR 
Sbjct  872   DEKNGGSPRLWALAVHPFLTDSAASFACFHLLAR-------GAYRVAASNSMVNANPGR-  923

Query  1017  SESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDV  1076
             S SG A DLLLREA L K++L GA RCFV CSYVFHPHV TMQY+AFFHACRLHGVCFDV
Sbjct  924   SGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDV  983

Query  1077  ERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrsv  1136
             ERTLGTLFLLADSLTAGVFGILS+GETTEGALAFLRTALEVIGRE G+TI    + SR V
Sbjct  984   ERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATI--EMATSRPV  1041

Query  1137  asrsGNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170
             ++R+GNFAQ+LSA+R STGGGK DRLGKMR+ +R
Sbjct  1042  STRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075

>PHALS_06477
Length=1166

 Score = 1454 bits (3764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1181 (66%), Positives = 900/1181 (76%), Gaps = 52/1181 (4%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+KVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RH++++T AEVQAF+
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             A+LQQTE+ELRAKAELVLNG++NSS+S  N+Q Q  T LPAV+VAA   I HR G  +A+
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  121   K---PRQMDASSIPVEFFREQFRNNSVEIRQSL---PEPWERHFGIHHGRLMRKKTTQHC  174
             +     ++D +S  +EFFR+QFRNN VEIRQSL   PE W R  G    R +RKKTTQH 
Sbjct  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192

Query  175   RLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSG---TSDGSGGGV  231
             RLLP VNK DPS PTP+LREEDA  G+LNLVTRGFLPAYADLTP F+G    S+GSGG  
Sbjct  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252

Query  232   MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrrs  291
             +K RAT IY+RS++  R TP   S G+NLA LKFD R   TP                  
Sbjct  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPS-----------------  295

Query  292   trrssALQGPNP-----FTRSVPISS-SKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNR  345
                      P P      + S+P +  S I    S+ P    S  VAA  NQ ED ENN 
Sbjct  296   -------SAPKPNHSATVSASMPNTKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNC  348

Query  346   DRFsdddisdeeqesdendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMR  405
                 +D   +E  +  +  KDE    + L  NV KIR YN+L+D YSLHQ LI+KGR +R
Sbjct  349   THSFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIR  408

Query  406   DTPEFVSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSKRE  465
             DTPEF SFRRV  +LWGSVEE LRALE +L QYFVPLA+VDGQRL+ALA T QP+FS+RE
Sbjct  409   DTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRE  468

Query  466   LLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASK  525
             LLSCIVN++QVMSVLRRPGQRY GRDRK RAATTI+AC RMW+V  RY ++R+S+ NA K
Sbjct  469   LLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIK  528

Query  526   IQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDE  585
             IQ A+RAYS  T+LKARLRE+  EK  KWE RM+  KS W QIA RRR+VVHVPS+SL E
Sbjct  529   IQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGE  588

Query  586   HSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDS  645
             HSRL AENFA+QQNLQLTR+CAAALD  V+LL+YVSP+ELT+DVSQYF KLLQL G  DS
Sbjct  589   HSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADS  648

Query  646   RPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAM  705
             RPRVK V+PEQ  RFPAHFSLSSL+LYSP+CLRRIRHYT G EAYLVMGLPG EDQRLA+
Sbjct  649   RPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAI  708

Query  706   ALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMD  765
              LDLPILGA P+QALPLLTRSGGKRLLI+AD+NVP GTYELYDEHE+  ALAKLA+AH+D
Sbjct  709   TLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHID  768

Query  766   QPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELER  825
             Q +WLIKLDYDPL VGEAVVDLS+MQAMREL REKRTPEYWRQPG RDAAA L L E ER
Sbjct  769   QSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFER  828

Query  826   PGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRAN  885
             PG LAR+ TP+ TE++P WRE+  A+GHFGCV+EAVPPTA AAS E      EP Y+RAN
Sbjct  829   PGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASME------EPTYLRAN  882

Query  886   LFVDPDGSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNV  945
             +FVDP+G+VH++STQNVL    GGL+RK+  F FPQT AP+ AIKGACNA GK L ETNV
Sbjct  883   IFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNV  942

Query  946   WGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV-A  1004
             WGYVSLDFVVFQD KSN A RLWALA+HPFLT+SA +FACFHLL RG LD NSG+YRV  
Sbjct  943   WGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPG  1002

Query  1005  NKSLTTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFF  1064
              K L TA +  +S +  A DLLLREA L K+   GA RC+V CSYVFHP+V   QYT FF
Sbjct  1003  TKKLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFF  1062

Query  1065  HACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGS  1124
               CRLHGVCFDV R LGTLFLLADSLTAGVFGILSIGET + AL++LRTALEVIGREAG+
Sbjct  1063  QNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGA  1122

Query  1125  TIsvasspsrsvasrsGNFAQILSAIRVSTGGGKSDRLGKM  1165
             T       S S  S  GNFA +LS +R STGGG S+RLG++
Sbjct  1123  T---KGIVSSSSRSVLGNFADVLSTVRASTGGGSSNRLGQV  1160

>PHYCA_34475
Length=692

 Score = 1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/724 (82%), Positives = 635/724 (88%), Gaps = 32/724 (4%)

Query  382   RGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealraletllaQYFVP  441
             RGYNELLD YSLHQFLIHKGRTMRDTPEF+SF RV QELWGSVEEALRALETLL  YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  442   LAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIE  501
             LAYVDGQRLL+LA TGQPRFSKRELLSCIVNE+QVM+ LRRPGQRYKGRDRKRRAATTI+
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  502   ACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNL  561
             A VRMW  RRRYAR+RA D NA++IQLAWRAYSCH +LKARLREV  E+LEKWE RMH L
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  562   KSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVS  621
             KS W QIA  RRVVVHVPSLSLDE+SRL AEN A++QNLQLTR+CAAALDS V+LL+YVS
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  622   PFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIR  681
             PFELT+DVSQYF+KLLQLGGL DSRPRVKL+FPEQ TRFPAHFSLSSLLLYSPHCLRRIR
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  682   HYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKRLLIRADVNVPN  741
             HYT GKEAYLVMGLPGAEDQRLAM LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  742   GTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKR  801
             GTYELYDEHE+ +ALAKLA+AHMDQP+WL KLDYDPL VGEAVVDLS MQAMRELRREKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  802   TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAV  861
             TPEYWRQPGPRDAAAKL+L ELERPG LAR+A P+  +IFP W EF +A+GHFGCV+EAV
Sbjct  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  862   PPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGGGLNRKTVAFTFPQ  921
             P TAIA + E ST L+EPAY+RANLFVDPDGSVH++ST N+LA GGGGLNR+TVAFTFPQ
Sbjct  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  922   TAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSAT  981
             TAAP+EA+KGAC+AAGKLLVETNVWGYVSLDFVVFQD+KSN APRLWALAVHPFLTDSA 
Sbjct  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  982   SFACFHLLARGVLDTNSGVYRVANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGAR  1041
             SFACFHLLARGVLD NSGVYR+A  S                                  
Sbjct  601   SFACFHLLARGVLDANSGVYRMAAASTP--------------------------------  628

Query  1042  RCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIG  1101
             RCFV CSYVFHPHV TMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFG+LSIG
Sbjct  629   RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIG  688

Query  1102  ETTE  1105
             ETTE
Sbjct  689   ETTE  692

>PYIR_13453
Length=1186

 Score = 1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/1224 (50%), Positives = 808/1224 (66%), Gaps = 93/1224 (8%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRH-NAIVTTAEVQAF  59
             MD+ QQQHHVEDVGR+LLQTQEQLR+MREQM A +       S MR  ++  +  +V AF
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPS---SSMRFASSGASQPDVLAF  57

Query  60    NAILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAA----APSIMHRSG  115
               ILQ+ E E+RAKAELVLNG VN+SS          + LP V+ +A    +P    R  
Sbjct  58    QEILQRAEVEIRAKAELVLNGFVNTSSQ--------ASALPTVSSSANGNASPKARLRQN  109

Query  116   YDKANKPRQMD--ASSIP-VEFFREQFRNNSVEIRQS--LPEPWERHFGIHHGRLMRKKT  170
                    R+    AS  P +++FR +F N +VE   S  LP P +R   I  G+L++KK 
Sbjct  110   VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQR---ITKGQLVKKKM  166

Query  171   TQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGG  230
              Q+ RLLPSVNK+DPS PTPEL E+DAK G+L+LV RGFLP  ADLTP F        G 
Sbjct  167   AQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNH----GS  222

Query  231   VMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrr  290
             ++K   TRIY+R EQ +RS P T  +G+N+ASLKFD+  P T       +   + + +R 
Sbjct  223   IIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRT  282

Query  291   strrssALQG------PNPFTRSVPISSSKIK-----------NGRSAHPTSLMSAAVAA  333
             +       +G      P  +  S  + S   K            G        ++AA   
Sbjct  283   AAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAML  342

Query  334   FTNQGEDTENNRDRFsdddisdeeqesdendkdeYAEMEKLGANVDKIRGYNELLDVYSL  393
              T+Q ++ E+      D+  S     +D+++ D  A M++L  NV+KIRGYNELLD YSL
Sbjct  343   STDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSA-MDELRKNVEKIRGYNELLDTYSL  401

Query  394   HQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLAL  453
             HQF+IHKGR MR+TPEFVSF+RV QE+WGSVEE +RALE LL +YFVPLAY+DGQRL+ +
Sbjct  402   HQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTV  461

Query  454   AGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRY  513
             A      FSKR+LLSCIVNEDQV S++RRPGQRYKG+DRKRRAA TI+   RMW  +++Y
Sbjct  462   AAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKY  521

Query  514   ARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRR  573
              R R    +   IQ  WRA++ H SLK +L+    ++ E+WE +M  LK  W  I G RR
Sbjct  522   TRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRR  581

Query  574   VVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYF  633
             VV+HVPSLS+DE SR+ A+NF+++QN+QL+R+C   +D NV+ ++YVSPFELT+DV+QY 
Sbjct  582   VVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVSPFELTADVAQYS  639

Query  634   LKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVM  693
             +KLLQLGG+ D   RVKLV+PEQ  RFPAHFSL++LLLYSPHCLRRI+ Y   KEAYLV 
Sbjct  640   MKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVT  699

Query  694   GLPGAEDQRLAMALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVC  753
             G+PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +RADVNVP GTY++YDE E+ 
Sbjct  700   GIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELV  759

Query  754   AALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRD  813
              +LAKL ++H++Q  W++K+DYDP   G A++D+S M  +RE+RREK++PEYW+QP  RD
Sbjct  760   FSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRD  819

Query  814   AAAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEAS  873
              AA+ I+AELER   LA + TP+  E++P W+EF+DA+  FG VVEA P   I       
Sbjct  820   NAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVI-------  870

Query  874   TVLVEPAYVRANLFVDPDGSVHISSTQNVLAA-------------GGGGLNRKTVAFTFP  920
                    +VRANLF++P G VH+SSTQ+++                 G    KTV + FP
Sbjct  871   ------GHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFP  924

Query  921   QTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSA  980
             QTAAPYEAI+GA  A GKLL +  V+GY S+D++VFQ++K++ A RLWA+A+HP+LTDSA
Sbjct  925   QTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTH-AARLWAMALHPYLTDSA  983

Query  981   TSFACFHLLARGVLDTNSGVYRVANKSLTTA-----------NSGRKSESGSATDLLLRE  1029
             ++FA FHLL RG L+ +SG+Y +   + + +           +    +   SA DL+++E
Sbjct  984   STFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQE  1043

Query  1030  AL---LAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLL  1086
             A    L      GA+R +V   Y+FHP+V TMQY+AFFH CRLHGVCFDVER +G++FLL
Sbjct  1044  ATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLL  1103

Query  1087  ADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrsvasrsGNFAQI  1146
             ADSLTAGVFGI+   ++  GAL FLRTALEVIGRE G T ++         S +GNFA +
Sbjct  1104  ADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESETGNFADV  1162

Query  1147  LSAIRVSTGGGKSDRLGKMRQRQR  1170
             L+ IR  T GGKS +L K+R+ +R
Sbjct  1163  LAVIRALT-GGKSAKLEKIRRLRR  1185

>PYIW_18793
Length=997

 Score = 967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/1035 (51%), Positives = 685/1035 (66%), Gaps = 77/1035 (7%)

Query  172   QHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGV  231
             QH RLLPSVNK DPS PTPEL E+DAK+G+L+LV RGFLP   DLT  F      S GG+
Sbjct  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFV----NSHGGI  58

Query  232   MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrrs  291
             ++   TRIY+R EQ +R+ P T  +G+N+A+LKFDL A           +          
Sbjct  59    IQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAV  118

Query  292   t--------rrssALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAV---AAFTNQGED  340
                         +  +GPN  T S    + +     +        + +   A+   + E 
Sbjct  119   VNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAES  178

Query  341   TENNRDRFsdddisdeeqesdendkdeYAEMEKLGANVDKIR-------GYNELLDVYSL  393
              E N D                     Y E +     +D++R       GYNELLD YSL
Sbjct  179   PETNVDE-----------------DLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSL  221

Query  394   HQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLAL  453
             HQF+IHKGR MR+TPEFVSF+RV QE+WGSV+E ++ALE LL +YFVPLAYVDGQRL+ +
Sbjct  222   HQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTV  281

Query  454   AGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRY  513
             A      +SKR+LLSCIVNEDQV S++RRPGQRYKG+DRKRRAA TI+   RMW  +++Y
Sbjct  282   AAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKY  341

Query  514   ARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRR  573
             +R R    +   IQ  WR Y+ H  LK R++    ++  +WE +M  LK  W +I G RR
Sbjct  342   SRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRR  401

Query  574   VVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYF  633
             VV+HVPS S+DE  RL A+NF+++QNLQL+R+C   +DSNV+ ++YVSPFELT+DV QY 
Sbjct  402   VVIHVPSFSVDERLRLSADNFSVKQNLQLSRLC-GLVDSNVD-IVYVSPFELTTDVVQYS  459

Query  634   LKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVM  693
             +KLLQLGG+ D   RVKLVFPE   RFP HFSL++LLLYSPHCLRRI+ Y   KEAYLV 
Sbjct  460   MKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVT  519

Query  694   GLPGAEDQRLAMALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVC  753
             G+PG ED+RLAMAL++PILG  P  ALPL+T+SGGKR  +RADVNVP GTY++YDE E+ 
Sbjct  520   GMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELV  579

Query  754   AALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRD  813
              +LAKL ++H++Q  W++K+DYDP   G A++D+S M A+RE+RREKR+PEYWRQPG RD
Sbjct  580   FSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRD  639

Query  814   AAAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEAS  873
              AA++I+AELER   L  + TP+  E++P W+++ DA+  FG VVEA P   +       
Sbjct  640   NAARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVV-------  690

Query  874   TVLVEPAYVRANLFVDPDGSVHISSTQNVL--------AAGGGGLNRKTVAFTFPQTAAP  925
                    +VRANLFV+P G VH+SSTQ++L           GG    K+V + FPQTAAP
Sbjct  691   ------GHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFPQTAAP  744

Query  926   YEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFAC  985
             YEAI+GA  A GKLL E NV+GY S+DF+VFQ++KS+ A RLWA+A+ P+LTDSA +F  
Sbjct  745   YEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTT  803

Query  986   FHLLARGVLDTNSGVYRVANKSLTTAN-------SGRKSESGSATDLLLREAL---LAKS  1035
             FHLL RG L+T SG+Y +   ++T+A+       S   +   SA DL+L EA    L   
Sbjct  804   FHLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVSL  863

Query  1036  SLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVF  1095
               VGA+  +V   Y+FHP+V TMQY+AFFH CRLHGVCFDVER +G++FLLADSLTAGVF
Sbjct  864   EKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVF  923

Query  1096  GILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrsvasrsGNFAQILSAIRVSTG  1155
             G++   +T  GAL FLRTALEV+GRE G T ++    +    + +GNFA +L+AIR  T 
Sbjct  924   GLMCCSDTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAIRALT-  981

Query  1156  GGKSDRLGKMRQRQR  1170
             GGKS +L K+R+ +R
Sbjct  982   GGKSAKLEKIRRLRR  996

>PYAP_17746
Length=1169

 Score = 928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/1175 (45%), Positives = 730/1175 (62%), Gaps = 88/1175 (7%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   + I +        
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSN-------GPGNGSVIASNNAGAEIE  53

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
              ILQ+ E ELR KAELVL+ +V +  ++     + G L+P  TV   P    R    + +
Sbjct  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELH  113

Query  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSLPEPWERHFG-----IH-HGRLMRKKTTQHC  174
                  D   + +E+FR++F+  +V+   S      R  G      H HG++++ KTT + 
Sbjct  114   DGGSYD---LDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKVVKHKTTSNA  170

Query  175   RLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVF----SGTSDGSGGG  230
             RLLP VNK DP+ P P L   DAK GVL+L+ RGFLP   DLTP F    S  S G+   
Sbjct  171   RLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNPTS  230

Query  231   VMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRapptpppvvpeatfpDsttrrr  290
             V++  + +++ R EQ VR+T ++    +NLA+LKFD+ A  T       +          
Sbjct  231   VIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIE--------  282

Query  291   strrssALQGPNPFTRSVPISSSK-----IKNGRSAHPTSLMSAAVAAFTNQGEDTENNR  345
                       P+  + ++P+ + K       NG+S           +   N  E   + R
Sbjct  283   ----------PHDESEALPLRAMKTVTISFHNGKSES---------SPRNNARESEHDGR  323

Query  346   DRFsdddisdeeqesdendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMR  405
                 +D    E ++ D    +    ME L  NV+KIRGYNELLD YSLHQF+IHKGR +R
Sbjct  324   REDGNDTAPLEREDLDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALR  383

Query  406   DTPEFVSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSKRE  465
             DTPEF SF+RV QE+WGS+EE ++ALE LL +YFVPLAY+DGQRL+ LA     + S  E
Sbjct  384   DTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCE  443

Query  466   LLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASK  525
             LL+C+VNEDQV S++RRPGQRYKG+DRKRRAATT++A  RM L R R+ + R +  +A  
Sbjct  444   LLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAML  503

Query  526   IQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDE  585
             IQ  WR+Y+C  SL+ RL  V  E+L +W+ ++  ++S W  I  +RRVV+HV S+S+DE
Sbjct  504   IQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDE  563

Query  586   HSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDS  645
              +RL  ENF+++QNLQL+R+ A  +D NVE ++YV+PFEL+++VSQYF+KLLQL G+ ++
Sbjct  564   RTRLSMENFSVKQNLQLSRL-AGLVDQNVE-IVYVTPFELSTEVSQYFIKLLQLSGIANA  621

Query  646   RPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAM  705
               RV+LVFPE   +FP HFSL++ L+YSP+C+RRI+    GKEAYLVMG+PG EDQRLA+
Sbjct  622   HTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAV  681

Query  706   ALDl-pilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHM  764
             AL +  +    P   LPL+TRSG KR  I+ADVNVP GTY++YD  E+  +LAKL I+H+
Sbjct  682   ALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHL  741

Query  765   DQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELE  824
             +Q  WL+KLD DPL  G A++D+S M  +R++RREKR PEYW+QPG RD  A+ +L ELE
Sbjct  742   NQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELE  801

Query  825   RPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRA  884
             R   +  +  P   EIF  W+EF  A+  FG VVEA+P                   +R 
Sbjct  802   RE--IGSLLKPSHPEIFASWKEFASAIPEFGVVVEALP-------------FHVAGVIRM  846

Query  885   NLFVDPDGSVHISSTQNVLAAGGGGLN---RKTVAFTFPQTAAPYEAIKGACNAAGKLLV  941
             N+F++P G VH+ ST +VL+  G  L+   R+  AF FPQT  P+EAI GA +A G++L 
Sbjct  847   NIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLY  906

Query  942   ETNVW-GYVSLDFVVFQDE---KSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTN  997
             E + + GY S+D  + Q+E     + A RLWA+++ P+LTDSA +FA FH L RGVL+  
Sbjct  907   EEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPA  966

Query  998   SGVYRVANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVIT  1057
             +G Y +      TA      ES SA    L  +++     +GA R +    YVFHP+V  
Sbjct  967   TGRYNL------TARESTPPESDSA----LVSSVIGTLDRIGAPRSYAVAEYVFHPNVSI  1016

Query  1058  MQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEV  1117
             M Y AFFH CRLHGVCFDVER +G++FLLADSLTAG+FG+LS GE+   AL +LRTA EV
Sbjct  1017  MSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEV  1076

Query  1118  IGREAGS-TIsvasspsrsvasrsGNFAQILSAIR  1151
             IGRE G+ ++    S   S    SGNFA+IL  +R
Sbjct  1077  IGREVGTQSMVSGDSDIGSSVQLSGNFAEILGLLR  1111

>PYU1_G001734
Length=800

 Score = 895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/818 (55%), Positives = 597/818 (73%), Gaps = 38/818 (5%)

Query  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealra  430
             M+ L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEFVSF+RV QE+WG VEE ++A
Sbjct  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  431   letllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490
             LETLL +YFVPLAYVDGQRL+ +A      FSK++LLSCIVNEDQV S++RRPGQRYKG+
Sbjct  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
             DRKRRAA TI+   RMW  +++Y+R R    +   IQ  WRAY+ H  L+ +L+    ++
Sbjct  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610
              E+WE RM  L+  WP+I   RRV++HVPSLS+DE  R+ A+NFA++QNLQL+R+C   +
Sbjct  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLC-GII  239

Query  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670
             D+NV+ ++YVSPFELTS+V QYF+KLLQLGG+ D   RVKLVFPEQ TRFPAHFSL+++L
Sbjct  240   DANVD-IVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVL  298

Query  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKR  730
             LYSPHCLRRIR    GKEAYLV G+PG ED+RLAMAL++PILG  P   LPL+T+SG KR
Sbjct  299   LYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKR  358

Query  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790
               +RADVNVP GTY++YDE E+  +LAKL ++H++Q  WL+K+DYDP   G A+VD S +
Sbjct  359   FFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVV  418

Query  791   QAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREFIDA  850
              A+RE+RREK++PEYWRQPG RD AA++I+AELER   + ++ TP+  E++P W+EF DA
Sbjct  419   TALREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADA  476

Query  851   VGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGGGL  910
             +  FG V+EA P   +              Y+RANLFV+P G VH+SSTQ+V+ +     
Sbjct  477   IAQFGVVIEAAPSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIH  523

Query  911   NRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWAL  970
              RK   + FPQT APYEAI+GA  A GK+LV+ +V+GY S+D++VF+++K++  PRLWA+
Sbjct  524   KRKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAM  582

Query  971   AVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLT---------------TANSGR  1015
             A+HP+LTDSA++FA FHLL RG L+ ++G Y +   + +                A+S R
Sbjct  583   ALHPYLTDSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTR  642

Query  1016  KSESGSATDLLLREAL---LAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGV  1072
              + S ++ +L+L+EA    L      GA+R +    Y+FHP+V TMQY++FFH CRLHGV
Sbjct  643   AAGSATSANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGV  702

Query  1073  CFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvassp  1132
             CFDVER  GT+F+LADSLTAGVFGI+  G+T   AL FLRTALEVIGRE G T ++    
Sbjct  703   CFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDL  761

Query  1133  srsvasrsGNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170
                    SGNFA++L+ +R  T GGKS +L K+R+ +R
Sbjct  762   RGGGDCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLRR  798

>H310_09212
Length=1113

 Score = 723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/1202 (37%), Positives = 669/1202 (56%), Gaps = 124/1202 (10%)

Query  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
             M+K+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43

Query  61    AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
             AIL++ E +LRAKAE+VLNG+VN+S            +LPA+        + +     A 
Sbjct  44    AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAIDAPGGQRYLSKFSSKLAQ  93

Query  121   KPRQMDAS---------SIPVEFFREQFR-----NNSVEIRQSLPEPWERHFG--IHHGR  164
             K R + A+           P       +R     +  +E  +    P  R  G  +  G 
Sbjct  94    K-RDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAGS  152

Query  165   LMRKKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTS  224
             L++ KTT+  R+LP +N+ DP+ P P L ++DA+ GV NL+TRGFLP   D+TP F+   
Sbjct  153   LVKHKTTKPRRILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAFT---  209

Query  225   DGSGGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFD-LRapptpppvvpeatfp  283
                G  V++    +IY+R+ Q V+S P+T  +G+N+ASLKFD +   P     VP     
Sbjct  210   --HGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPINQGG  267

Query  284   DsttrrrstrrssALQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTEN  343
             D    + S      +        +VP    + K G         SA   A  N      N
Sbjct  268   DIPPSKTSIPTPIDITFDGHANNAVPFRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHN  327

Query  344   NRDRFsdddisdeeqesdendkdeYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRT  403
              R                               NV+KIRGYNELLD YSLHQF+I KG+T
Sbjct  328   LR------------------------------RNVEKIRGYNELLDTYSLHQFIIRKGKT  357

Query  404   MRDTPEFVSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQRLLALAGTGQPRFSK  463
             + DTPEF+SF+R T++LWGSV ++++ LE +L  Y VPLAYVDGQ+L+ +A         
Sbjct  358   LADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGT  417

Query  464   RELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNA  523
              ELLSCI+N D+V S++RRPGQR+KG+     AA  +++  RM++ ++R      ++ +A
Sbjct  418   MELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGNE-DA  476

Query  524   SKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSL  583
             + IQ  +R+Y C + L+ RL+ V    L  W+ +M   +++W  I  +RRVVVHVPS S 
Sbjct  477   AVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSS  536

Query  584   DEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLV  643
             +E +RL  ENF+IQQNLQ+ R+CA A D NV+++ Y+SPFEL+ D+ +Y ++LLQLGG+ 
Sbjct  537   EERTRLKMENFSIQQNLQMARMCAIA-DPNVDII-YISPFELSPDIQKYQVRLLQLGGIA  594

Query  644   DSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRL  703
             D + R++++ PE   RFP HFSL+++LLYSPHCL++I+ +  GK+AY+V G  G ED+RL
Sbjct  595   DPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRL  654

Query  704   AMALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAH  763
             A+AL LP+LG  P +AL   TRSGGKR+ + ADVN+P G +++YDE E+  +L+KL  A 
Sbjct  655   AIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAAD  714

Query  764   MDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKR-----TPEYWRQPGPRDAAAKL  818
             +DQ  WLIK+D D  + G A +++  MQ++ + R EKR       EY++QP  RDA  + 
Sbjct  715   IDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRS  774

Query  819   ILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVE  878
             + +EL      A + TP   E++  W          G V+EA P          S VL  
Sbjct  775   VYSELNESYFAANV-TPCFPEMYASWAAMRPIALRVGVVIEAYP----------SKVL--  821

Query  879   PAYVRANLFVDPDGSVHISSTQNVLAAGGGGLNRK-TVAFTFPQTAAPYEAIKGACNAAG  937
              ++VR N+F++P G VHI+S  +V       +N+       FPQ++ PY+AI+GA  A  
Sbjct  822   -SHVRTNIFIEPSGGVHITSAHDVFMC---PVNKHLPQCAVFPQSSVPYQAIRGASLAIA  877

Query  938   KLLVETNVWGYVSLDFVVFQDEKS--NDAP--RLWALAVHPFLTDSATSFACFHLLARGV  993
               +    + GY S+D++ F D K+  +  P  RLWA+ V P LT++A SF  F  L+   
Sbjct  878   SSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQ  937

Query  994   LDTNSG-----VYRVANKSLTTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACS  1048
              +  +G     V      +L+TAN+           +L   +  A +S+ G  R ++   
Sbjct  938   FNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILSPPSSAAAASVCGPERTYMVLD  997

Query  1049  YVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGAL  1108
             Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  ++LADSLTAGV G++ IGE+ + A 
Sbjct  998   YIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAF  1057

Query  1109  AFLRTALEVIGREAGSTIsvasspsrsvasrsGNFAQILSAIRVSTGGGKSDRLGKMRQR  1168
                R A+E+IG + G    V + P+     R GNF  +L+ +R      KSD      +R
Sbjct  1058  RIARQAVELIGDQVG----VQALPNSLSGERLGNFPHLLAIVR-----NKSDDPAAADRR  1108

Query  1169  QR  1170
             +R
Sbjct  1109  KR  1110

>SDRG_01764
Length=1092

 Score = 629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/793 (43%), Positives = 495/793 (62%), Gaps = 38/793 (5%)

Query  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealra  430
             +++L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+T++LWGSV  A+R 
Sbjct  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368

Query  431   letllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490
             LETLL  Y VPLAY+DGQ+LL +A       SK ELL+C++N D+V + + RPGQR+KG 
Sbjct  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428

Query  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
             D +  AA  +++  RM L RRR  +     + AS IQ  +R Y     ++ +LR      
Sbjct  429   DSRHAAAILLQSVYRMHLTRRRLRQHHGHSY-ASHIQRVYRTYKSVKEIQVKLRLAREAD  487

Query  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610
                WE +M    ++W +I  +RRVVVHVPS S +E +RL  +NFAI+QNLQ+ R+CA A 
Sbjct  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-  546

Query  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670
             D NV+++ Y+SPFEL++D+ +Y ++LLQLGG+ D   RV+++ PE   RFP HFSL+++L
Sbjct  547   DPNVDVI-YISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  605

Query  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKR  730
             LYSPHCL++I+ Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KR
Sbjct  606   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  665

Query  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790
             L  +ADVN+P G +++YDE E+  +LAKL  A++ Q  WLIKLD DP D G A +D+  +
Sbjct  666   LFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHAL  725

Query  791   QAMRELRREKR---TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREF  847
             + + ++R EKR     EY+ QP  ++   + I+AEL       R+ +P   +++P W+  
Sbjct  726   ECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  783

Query  848   IDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGG  907
                V   G V+EA PP  +             A VRAN+F++P G VH++S Q  L    
Sbjct  784   RPVVNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAK  830

Query  908   GGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAP--  965
                  ++V   +P T  PY AI+GA  A  + +  + + GY S+D+V F D K+ +    
Sbjct  831   N--KHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888

Query  966   ----RLWALAVHPFLTDSATSFACFHLLARGVLDTNSG---VYRVANKSLTTANSGRKSE  1018
                 RLWAL + P LT +A SF  F  L+   LD  +G   + + A            +E
Sbjct  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTE  948

Query  1019  SGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVER  1078
             +  A + +L E+   +SS VG  R ++A  Y+FHP++ T+QY  FF+ CR+HGV FD+++
Sbjct  949   TQLAVEKILSES--PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQK  1006

Query  1079  TLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrsvas  1138
             ++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+IG + G    V  +P      
Sbjct  1007  SIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTGE  1062

Query  1139  rsGNFAQILSAIR  1151
             R GNFA +L AIR
Sbjct  1063  RLGNFAAVLGAIR  1075

 Score = 181 bits (458),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 157/272 (58%), Gaps = 28/272 (10%)

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
            MD++ QQ+HVEDVGR+LLQ Q++LR MREQ+             +  N I    ++ A  
Sbjct  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQV-------------LTSNNI----DIDALQ  43

Query  61   AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
            AIL++ E +LR+KAE+VLNG+VN++          G   P+V+  ++     R   D   
Sbjct  44   AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103

Query  121  KPRQMD---ASSIPVEFFREQFRNNSVEIRQSLPEPWERHFG--IHHGRLMRKKTTQHCR  175
            +   +D     S PVE  R+Q     V + +  P P +R  G  +  GRL++KK T   R
Sbjct  104  RDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRP-PGKRPIGRTMQVGRLIKKKVTGPQR  162

Query  176  LLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQR  235
            LLP VN+ DP  P P+L ++DAK GVLNLV RGF+P  ADL+  F+      G G+++  
Sbjct  163  LLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFT-----HGDGIIQNS  217

Query  236  ATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267
              R+Y+RSEQ V+S P+  S+ +N+ASLK DL
Sbjct  218  KLRLYDRSEQPVKSQPYMNSSSFNVASLKLDL  249

>SPRG_06354
Length=884

 Score = 625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/797 (44%), Positives = 496/797 (62%), Gaps = 45/797 (6%)

Query  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealra  430
             +++L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+T++LWGSV  A+R 
Sbjct  97    IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRE  156

Query  431   letllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490
             LETLL  Y VPLAY+DGQ+LL +A       SK ELL+C++N D+V + + RPGQR+KG 
Sbjct  157   LETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGG  216

Query  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
             D +  AA  I++  RM   RR   +     + A+ IQ  +R Y C   ++ +LR      
Sbjct  217   DGRHAAAIVIQSVYRMHRTRRLLRQHHGHSY-ATHIQRVYRTYKCVKDIQVKLRLAREAD  275

Query  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610
                WE +M    ++W +I  +RRVVVHVPS S +E +RL  +NFAI+QNLQ+ R+CA A 
Sbjct  276   ARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-  334

Query  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670
             D NV+++ Y+SPFEL+ D+ +Y ++LLQLGG+ D   RV+++ PE   RFP HFSL+++L
Sbjct  335   DPNVDVI-YISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  393

Query  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKR  730
             LYSPHCL++I+ Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KR
Sbjct  394   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  453

Query  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790
             L  +ADVN+P G +++YDE E+  +LAKL  A++ Q  WLIKLD DP D G A +D+  +
Sbjct  454   LFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHAL  513

Query  791   QAMRELRREKR---TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREF  847
             + + ++R EKR     EY+ QP  ++   + I+AEL       R+ +P   +++P W+  
Sbjct  514   ECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  571

Query  848   IDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGG  907
                V   G V+EA PP  +             A VRAN+F++P G VH++S Q  L    
Sbjct  572   RPVVNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHVTSAQEQLMHVK  618

Query  908   GGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAP--  965
                  ++V   +P TA PY AI+GA  A  + +  + + GY S+D+V F D K+ +    
Sbjct  619   N--KHQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  676

Query  966   ----RLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTANSGRKSESGS  1021
                 RLWAL + P LT +A SF  F  L+   LD  +G      +S     + R S    
Sbjct  677   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG------RSFLPLPAPRPSSLAG  730

Query  1022  --ATDLLLR-EALLAKSS---LVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFD  1075
               AT+  L  E +L +SS    +GA R ++A  Y+FHP++ T+QY  FF+ CR+HGV FD
Sbjct  731   PPATETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFD  790

Query  1076  VERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrs  1135
             +++++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+IG + G    V  +P   
Sbjct  791   LQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDAL  846

Query  1136  vasrsGNFAQILSAIRV  1152
                R GNFA +L AIR+
Sbjct  847   TGERLGNFAAVLGAIRL  863

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)

Query  232  MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267
            M+    R+Y+RSEQ V+S P+  S+G+N+ASLK DL
Sbjct  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDL  36

>H257_06305
Length=1099

 Score = 594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/813 (41%), Positives = 492/813 (61%), Gaps = 42/813 (5%)

Query  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealra  430
             +  L  NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEF+SF+R T++LWGSV  +++ 
Sbjct  311   IHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQE  370

Query  431   letllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490
             LET+L  Y VPLAYVDGQ+L+ +A          ELLSCI+N D+V S++RRPGQRYKG 
Sbjct  371   LETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGS  430

Query  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
                  A   I++  RM+L ++R      ++ +A+ IQ  +R+Y C + L+ RL+ V    
Sbjct  431   QGPDLAVVLIQSVWRMFLTKKRLKNHHGNE-DAAVIQRIYRSYRCFSQLQQRLKLVREAD  489

Query  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610
             L  W+ +M   +++W  +  +RRVVVHVPS + D+ +RL  +NF+I+QNLQ+ R+CA A 
Sbjct  490   LRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-  548

Query  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670
             D NV+++ Y+SPFEL+ D+ +Y ++LLQLGG+ D + R++++ PE   RFP HFSL++LL
Sbjct  549   DPNVDII-YISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLL  607

Query  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKR  730
             LYSPHCL++I+ +  GK AY+V G  G ED+RLA+AL +P+LG  P +AL   TRSGGKR
Sbjct  608   LYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKR  667

Query  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790
             + + ADVN+P G +++YDE E+  +L+KL  A +DQ  WL+K+D D  D G A +++  M
Sbjct  668   IFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQM  727

Query  791   QAMRELRREKR-----TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWR  845
             Q++ ++R EKR       EY++QP  RDA  + I  EL      A I TP   +++  W 
Sbjct  728   QSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANI-TPCFPDVYASWA  786

Query  846   EFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAA  905
             E        G V+EA P          S VL +   VRAN+F++P G VHI+S  ++  +
Sbjct  787   ELRPVALRVGVVIEAYP----------SKVLSQ---VRANVFIEPSGGVHITSAHDLFMS  833

Query  906   GGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS----  961
                          FPQT+ PY+AI+GA  A    +    + GY S+D++ F D K+    
Sbjct  834   PAN--KHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGG  891

Query  962   -NDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV----ANKSLTTANSGRK  1016
                  RLWA+ V P LT++A SF  F  L+    +  +G   +          +A     
Sbjct  892   GRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPI  951

Query  1017  SESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDV  1076
             +++  A + +L       + + G  R ++   Y++HP++ T+ ++ FF+ CRL+GV FD+
Sbjct  952   TQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDL  1011

Query  1077  ERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvasspsrsv  1136
             +R +G  F+LADSLTAGV G++ IGE  + A    R A+E+IG + G    V + P    
Sbjct  1012  QRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG----VQALPDSLS  1067

Query  1137  asrsGNFAQILSAIRVSTGGGKSDRLGKMRQRQ  1169
               R GNF  +L+ +R      KSD     R+R+
Sbjct  1068  GERLGNFPHLLAIVR-----NKSDDPADRRKRR  1095

 Score = 173 bits (439),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 155/280 (55%), Gaps = 46/280 (16%)

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
            MDK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   N
Sbjct  1    MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEK-----------------NNVDVNEIN  43

Query  61   AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
            AIL++ E +LRAKAE+VLNG+VN+S            +LPA+      + + +     A 
Sbjct  44   AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAIEAPGGKTSLSKFSSKLAQ  93

Query  121  KPRQMDASSI---PVEFFREQFRNNSVEIRQSLP-EPWERHFG---------IHHGRLMR  167
            K R++ A+       E     +R    E R   P EP ER            I  G L++
Sbjct  94   K-RELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVK  152

Query  168  KKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGS  227
            KKTT+  RLLP +N+TDP+ P+P+L EEDA+ GV NLVTRGFLP   D+TP F+      
Sbjct  153  KKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFT-----H  207

Query  228  GGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267
            G  V++    +IY+R+ Q V+S P+T  +G+N+ASLKFD+
Sbjct  208  GTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247

>CCA18898
Length=1147

 Score = 519 bits (1336),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 294/763 (39%), Positives = 454/763 (60%), Gaps = 46/763 (6%)

Query  373   KLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealrale  432
             K+  + +  +G N      S H F IH+G   R   +F SF+    ++W +VEE +  LE
Sbjct  362   KINTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLE  416

Query  433   tllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDR  492
              LL+ YF+P+A+++GQR+L L+       + R+LLSC+ NE +V  +L +PGQR++G ++
Sbjct  417   RLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEK  476

Query  493   KRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLE  552
               RAA  +++ +RM   RR Y    ++      IQ  WR Y+ + + K ++  +   +  
Sbjct  477   CTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDI  536

Query  553   KWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDS  612
              + + M +  S+W +I  +RR V+H+PS+S+D   R+  E F+IQQNLQL R+C A +D 
Sbjct  537   VFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLC-ALIDE  595

Query  613   NVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLY  672
             NVE L+Y+ PFELT D+ QY++KLLQL G+ D+  R+KL+ PE  +RFP+HFSLS+++L 
Sbjct  596   NVE-LIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLC  654

Query  673   SPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKRLL  732
             SPH ++R+  Y  G+ AYLV G PG ED+RLA  L +PILG  PA+   + T SG KR  
Sbjct  655   SPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCF  714

Query  733   IRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQA  792
              + + N   G+ +LYDE+E+  +LAKL  A+  Q   ++KLDYDP   G A+VD+S +Q+
Sbjct  715   KKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQS  774

Query  793   MRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVG  852
             ++ LR   RT +YWRQP  ++   + I+ E++   +++ +   +  E++P W+ F+ A+ 
Sbjct  775   IQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIR  832

Query  853   HFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGGGLN-  911
              +G V+E  P                  YVRANLF++P   V ISSTQ  L+      N 
Sbjct  833   MYGVVIEVCPKN-------------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHEND  879

Query  912   ---------------RKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVF  956
                             +T+ FTFPQT   +E +K A    G+ L +  + GY+S+DF+V 
Sbjct  880   DRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVI  939

Query  957   QDEKSNDAPRLWALAVHPFLTDSATSFACFHLLAR-GVLDTNSGVYRV--ANKSLTTANS  1013
              D+++ +   L+A+A+ PFLT+SA SF+ F  L+R G  ++ +G++ +  A  S    + 
Sbjct  940   LDDQTQNKI-LYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSD  998

Query  1014  GRKSESGSATDLLLREA----LLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRL  1069
                S S SATDL++REA    +++    +   R +V   YV +P+V T+ Y +FF  CR 
Sbjct  999   TPSSSSLSATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRS  1058

Query  1070  HGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLR  1112
              GV FD+ER +GT+FLLADSLTAGV GI+ I +T + AL   R
Sbjct  1059  RGVYFDIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCR  1101

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 139/281 (49%), Gaps = 31/281 (11%)

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaa---aveanaSPMR--HNAIVT---  52
            M++V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H ++     
Sbjct  26   MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  53   TAEVQAFNAILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAP---S  109
            + +++  + IL + E E++AK +L+  G  N     +       T LPAVT  + P   S
Sbjct  86   SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQ-------TGLPAVT--SPPRQVS  136

Query  110  IMHRSGYDK--ANKPRQMDASSIPVEFFREQFRNNSVEIRQSLPEPWERHFGIHHGRLMR  167
               +S  D+  + +  ++D +   +   ++ ++ +    +  L  P     G+   +  +
Sbjct  137  TTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKASK  196

Query  168  KKTTQHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFS-GTSDG  226
            K+     + LP+V     S  +  L ++ ++       T  FL +    +P+ S   S  
Sbjct  197  KRYNVSLKSLPAVQNGHASTSSSALADQSSE-------TAHFLNSRHG-SPLNSIEISQS  248

Query  227  SGGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267
            +    + QR  +++NR E+ +R+TP T +  +++ SLKFD 
Sbjct  249  TYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF  289

>CCI45122
Length=1105

 Score = 516 bits (1329),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 298/764 (39%), Positives = 446/764 (58%), Gaps = 49/764 (6%)

Query  389   DVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealraletllaQYFVPLAYVDGQ  448
             ++   + F+IH+G   R  PEF +F+R+   +W SV+  L AL  +L+ YF+P+AY++GQ
Sbjct  333   EISKTYDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQ  392

Query  449   RLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWL  508
             R+L LA       + ++L+SCI NED+V  +L +PGQR++G +R +RA   +++ +RM +
Sbjct  393   RILTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAM  452

Query  509   VRRRYARTRASDFNASKIQLAWRAYSCH--TSLKARLREVHLEKLEKWEKRMHNLKSHWP  566
              R+R+   R   +  + IQ  WR +S H  T LK   +  H E +  +   M +  S+W 
Sbjct  453   HRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMV--FTDSMRSFCSNWD  510

Query  567   QIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELT  626
             +I  +RR ++H+PS+S+D   R+  E F+IQQNLQL R+C A +D NVE L+Y+ PFELT
Sbjct  511   KIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLC-AVIDENVE-LIYICPFELT  568

Query  627   SDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTG  686
              D+ QY++KLLQLGG+ D+  R+KL+ PE  +RFP+HFSLSS++LYSP  L R+     G
Sbjct  569   DDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRG  628

Query  687   KEAYLVMGLPGAEDQRLAMALDlpilgappaqalpllTRSGGKRLLIRADVNVPNGTYEL  746
             + AY+V G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +L
Sbjct  629   RNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDL  688

Query  747   YDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYW  806
             YDE+E+  +LAKL  +H  Q   +++LDYDP   G A++D+S +Q+++E+R   +T E W
Sbjct  689   YDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESW  748

Query  807   RQPGPRDAAAKLILA-ELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTA  865
              QP      AKLI    LE    ++     +  EIFP  + F+ A+  +G ++E  P   
Sbjct  749   LQP---PIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK-  804

Query  866   IAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGG----------GLNR---  912
                            +VRANLF++P   V +SST  + +              GL++   
Sbjct  805   ------------RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASA  852

Query  913   ---KTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWA  969
                +T   TFPQT   +E +K A  A G+ L +  + GY+S+DFVV  D+++     L+A
Sbjct  853   AKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYA  911

Query  970   LAVHPFLTDSATSFACFHLLAR-GVLDTNSGVYRVANKSLTTANSGRKSESGSATDLLLR  1028
               + PFLT++A SFA F LL+R G  ++ +G   +  +            S SATDL++R
Sbjct  912   TGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIR  971

Query  1029  EALLAKSSLVG------ARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGT  1082
             EA L  S +V         R +    YV +P V T+  ++FF  CR  GV FD ER  GT
Sbjct  972   EARL--SGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGT  1029

Query  1083  LFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTI  1126
             +FLLADSLTAGVFGI+ I +T + AL+  R A+E I   AG+ +
Sbjct  1030  VFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKM  1073

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 127/287 (44%), Gaps = 58/287 (20%)

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaS--------PMRHNAIVT  52
            MD ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    ++  
Sbjct  1    MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  53   TAEVQAFNAILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMH  112
            + +++    IL + E E++AK +L+  G+ +     +       T LP V          
Sbjct  61   SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQ-------TGLPFV----------  103

Query  113  RSGYDKANKPRQMDASSIPVEFFREQFRNNSVE-IRQSLPEPWERHFGIHHGRLMRKKTT  171
                  A+ PRQ+ +S+      +  F+  SV+ IR+ L    E++  +         T 
Sbjct  104  ------ASPPRQIPSSANSSLERKSSFQELSVDLIRKQLHSVKEKYKCL--------PTK  149

Query  172  QHCRLLPSVNKTDPSVPT-------PELREEDAKHGVLNLVTRG----FLPAYADLTPVF  220
            QH  L+       P  PT       P  +  +A    L  V RG    F  A  D     
Sbjct  150  QHSELI------SPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIGEA  203

Query  221  SGTSDGSGGGVMKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267
            S T       V+ QR   ++NR E+ +++TP+T +  +N+ S+KFD 
Sbjct  204  SNTL-SVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  249

>PHYKE_8394
Length=428

 Score = 332 bits (850),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 177/222 (80%), Positives = 190/222 (86%), Gaps = 23/222 (10%)

Query  592  ENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKL  651
            ENFA+QQNLQLTR+CAAALDSNV+LL+YVSPFELT+DVSQYFLKLLQLGGL DSRPRVKL
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  652  VFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDlpi  711
            VFPEQ  RFP                       TGK+AYLVMGLPGAEDQRLA+ALDLPI
Sbjct  238  VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  712  lgappaqalpllTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLI  771
            LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HE+ AALAKLA+ HMDQPRWL+
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  772  KLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRD  813
            KLDYDPL VGEA++DLS MQAMRELRREKR PEYWRQPGPRD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 114/148 (77%), Gaps = 17/148 (11%)

Query  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHNAIVTTAEVQAFN  60
            M+K+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRH+ +          
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV----------  50

Query  61   AILQQTETELRAKAELVLNGMVnssssarnnqaqsGTLLPAVTVAAAPSIMHRSGYDKAN  120
                +TE ELRAKAELVLNGMVNSSS+ ++NQ Q GTLLPAVTV A PSI  R GYD   
Sbjct  51   ----KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  106

Query  121  KPR---QMDASSIPVEFFREQFRNNSVE  145
            KP+   + D  SIP+EFFRE+FRN++VE
Sbjct  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 1/37 (3%)

Query  894  VHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIK  930
            VH++STQNVLA+G G LNRKTVA+TFPQTAAP+EA+K
Sbjct  390  VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)

Query  369  AEMEKLGANVDKIRGYNELLDVYS  392
            AEME+LGANVDKIRGYNELLD Y+
Sbjct  154  AEMEELGANVDKIRGYNELLDAYT  177

>PYAR_13581
Length=730

 Score = 291 bits (746),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 208/305 (68%), Gaps = 28/305 (9%)

Query  371  MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVeealra  430
            M+ L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RA
Sbjct  81   MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRA  140

Query  431  letllaQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490
            LE LL +YF+                    F    LLSC+VNEDQV S+LRRPGQRYKG+
Sbjct  141  LEALLTRYFMA------------------SFPTSVLLSCVVNEDQVASLLRRPGQRYKGK  182

Query  491  DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
            DRKRRAATT++A  RM   R R+ R      +A++IQ  WR ++   SL+  L     E+
Sbjct  183  DRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQ  242

Query  551  LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610
            L  W+ +M  L+S W +I+ +RRVVVHVPSLSLDEH+R+  ++FA+QQNLQL R+ AA +
Sbjct  243  LRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-AAVV  301

Query  611  DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670
            D+ VE ++YVSPFEL +D+S          G+ ++  RVK+V PE    FP HFSL++ L
Sbjct  302  DATVEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQL  352

Query  671  LYSPH  675
            LYSPH
Sbjct  353  LYSPH  357

 Score = 172 bits (435),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 127/388 (33%), Positives = 174/388 (45%), Gaps = 109/388 (28%)

Query  783   AVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFP  842
             A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  +A P  +E FP
Sbjct  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446

Query  843   KWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDP-----DGSVHIS  897
              WR F  A+G  G V+EA+P                   VR N+FV P     D  V + 
Sbjct  447   DWRAFAQAIGRDGVVIEALPARVRGV-------------VRVNIFVTPASSDHDADVPVV  493

Query  898   STQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVW-GYVSLDFVVF  956
             STQ  L A  G   R  +AF  PQT  P++A+ GA  A G+LL E   + GY S+D  + 
Sbjct  494   STQEALRASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLC  550

Query  957   QDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTANSGRK  1016
             +DE S                         +LL    +DT++ +                
Sbjct  551   RDETSG-----------------------LYLLPSPAVDTSAPL----------------  571

Query  1017  SESGSATDLLLREA-LLAKSSL-----VGARRCFVACSYVFHPHVITMQYTAFFHACRLH  1070
                  AT L+L+EA LLA+SS        + RCFV+  +  HP++ TM   AFF ACR  
Sbjct  572   ---SPATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRR  628

Query  1071  GVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTIsvas  1130
             GVCFDV R                            A+ +LRTA EV+ RE GS+     
Sbjct  629   GVCFDVTRR---------------------------AMQYLRTAFEVLAREVGSST----  657

Query  1131  spsrsvasrsGNFAQILSAIRVSTGGGK  1158
                    S  GNF  +L+ +R   G  K
Sbjct  658   ------PSSDGNFGDVLALLRHRVGVEK  679

>SDRG_01714
Length=1233

 Score = 43.5 bits (101),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 56/121 (46%), Gaps = 19/121 (16%)

Query  490  RDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQ----------------LAWRAY  533
            R  K  AA  +++ VR+WL RRR+   +A + +  ++                 LAW  Y
Sbjct  508  RIEKEAAALMLQSNVRLWLARRRFLAAKAKEASHRRLVALFLGQRSAQRRRNTFLAW--Y  565

Query  534  SCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAEN  593
            S HT ++A L+     +L+ W +    L      +A RRRV+ HV +L L  H+    + 
Sbjct  566  SMHTHVRA-LKRASASRLQSWWRGRRALWEFRLAMAHRRRVLNHVEALVLGRHAHWRLQC  624

Query  594  F  594
            F
Sbjct  625  F  625

>H310_11272
Length=1799

 Score = 39.7 bits (91),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 3/40 (8%)

Query  494   RRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAY  533
             R+AATTI + +RM+L RRRY ++RA+     K+Q  WR++
Sbjct  1122  RKAATTIASGIRMFLARRRYRKSRAA---FVKLQARWRSF  1158

>PYVX_21078
Length=1475

 Score = 37.7 bits (86),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query  491  DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
            +R +RAA  +EA  R  L  R+Y +TRAS          WRA     +L+   R   ++ 
Sbjct  821  ERAKRAAIIVEAAFRTHLAMRQYRKTRASTIVVQTFVRRWRAQKLLVTLREEHRATQIQN  880

Query  551  LEKW---EKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTR  604
            + K     +R   L +   +I    R+ V V S ++ +  +   E+  ++  +QL +
Sbjct  881  VFKMYVARRRYVKLTTAIRKIQSVVRMFVAVRSFAVLQ--KQAKEDAKLENQIQLLK  935

>SPRG_21044
Length=1132

 Score = 37.7 bits (86),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 62/150 (41%), Gaps = 24/150 (16%)

Query  490  RDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQ----------------LAWRAY  533
            R  K  A   +++ VR WL RRR+   +A +    ++                  AW  Y
Sbjct  511  RHEKAAAVLVLQSNVRRWLARRRFLAAKAKEATHRRLLSLFLGQRSAQRRQATFFAW--Y  568

Query  534  SCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAEN  593
            + HT ++A  ++    +L+ W +    L      +A RRRV+ HV ++ L  H+    + 
Sbjct  569  TLHTHVRAS-KQASALRLQSWWRGRRALWEFRHAMAHRRRVLNHVEAMVLGRHAHWRLQC  627

Query  594  F-----AIQQNLQLTRVCAAALDSNVELLL  618
            F      + Q + L   CA  +   V  LL
Sbjct  628  FRHWTTYVAQRMVLKHQCATRIQRRVRGLL  657

>CCI46638
Length=1989

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 1/48 (2%)

Query  485   QRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNAS-KIQLAWR  531
             QRYK   R+++AATT+    R +L+R R  R R   +NA+ K+Q  +R
Sbjct  1067  QRYKRHIREKKAATTLTHWTRAYLIRTRVERHRRLQYNATLKLQKWYR  1114

>CCI49118
Length=1989

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 30/48 (63%), Gaps = 1/48 (2%)

Query  485   QRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNAS-KIQLAWR  531
             QRYK   R+++AATT+    R +L+R R  R R   +NA+ K+Q  +R
Sbjct  1067  QRYKRHIREKKAATTLTHWTRAYLIRTRVERHRRLQYNATLKLQKWYR  1114

>PHYRA_96309
Length=974

 Score = 35.4 bits (80),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  496  AATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLK  540
            AA TI++CVR WL RRR    + +  +A+++Q AWR  +    +K
Sbjct  127  AARTIQSCVRKWL-RRREHLLQLTVMHAARLQAAWRGRATRKQVK  170

>PHYSO_307452
Length=1214

 Score = 35.0 bits (79),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query  496  AATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARL  543
            AA TI+ CVR WL RRR    + +  +A+++Q AWR  +    +K  L
Sbjct  149  AARTIQRCVRKWL-RRRERILQPTVLHAARLQAAWRGRATRKRIKHEL  195

>PYAR_23813
Length=1097

 Score = 34.7 bits (78),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 19/23 (83%), Gaps = 0/23 (0%)

Query  492  RKRRAATTIEACVRMWLVRRRYA  514
            R+R+AAT I++ VR WLVRR Y+
Sbjct  676  RRRKAATVIQSFVRGWLVRREYS  698

>PHYSO_517698
Length=1911

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query  494   RRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550
             RR+  T++ CV  WL+ R++ R R +   + +IQ  WR++S     +A +  V + +
Sbjct  1184  RRSTRTLQYCVTSWLLCRQFRRARKA---SRRIQKTWRSHSRRVKWEAEVASVFVSR  1237

>PPTG_16221
Length=1259

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 22/43 (51%), Gaps = 3/43 (7%)

Query  494  RRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCH  536
            R+ A  ++  VR WL+RRRY R +        IQ  WR Y  H
Sbjct  698  RKYAIVLQKNVRCWLMRRRYLRQKQ---QIVVIQKYWRRYVVH  737

>CCA14389
Length=1187

 Score = 34.3 bits (77),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (46%), Gaps = 25/96 (26%)

Query  492  RKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSC----------------  535
            R+R AA  I+  +R +L R RY   RA +  A++ + A+R Y C                
Sbjct  760  RQRSAAIRIQCLLRCYLARTRYLSLRA-NHCAAQTETAYRKYHCCSNYRKLCVATIKIQS  818

Query  536  ----HTSLKA----RLREVHLEKLEKWEKRMHNLKS  563
                H ++K+    R++  +L KLEK     H+ +S
Sbjct  819  LHRMHVAIKSFRCLRIQAQNLAKLEKEAAMKHDSRS  854

>PYVX_21490
Length=2926

 Score = 34.3 bits (77),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 63/134 (47%), Gaps = 11/134 (8%)

Query  462   SKRELLSCIVNEDQVMSVLRRPGQRYKG-RDRKRRAATTIEACVRMWLVRRRYA----RT  516
             +K  +L C       +  +R+  +R +  R+RK +A  TI+ C+R W++RRR A    +T
Sbjct  998   AKETILRCWRRMQARLRRVRKQQERLRQQRERKDQAIRTIKQCLREWILRRRLAVAQRQT  1057

Query  517   RASDFNASKIQLAW-RAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQI-AGRRRV  574
             R + F   K  L W +A   H  + +  ++   E   K    +  L+  W Q  A R ++
Sbjct  1058  RQTMF---KENLKWTKAKRDHEKILSLEKKRRDELSSKLTSNLAELEQKWQQTDAERIKL  1114

Query  575   VVHVPSLSLDEHSR  588
               H   + L +H R
Sbjct  1115  AAHNEKV-LKQHQR  1127

>PYIR_20165
Length=1163

 Score = 33.9 bits (76),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (52%), Gaps = 12/77 (16%)

Query  483  PGQRYKGRDRKRR--AATTIEACVRMWLVRRRYARTRAS---------DFNASKIQLAWR  531
            PG R  GR ++R+  AAT I+ C R +L+R+ +   R+S          F+ ++ +  WR
Sbjct  15   PGWR-PGRKKRRQVLAATMIQKCFRSYLLRKAFHANRSSVTQSFQALRAFHHARDRRHWR  73

Query  532  AYSCHTSLKARLREVHL  548
            +   HT  +  LR V L
Sbjct  74   SVDLHTLKREELRLVAL  90

>CCA18434
Length=1985

 Score = 33.9 bits (76),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query  484   GQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNAS-KIQLAWR  531
              QRYK   R++RAATT+    R++L R R  R R    NA+ +IQ  +R
Sbjct  1063  NQRYKRYIREKRAATTLTHWTRVYLDRTREERHRRLQHNATLRIQKWYR  1111

>CCA18292
Length=1985

 Score = 33.9 bits (76),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query  484   GQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNAS-KIQLAWR  531
              QRYK   R++RAATT+    R++L R R  R R    NA+ +IQ  +R
Sbjct  1063  NQRYKRYIREKRAATTLTHWTRVYLDRTREERHRRLQHNATLRIQKWYR  1111

Lambda      K        H        a         alpha
   0.321    0.134    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 99069140142

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40