Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_184561475635135117320.0
PPTG_171271475635135116390.0
PHYSO_4715231475634835115350.0
PHYRA_811001475634935115330.0
PHYCA_5561621475635135115030.0
PHALS_064781475634535114460.0
PHYKE_83931475632635112792e-177
PYU1_G001735147563423529366e-125
PYIR_13451147563593638933e-118
PYAP_17762147563483588821e-116
PYIW_19971147563483648212e-107
PYVX_18171147562943418083e-106
PYAR_13570147563223257132e-91
CCA18899147563433396621e-83
CCI45123147563013185155e-62
SPRG_06336147563353374915e-58
SDRG_01781147563353364838e-57
H310_09223147563333384253e-48
H257_06294147563583554212e-47
CCI451271609872022112643e-26
PYAR_23286161286071191465e-09
HYAP_086451612815141171385e-08
PHYRA_849161612815411071361e-07
PHYSO_3617471612815231161342e-07
PYU1_G0063471612810951071323e-07
PYIW_17381161289521291296e-07
PPTG_188981612815591071298e-07
PITG_205621612815591071289e-07
CCI447521612815261251289e-07
SPRG_060581612812581301252e-06
PHYKE_19901612814991071234e-06
PYIR_215891612815681111226e-06
H257_067221612814821191208e-06
PYVX_204381612813461111209e-06
CCA188751612815141251191e-05
PHYKE_247914459171531112e-05
PYAP_169971612810181191153e-05
PYU1_G00106314459783351154e-05
PYAP_1729014459835361144e-05
PYIR_1530914459937361144e-05
PYIW_1317214459939351144e-05
H310_002311612814951121145e-05
SDRG_127621612813921181136e-05
SDRG_127631251091317361136e-05
PYAR_1991414459788351111e-04
H257_067211251091238401111e-04
PYVX_1357414459950351101e-04
CCI4122514459981351101e-04
H310_0023012510912481221101e-04
SPRG_0605912510913121361092e-04
PHALS_0653314459930351092e-04
PITG_1806714459924541082e-04
PPTG_1340114459927541083e-04
PHYRA_7783414459936341083e-04
CCA1648714459975351073e-04
CCI42457152926906351073e-04
PHYCA_503112152926214341033e-04
PYU1_G008848152677651331055e-04
CCA17102152926884351055e-04
PPTG_193711526711951661056e-04
PYIR_183821526711541331020.001
PHYSO_5445981526711631441020.001
PYIR_17453951126191121020.002
SDRG_00080124544298109990.002
CCI1048915870977737990.003
PITG_19213152671201143990.004
PHALS_04098152671183141980.004
PHYRA_82543152671199147980.004
PITG_11303931829334960.004
SPRG_16312131322261109950.005
PHALS_0669914313884133970.005
PHYSO_55616414313765135970.005
PYAP_18636152671009140970.006
PITG_1789314313747118960.007
PYIW_2110895112593130950.010
PYU1_G01081856695169110900.010
PPTG_0455314313904118950.010
PYIW_1987356695185123910.011
PHYRA_7353514313875135940.012
SPRG_0293995112161181940.013
H310_0091295112182123940.014
PYVX_18338241774649930.016
PYIW_1698715267821114930.017
PHYSO_3436291445997730920.018
PHYSO_344112241781337920.019
PHYCA_506137241781037920.020
PYVX_2334914313924112920.021
SPRG_143129639661133920.021
PPTG_05519241781037920.021
PHYRA_79281241780937920.022
PYIW_18480241775537920.022
PITG_02762241781037920.022
H310_063781445983735920.022
HYAP_08026241779837920.023
PHYRA_73534696861210118920.024
SDRG_055678195980156910.024
SPRG_091281431362030910.025
PYAP_22646241781537910.025
PYAR_15463152671091110910.026
H257_135671445983635910.026
CCA21715241778237910.027
CCA2186015507878237910.027
CCI3936728852046117910.027
PHALS_035401690479910.029
PYVX_13312152671016110910.031
SDRG_088001445988135900.032
H257_0982314313654110900.038
PHYKE_5678241780937900.040
SPRG_054491445972335890.041
PYAP_161619866188941890.042
SPRG_1702213189210739830.042
PYU1_G004386241783742890.046
CCA18023152671138114890.048
PYAP_2347885060897167890.051
CCI46235152671155114890.051
PHALS_03645241783042890.053
PYIR_2458885060909109890.054
SDRG_142861431367030880.059
PYIR_13120241781437880.061
PYAR_19883241783337880.061
SDRG_0140715267815119880.063
SPRG_060218195983110880.067
SPRG_119001660547870.071
H257_039319639695124870.074
PYU1_G0032291681045870.081
SPRG_0821716430687217870.082
SDRG_05150241778739870.088
SDRG_0487116430687217860.094
SPRG_08346241779739860.095
PYIW_2190185060913112860.097
H257_0517516430678121860.11
H310_0666713886889652860.11
H257_0336112342869961860.12
PITG_02109185352256850.12
H310_06666863288734850.14
SDRG_06927144484793850.14
SPRG_09805144483876850.15
H257_0309315267975110850.15
H310_048431526796834850.16
SPRG_0089015267883110850.16
H310_0466716430680121840.16
HYAP_0445715267120357840.19
H310_070709639680117840.19
H310_1362714313678110830.22
H257_02642640397551830.22
PPTG_14630185339856820.24
HYAP_061012885984113830.26
SDRG_062881664147830.26
H257_01308863289734830.28
PYAR_14615863251737820.28
PHYKE_491118534632720.30
PYAR_1929185060711128820.32
HYAP_0930413479114432820.34
PHYKE_666215267765110820.35
PHYKE_7856288534632810.35
H257_07514241781037820.35
H310_07701241781137820.36
PYVX_14593185096450820.37
PHYRA_9440928851270114820.39
PYIR_1316828851353110820.39
PHYKE_4910185237547800.42
SDRG_0560811092121127760.44
H257_06469219447630730.44
SPRG_01860863267433810.46
SDRG_08236863286433810.46
PHALS_06568185338856800.46
PITG_0210618501015147810.47
SPRG_0491212454426160790.48
CCI40991241780127810.49
PHYSO_2484812885128335810.51
PYU1_G0007249278718936780.51
PITG_033182885134335810.52
PPTG_160442885137835800.53
H310_140199204683164800.55
PYAR_157921109212142750.56
SPRG_025021109212163750.58
PHALS_06336185251156790.64
PYU1_G0128591850118365800.69
PYVX_1998216430700176790.70
PYVX_168828217970125790.71
PPTG_1898913479121332790.72
HYAP_137571151726231780.76
CCI420883199100734790.76
PYAP_1364715926671780.77
H257_081821685942790.80
H310_13911770036975780.81
PYU1_G00742385060928130790.81
SDRG_021352194430634780.82
H310_01921185334166780.82
H257_03363185331666780.84
PHYKE_1044863252139780.87
CCA1551328851341110790.88
PYAR_162289866186241780.89
PHYRA_8194413479114932790.89
PHYCA_504801185339856780.91
PHALS_0793013479120032780.92
CCI4379313479111733780.98
PYIR_1511813479122232781.1
PYU1_G0095089576532832771.1
SPRG_14955749063554771.1
SDRG_1448712342896460781.1
PITG_104628632102834781.2
PYAP_136951853348122771.2
PHYSO_55923412330154488781.2
PYAR_2606510677931460761.2
PHYSO_558498863296734771.2
PHYSO_478611185352256771.2
PYIR_2337215835141536771.3
PHALS_09729863294934771.3
PYIW_1891113479119632771.3
SPRG_0275212342883158771.3
PPTG_08785863294434771.3
PYU1_G0092499511258057771.4
SDRG_14070749063054771.4
PYIW_1961312330131471771.4
PYAP_22195863290134771.4
PHYCA_564296863295734771.4
CCA27255157810112568771.4
PHALS_055872885136136771.4
PHYRA_820408632105434771.4
PPTG_1171495112444126771.4
PYAP_184348965104256771.5
CCA17832103311125156771.5
PYIW_150141643070255761.5
PYAP_237441109212356721.5
SPRG_2139314760494111761.5
CCI434561109212639721.5
PYIW_219442885131734771.5
PYIR_144941681933761.5
PHALS_09273319966344761.6
PYIR_214731643066755761.6
PYVX_2343212330151060761.6
PHALS_0089682171010104761.6
H257_0130913886889533761.7
PYAR_166741643065155761.7
PYAR_134918195108030761.8
PYU1_G006732863295434761.8
PYVX_145276030126956761.9
PYVX_167148632103034761.9
PITG_175941408869455761.9
PYU1_G0122741583587336762.0
CCI45857863290531762.0
CCA191181109212545712.0
CCA23572863286831752.2
PYVX_14287319965238752.3
PHALS_063341850106436752.3
PHALS_125031151734031742.3
H310_14473749061330752.3
PYAR_233668366382841752.4
PYAP_167348195131432752.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18456

Length=351
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18456                                                            671        0.0   
PPTG_17127                                                            635        0.0   
PHYSO_471523                                                          595        0.0   
PHYRA_81100                                                           595        0.0   
PHYCA_556162                                                          583        0.0   
PHALS_06478                                                           561        0.0   
PHYKE_8393                                                            497        2e-177
PYU1_G001735                                                          365        6e-125
PYIR_13451                                                            348        3e-118
PYAP_17762                                                            344        1e-116
PYIW_19971                                                            320        2e-107
PYVX_18171                                                            315        3e-106
PYAR_13570                                                            279        2e-91 
CCA18899                                                              259        1e-83 
CCI45123                                                              202        5e-62 
SPRG_06336                                                            193        5e-58 
SDRG_01781                                                            190        8e-57 
H310_09223                                                            168        3e-48 
H257_06294                                                            166        2e-47 
CCI45127                                                              106        3e-26 
PYAR_23286                                                            60.8       5e-09 
HYAP_08645                                                            57.8       5e-08 
PHYRA_84916                                                           57.0       1e-07 
PHYSO_361747                                                          56.2       2e-07 
PYU1_G006347                                                          55.5       3e-07 
PYIW_17381                                                            54.3       6e-07 
PPTG_18898                                                            54.3       8e-07 
PITG_20562                                                            53.9       9e-07 
CCI44752                                                              53.9       9e-07 
SPRG_06058                                                            52.8       2e-06 
PHYKE_1990                                                            52.0       4e-06 
PYIR_21589                                                            51.6       6e-06 
H257_06722                                                            50.8       8e-06 
PYVX_20438                                                            50.8       9e-06 
CCA18875                                                              50.4       1e-05 
PHYKE_2479                                                            47.4       2e-05 
PYAP_16997                                                            48.9       3e-05 
PYU1_G001063                                                          48.9       4e-05 
PYAP_17290                                                            48.5       4e-05 
PYIR_15309                                                            48.5       4e-05 
PYIW_13172                                                            48.5       4e-05 
H310_00231                                                            48.5       5e-05 
SDRG_12762                                                            48.1       6e-05 
SDRG_12763                                                            48.1       6e-05 
PYAR_19914                                                            47.4       1e-04 
H257_06721                                                            47.4       1e-04 
PYVX_13574                                                            47.0       1e-04 
CCI41225                                                              47.0       1e-04 
H310_00230                                                            47.0       1e-04 
SPRG_06059                                                            46.6       2e-04 
PHALS_06533                                                           46.6       2e-04 
PITG_18067                                                            46.2       2e-04 
PPTG_13401                                                            46.2       3e-04 
PHYRA_77834                                                           46.2       3e-04 
CCA16487                                                              45.8       3e-04 
CCI42457                                                              45.8       3e-04 
PHYCA_503112                                                          44.3       3e-04 
PYU1_G008848                                                          45.1       5e-04 
CCA17102                                                              45.1       5e-04 
PPTG_19371                                                            45.1       6e-04 
PYIR_18382                                                            43.9       0.001 
PHYSO_544598                                                          43.9       0.001 
PYIR_17453                                                            43.9       0.002 
SDRG_00080                                                            42.7       0.002 
CCI10489                                                              42.7       0.003 
PITG_19213                                                            42.7       0.004 
PHALS_04098                                                           42.4       0.004 
PHYRA_82543                                                           42.4       0.004 
PITG_11303                                                            41.6       0.004 
SPRG_16312                                                            41.2       0.005 
PHALS_06699                                                           42.0       0.005 
PHYSO_556164                                                          42.0       0.005 
PYAP_18636                                                            42.0       0.006 
PITG_17893                                                            41.6       0.007 
PYIW_21108                                                            41.2       0.010 
PYU1_G010818                                                          39.3       0.010 
PPTG_04553                                                            41.2       0.010 
PYIW_19873                                                            39.7       0.011 
PHYRA_73535                                                           40.8       0.012 
SPRG_02939                                                            40.8       0.013 
H310_00912                                                            40.8       0.014 
PYVX_18338                                                            40.4       0.016 
PYIW_16987                                                            40.4       0.017 
PHYSO_343629                                                          40.0       0.018 
PHYSO_344112                                                          40.0       0.019 
PHYCA_506137                                                          40.0       0.020 
PYVX_23349                                                            40.0       0.021 
SPRG_14312                                                            40.0       0.021 
PPTG_05519                                                            40.0       0.021 
PHYRA_79281                                                           40.0       0.022 
PYIW_18480                                                            40.0       0.022 
PITG_02762                                                            40.0       0.022 
H310_06378                                                            40.0       0.022 
HYAP_08026                                                            40.0       0.023 
PHYRA_73534                                                           40.0       0.024 
SDRG_05567                                                            39.7       0.024 
SPRG_09128                                                            39.7       0.025 
PYAP_22646                                                            39.7       0.025 
PYAR_15463                                                            39.7       0.026 
H257_13567                                                            39.7       0.026 
CCA21715                                                              39.7       0.027 
CCA21860                                                              39.7       0.027 
CCI39367                                                              39.7       0.027 
PHALS_03540                                                           39.7       0.029 
PYVX_13312                                                            39.7       0.031 
SDRG_08800                                                            39.3       0.032 
H257_09823                                                            39.3       0.038 
PHYKE_5678                                                            39.3       0.040 
SPRG_05449                                                            38.9       0.041 
PYAP_16161                                                            38.9       0.042 
SPRG_17022                                                            36.6       0.042 
PYU1_G004386                                                          38.9       0.046 
CCA18023                                                              38.9       0.048 
PYAP_23478                                                            38.9       0.051 
CCI46235                                                              38.9       0.051 
PHALS_03645                                                           38.9       0.053 
PYIR_24588                                                            38.9       0.054 
SDRG_14286                                                            38.5       0.059 
PYIR_13120                                                            38.5       0.061 
PYAR_19883                                                            38.5       0.061 
SDRG_01407                                                            38.5       0.063 
SPRG_06021                                                            38.5       0.067 
SPRG_11900                                                            38.1       0.071 
H257_03931                                                            38.1       0.074 
PYU1_G003229                                                          38.1       0.081 
SPRG_08217                                                            38.1       0.082 
SDRG_05150                                                            38.1       0.088 
SDRG_04871                                                            37.7       0.094 
SPRG_08346                                                            37.7       0.095 
PYIW_21901                                                            37.7       0.097 
H257_05175                                                            37.7       0.11  
H310_06667                                                            37.7       0.11  
H257_03361                                                            37.7       0.12  
PITG_02109                                                            37.4       0.12  
H310_06666                                                            37.4       0.14  
SDRG_06927                                                            37.4       0.14  
SPRG_09805                                                            37.4       0.15  
H257_03093                                                            37.4       0.15  
H310_04843                                                            37.4       0.16  
SPRG_00890                                                            37.4       0.16  
H310_04667                                                            37.0       0.16  
HYAP_04457                                                            37.0       0.19  
H310_07070                                                            37.0       0.19  
H310_13627                                                            36.6       0.22  
H257_02642                                                            36.6       0.22  
PPTG_14630                                                            36.2       0.24  
HYAP_06101                                                            36.6       0.26  
SDRG_06288                                                            36.6       0.26  
H257_01308                                                            36.6       0.28  
PYAR_14615                                                            36.2       0.28  
PHYKE_4911                                                            32.3       0.30  
PYAR_19291                                                            36.2       0.32  
HYAP_09304                                                            36.2       0.34  
PHYKE_6662                                                            36.2       0.35  
PHYKE_7856                                                            35.8       0.35  
H257_07514                                                            36.2       0.35  
H310_07701                                                            36.2       0.36  
PYVX_14593                                                            36.2       0.37  
PHYRA_94409                                                           36.2       0.39  
PYIR_13168                                                            36.2       0.39  
PHYKE_4910                                                            35.4       0.42  
SDRG_05608                                                            33.9       0.44  
H257_06469                                                            32.7       0.44  
SPRG_01860                                                            35.8       0.46  
SDRG_08236                                                            35.8       0.46  
PHALS_06568                                                           35.4       0.46  
PITG_02106                                                            35.8       0.47  
SPRG_04912                                                            35.0       0.48  
CCI40991                                                              35.8       0.49  
PHYSO_248481                                                          35.8       0.51  
PYU1_G000724                                                          34.7       0.51  
PITG_03318                                                            35.8       0.52  
PPTG_16044                                                            35.4       0.53  
H310_14019                                                            35.4       0.55  
PYAR_15792                                                            33.5       0.56  
SPRG_02502                                                            33.5       0.58  
PHALS_06336                                                           35.0       0.64  
PYU1_G012859                                                          35.4       0.69  
PYVX_19982                                                            35.0       0.70  
PYVX_16882                                                            35.0       0.71  
PPTG_18989                                                            35.0       0.72  
HYAP_13757                                                            34.7       0.76  
CCI42088                                                              35.0       0.76  
PYAP_13647                                                            34.7       0.77  
H257_08182                                                            35.0       0.80  
H310_13911                                                            34.7       0.81  
PYU1_G007423                                                          35.0       0.81  
SDRG_02135                                                            34.7       0.82  
H310_01921                                                            34.7       0.82  
H257_03363                                                            34.7       0.84  
PHYKE_1044                                                            34.7       0.87  
CCA15513                                                              35.0       0.88  
PYAR_16228                                                            34.7       0.89  
PHYRA_81944                                                           35.0       0.89  
PHYCA_504801                                                          34.7       0.91  
PHALS_07930                                                           34.7       0.92  
CCI43793                                                              34.7       0.98  
PYIR_15118                                                            34.7       1.1   
PYU1_G009508                                                          34.3       1.1   
SPRG_14955                                                            34.3       1.1   
SDRG_14487                                                            34.7       1.1   
PITG_10462                                                            34.7       1.2   
PYAP_13695                                                            34.3       1.2   
PHYSO_559234                                                          34.7       1.2   
PYAR_26065                                                            33.9       1.2   
PHYSO_558498                                                          34.3       1.2   
PHYSO_478611                                                          34.3       1.2   
PYIR_23372                                                            34.3       1.3   
PHALS_09729                                                           34.3       1.3   
PYIW_18911                                                            34.3       1.3   
SPRG_02752                                                            34.3       1.3   
PPTG_08785                                                            34.3       1.3   
PYU1_G009249                                                          34.3       1.4   
SDRG_14070                                                            34.3       1.4   
PYIW_19613                                                            34.3       1.4   
PYAP_22195                                                            34.3       1.4   
PHYCA_564296                                                          34.3       1.4   
CCA27255                                                              34.3       1.4   
PHALS_05587                                                           34.3       1.4   
PHYRA_82040                                                           34.3       1.4   
PPTG_11714                                                            34.3       1.4   
PYAP_18434                                                            34.3       1.5   
CCA17832                                                              34.3       1.5   
PYIW_15014                                                            33.9       1.5   
PYAP_23744                                                            32.3       1.5   
SPRG_21393                                                            33.9       1.5   
CCI43456                                                              32.3       1.5   
PYIW_21944                                                            34.3       1.5   
PYIR_14494                                                            33.9       1.5   
PHALS_09273                                                           33.9       1.6   
PYIR_21473                                                            33.9       1.6   
PYVX_23432                                                            33.9       1.6   
PHALS_00896                                                           33.9       1.6   
H257_01309                                                            33.9       1.7   
PYAR_16674                                                            33.9       1.7   
PYAR_13491                                                            33.9       1.8   
PYU1_G006732                                                          33.9       1.8   
PYVX_14527                                                            33.9       1.9   
PYVX_16714                                                            33.9       1.9   
PITG_17594                                                            33.9       1.9   
PYU1_G012274                                                          33.9       2.0   
CCI45857                                                              33.9       2.0   
CCA19118                                                              32.0       2.0   
CCA23572                                                              33.5       2.2   
PYVX_14287                                                            33.5       2.3   
PHALS_06334                                                           33.5       2.3   
PHALS_12503                                                           33.1       2.3   
H310_14473                                                            33.5       2.3   
PYAR_23366                                                            33.5       2.4   
PYAP_16734                                                            33.5       2.4   
CCA25510                                                              33.5       2.4   
PHALS_01010                                                           33.5       2.4   
PHALS_08097                                                           33.5       2.5   
CCI42349                                                              33.5       2.6   
HYAP_06403                                                            33.5       2.6   
PHYRA_73430                                                           33.1       2.6   
PYAP_22685                                                            33.5       2.7   
PYIW_20891                                                            32.7       2.7   
PHYRA_72718                                                           33.1       2.7   
PHYRA_83071                                                           33.1       3.0   
CCA19033                                                              33.1       3.1   
CCA26890                                                              33.1       3.1   
H257_13346                                                            33.1       3.1   
PITG_07134                                                            33.1       3.1   
H310_02133                                                            33.1       3.1   
HYAP_07348                                                            33.1       3.2   
HYAP_11295                                                            33.1       3.3   
PHYCA_505441                                                          33.1       3.3   
H257_05679                                                            32.7       3.3   
H257_03095                                                            33.1       3.3   
PPTG_16174                                                            33.1       3.3   
SPRG_02753                                                            32.7       3.4   
SDRG_14771                                                            32.7       3.4   
HYAP_08248                                                            32.7       3.5   
SDRG_01408                                                            33.1       3.5   
PHYRA_84567                                                           32.7       3.5   
PYVX_13084                                                            33.1       3.6   
PYIW_23677                                                            30.8       3.6   
PITG_21026                                                            32.7       3.6   
SDRG_14486                                                            32.3       3.7   
PHYSO_304784                                                          32.7       3.7   
CCA22367                                                              32.7       3.8   
SPRG_00889                                                            32.7       3.8   
H257_09028                                                            32.7       3.8   
PHALS_02739                                                           32.7       4.3   
HYAP_13267                                                            32.7       4.5   
PHYCA_556081                                                          32.7       4.7   
PYIW_18491                                                            32.7       4.7   
PPTG_19135                                                            32.3       4.9   
PYIR_23012                                                            32.3       4.9   
PHYRA_73432                                                           32.3       4.9   
PYIW_17818                                                            32.3       5.2   
H310_05692                                                            32.3       5.2   
PHYKE_7347                                                            30.8       5.3   
PHALS_03335                                                           32.3       5.3   
PYIW_14463                                                            31.6       5.5   
PHALS_07062                                                           30.8       5.6   
PITG_13665                                                            30.8       5.6   
PHYSO_289146                                                          30.8       5.6   
PHYCA_510506                                                          30.8       5.7   
PPTG_09983                                                            32.3       5.8   
PPTG_19631                                                            30.8       5.9   
PHYSO_489872                                                          32.3       6.0   
PITG_16799                                                            32.3       6.1   
PYU1_G008119                                                          30.4       6.1   
PYAR_16120                                                            32.3       6.2   
PYIR_16539                                                            32.3       6.3   
CCA24531                                                              32.0       6.3   
SPRG_20275                                                            32.0       6.3   
PHYSO_506918                                                          32.0       6.3   
PYIR_15407                                                            30.4       6.3   
HYAP_02360                                                            30.4       6.3   
PYAP_24144                                                            32.0       6.3   
SDRG_17208                                                            32.3       6.3   
PYU1_G012858                                                          32.0       6.4   
PYIW_26522                                                            30.4       6.4   
PYVX_15906                                                            30.4       6.4   
PHYRA_85100                                                           30.4       6.5   
PHYRA_85097                                                           30.4       6.5   
PYAR_25500                                                            32.0       6.5   
HYAP_14013                                                            32.0       6.6   
PHYSO_478442                                                          32.0       6.7   
H310_01510                                                            32.0       6.8   
SDRG_12776                                                            32.0       6.9   
CCI47145                                                              31.6       6.9   
PPTG_19153                                                            32.0       7.2   
SDRG_15262                                                            32.0       7.3   
PPTG_14626                                                            32.0       7.5   
PHYKE_4241                                                            31.6       7.7   
H257_00729                                                            30.4       7.8   
PYU1_G012870                                                          31.6       7.9   
PYU1_G007013                                                          31.6       7.9   
SPRG_02495                                                            32.0       8.1   
PYIW_21526                                                            32.0       8.1   
PITG_20103                                                            32.0       8.3   
PHYSO_484541                                                          31.6       8.4   
PYAR_14218                                                            31.6       8.4   
PPTG_10755                                                            31.6       8.5   
H310_02582                                                            31.6       8.6   
PITG_09956                                                            31.6       8.8   
PYIR_22667                                                            31.6       8.8   
PITG_00416                                                            31.6       8.9   
H310_01094                                                            30.0       8.9   
PHYSO_349983                                                          31.6       9.1   
PPTG_13492                                                            31.6       9.2   
PYVX_19272                                                            31.6       9.3   
PITG_03652                                                            31.6       9.3   
PPTG_16659                                                            31.6       9.4   
PHYRA_84786                                                           31.6       9.5   
SDRG_02154                                                            31.6       9.6   
PPTG_07800                                                            30.4       9.6   
PHYCA_539981                                                          31.6       9.6   
H257_09269                                                            31.6       10.0  

>PITG_18456
Length=351

 Score = 671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/351 (100%), Positives = 351/351 (100%), Gaps = 0/351 (0%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PPTG_17127
Length=351

 Score = 635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/351 (93%), Positives = 336/351 (96%), Gaps = 0/351 (0%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPEHG TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP G+PSAPKG FYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVARNAL  KRQLTRQAIDQSVSP KK LFGFSV+LSPQPAMSPQKQ+QTL+KS
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDELLS+ALRELEAAKLVGREACNEIV+QGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLHLFSDDSRPKSTG SKGSSPQR HQSGGSSP+RLPPA + SSDAG SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAE+LNGEA  SSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYSO_471523
Length=348

 Score = 595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/351 (84%), Positives = 317/351 (90%), Gaps = 3/351 (1%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNL VSYYESRAAC
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP G+PSAPKG FYLSSIEPHEYVVGVMGAA+KPFGFKMVGHAP+KGYVELDVFV+TL 
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVARNAL AKRQLTRQAIDQSVSP +KNLFGF++SLSPQP MSPQKQ+QTL+KS
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +DELLS ALR++EAAK VGREACNEIV QGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLHLFSDDSRPK++ S   S  +         P RLPPA++  +DAGVSDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKASASKASSPQRSQQ---SGRPPRLPPAMDSINDAGVSDLERLAQALGE  297

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAELLNGEAGR +QQIERIEH L+NVT RVEKQTKQASA L +GPRLF
Sbjct  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PHYRA_81100
Length=349

 Score = 595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/351 (84%), Positives = 319/351 (91%), Gaps = 2/351 (1%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLV++GSNLQ+SYYESRAAC
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP  +PSAPKG FYLSSIEPHEYVVGVMGAA KPFGFKM+GHAPKKGYVELDVFV+T  
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVARNAL AKRQLTRQAIDQSVS  KKNLFGF VSLSPQP M+PQKQ+QTL+++
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KDELLS ALR++EAAKLVGREACNEIV+QGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLHLFSDDSRPKST S   S  +      G SP+RLPPA+E  +DAGVSDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTASKGHSPQRSQQS--GGSPSRLPPAMETINDAGVSDLERLAQALGE  298

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAE+LNGEAGRS+QQIER+EH L+NVT RVEKQTKQASATL AGP+LF
Sbjct  299  LEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PHYCA_556162
Length=351

 Score = 583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/351 (85%), Positives = 320/351 (91%), Gaps = 0/351 (0%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE GA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HP  G+ S PKG FYLSSIEPHEYVVGVMGAA KPFGFKMVGHAPKKGYVELDVFV+T+ 
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVARNAL AKRQLTRQAIDQSVSP KKNLFGFSVSLSPQPA+SPQKQ+QTL+K+
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            KD+LLS ALR++EAAK +GREACNEIV+QGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLH+FS+DSRPKST SSK +SPQRS QSGGSSPTRL  A E   D G SDLERLAQALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LE+QAELLN EAG S+QQI+ IEHHL+ VT RVEKQTKQASATL AGPRLF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHALS_06478
Length=345

 Score = 561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/351 (80%), Positives = 305/351 (87%), Gaps = 6/351 (2%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP G+ + PKG FYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVSP KK LFGFSV  S QP MSPQKQ+QTL+ S
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            K+ LL +ALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLH FSDD         K       H SG +SP+RL PA+EI+ DAGVSDL+RLAQALGE
Sbjct  241  TLHFFSDD------TRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LEVQAELLN E+G SSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  295  LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PHYKE_8393
Length=326

 Score = 497 bits (1279),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 262/351 (75%), Positives = 291/351 (83%), Gaps = 25/351 (7%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            MNILRVPE GATASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
            HPP G+  A KG FYLS+I PHEYVVGVMGAADKPFGFKMVGHAP+KGYVELDVFV+TL+
Sbjct  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95

Query  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
            DRNKWLEVARNALGAKRQ+ RQAIDQSVSP KK +FGF +SLSPQP + PQKQIQ L+ +
Sbjct  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  155

Query  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            K+ELL++ALRELEAAK+VGREACNEIVVQGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  156  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215

Query  241  TLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300
            TLHLFSDD+RPKS  +S  SSPQR+HQS GS+P  LP ++  ++DA  SDLERLA ALGE
Sbjct  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  275

Query  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            LE+QAELLNGEAGRS+QQI RIE  L+NVT RVEKQTKQASATLSAGPRLF
Sbjct  276  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYU1_G001735
Length=342

 Score = 365 bits (936),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 250/352 (71%), Gaps = 18/352 (5%)

Query  1    MNILRVPEHGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQVSY+ESR A
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  60   CHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119
             H P    + PKG FY+SS+E HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FV++L
Sbjct  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  120  ADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSK  179
             D NKWLEV +NAL A ++LTR+ +  S     K++FGF  S+SPQ       Q++ L+ 
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVKKLAA  167

Query  180  SKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239
            +K+ELL +ALRE+E AKL+GREA NEIV QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  240  PTLHLFSDDsrpkstgsskgsspqrshqsGGSSP---TRLPPALEISSDAG-VSDLERLA  295
            P LH+FS+D+R K    +  ++      S  +SP   T      +I+   G ++DLE LA
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  296  QALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAG  347
             AL ELE QA L+N EA RS++QI RIE  LT+V  RV+ QTK+A+AT+ AG
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYIR_13451
Length=359

 Score = 348 bits (893),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 237/363 (65%), Gaps = 23/363 (6%)

Query  1    MNILRVPEHGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV+YY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  55   ESRAACHPPIGQPS----APKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYV  110
            ESR A              PKG FY+SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  111  ELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSP  170
            ELD+FV++L D NKW+EV +NAL A ++ +R    Q  S   K +FGFS S SPQ     
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNST-TKTMFGFSASASPQL----  175

Query  171  QKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFG  230
              Q++ L+ +K++LL  ALRE+E AKL+GREA NEIVVQGEKLD +E DL  ++ DLD  
Sbjct  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  231  DKLLRRLKSPTLHLFSDDsrpks------tgsskgsspqrshqsGGSSPTRLPPALEISS  284
            DKLLR +K P LHLFS D R K              +         +  T     +    
Sbjct  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQR  293

Query  285  DAGVSDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATL  344
            +  +SDLE+LA ALGELE QA L+N EA +S++QI R+E  LT V  RV+ QTK+A+AT+
Sbjct  294  NDALSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATM  353

Query  345  SAG  347
             AG
Sbjct  354  KAG  356

>PYAP_17762
Length=348

 Score = 344 bits (882),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/358 (51%), Positives = 250/358 (70%), Gaps = 25/358 (7%)

Query  1    MNILRVPEHGATA----------SGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            MNILR+P  GAT+               +PTSCEGYVTKRGHFRKSWRVRFLV++G++L 
Sbjct  1    MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  59

Query  51   VSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYV  110
            VSYY+S+          + PKG FYLSS+E HEY VGV+GA +KPFGFKMVGHAP+KGYV
Sbjct  60   VSYYDSKEVARTA---GAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  116

Query  111  ELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSP  170
            ELD+FV+TL D NKWLEV +NAL A ++LTR    ++++P  K+LFGFS      PA SP
Sbjct  117  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSP  168

Query  171  QKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFG  230
            Q+Q++ ++ +K+++L QA+ E+E+AKL+GR AC EI +QGE+LD I Q+L+ ++ DLD+ 
Sbjct  169  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYA  228

Query  231  DKLLRRLKSPTLHLFSDDsrpkstgsskgsspqrshqsGGSSPTR---LPPALEISSDAG  287
            DKLLR +K+P LH+FS D+R ++  + +     R   S  S  TR   L  + +    A 
Sbjct  229  DKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAP  288

Query  288  VSDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLS  345
            +SD+ERLA  LGELE QA LLN EA + + Q+ER+   L +V  RV+ QT++A+A+++
Sbjct  289  LSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASIA  346

>PYIW_19971
Length=348

 Score = 320 bits (821),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/364 (50%), Positives = 239/364 (66%), Gaps = 36/364 (10%)

Query  1    MNILRVPE------HGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            MNILRVP+      HG+   GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ +  
Sbjct  1    MNILRVPDMKLATSHGS--GGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGG  58

Query  55   ESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDV  114
               +         + PKG F++SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+ELD+
Sbjct  59   GGASP--------ATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110

Query  115  FVDTLADRNKWLEVARNALGAKRQLTRQ--AIDQSVSPGKKNLFGFSVSLSPQPAMSPQK  172
            FV+TL D NKW+EV +NAL A ++ TR   A D S +   KN+FGFS ++SPQ       
Sbjct  111  FVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTT---KNMFGFSATVSPQL------  161

Query  173  QIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDK  232
            Q++ L+ +K+ELL  ALRE+E AKL+GREA ++I  QG KL+ IE DL  ++ DLD G K
Sbjct  162  QVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGK  221

Query  233  LLRRLKSPTLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSDAG-----  287
            LL  +K P LHLFS+D+R K      GS         G+ P+    + E ++ A      
Sbjct  222  LLNHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQ  281

Query  288  ----VSDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASAT  343
                +SDLERL  ALGELE QA  +N EA +S++QI R+E  LT V  RV+ QTK+A+AT
Sbjct  282  DTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATAT  341

Query  344  LSAG  347
            + AG
Sbjct  342  MKAG  345

>PYVX_18171
Length=294

 Score = 315 bits (808),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/341 (52%), Positives = 216/341 (63%), Gaps = 64/341 (19%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSS  78
            RPTSCEGYVTKRGHFRKSWRVR+LV+DG++L+V+Y+ES+ A        +A KG FYLSS
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  65

Query  79   IEPHEYVVGVMGAA---DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGA  135
            I+ H YV G MGA    +KPFGFKMVGHAPKKGY ELD+FV+TLAD  KWLEVA NAL +
Sbjct  66   IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125

Query  136  KRQLTRQAI-DQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEA  194
               ++R+A  D   S   K+LFGFS +       SPQ+Q++ +S SKDELL  ALRELE 
Sbjct  126  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  179

Query  195  AKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkst  254
            AKL+GREAC E+VVQGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL + D      
Sbjct  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDL-----  234

Query  255  gsskgsspqrshqsGGSSPTRLPPA----LEISSDAGVSDLERLAQALGELEVQAELLNG  310
                                R PP+    L  + D G + LE+L                
Sbjct  235  --------------------RRPPSPTKTLSNAGD-GRAALEQL----------------  257

Query  311  EAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
                S+QQI RIE  LT V  RV++QTKQA++ +  G  +F
Sbjct  258  ----STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYAR_13570
Length=322

 Score = 279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 217/325 (67%), Gaps = 27/325 (8%)

Query  36   SWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKP  95
            SWRVR+LV++G++L VSY++S+     P    ++PKG FYLSS+E HEYVVGV+GA  KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTP---GASPKGSFYLSSVEKHEYVVGVLGAQKKP  64

Query  96   FGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNL  155
            FGFKMVGHAP+KGYVELD+FV++  D  KWLEV ++AL A ++LTR  +  + S   K+L
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122

Query  156  FGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQG-----  210
            FGFS      PA SPQKQIQ LS SK+ELL QA+ E+E+AKL+GREAC EIVVQG     
Sbjct  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176

Query  211  ----------EKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstgsskgs  260
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K++ S   S
Sbjct  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHS  236

Query  261  spqrshqsGGSSPTRLPPALEISSDAG-VSDLERLAQALGELEVQAELLNGEAGRSSQQI  319
              +    +  S+         +   +G +SD+ERLA  LGELE QA LLN EA R + Q+
Sbjct  237  PVKSKQSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQV  296

Query  320  ERIEHHLTNVTTRVEKQTKQASATL  344
            ER+   L ++  RV+ QTK+A + +
Sbjct  297  ERVGDALAHINERVQNQTKKADSAV  321

>CCA18899
Length=343

 Score = 259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 203/339 (60%), Gaps = 17/339 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QVSYYES+ +      + + PKG F L S 
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSK---SKNATPKGSFILQSA  71

Query  80   EPHEYVVGVM---GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
            E HEY +  M      +KPFGFKMVGHAPK+GY+ELDVFVD+ +D ++WL+V  N L A 
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  137  RQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAK  196
            + + R+A    +    K++ GFS         + ++QIQ L   K + + +AL+++E AK
Sbjct  132  KCMAREAFMAEMDT-TKSVLGFSY-----IGTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185

Query  197  LVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFS----DDsrpk  252
              G  AC+EIV QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS     D    
Sbjct  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATI  245

Query  253  stgsskgsspqrshqsGGSSPTRLPPALEISSDAGVSDLERLAQALGELEVQAELLNGEA  312
            S  SS   S         +   R    L        +D+E+LA AL +LEVQA+L+N EA
Sbjct  246  SKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEA  305

Query  313  GRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
             +S++QI RIE  L+ +  R++ QT Q   T S    LF
Sbjct  306  VKSNEQIARIEGQLSGINDRIQAQTSQV-ITSSGKQNLF  343

>CCI45123
Length=301

 Score = 202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/318 (37%), Positives = 179/318 (56%), Gaps = 32/318 (10%)

Query  49   LQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVM---GAADKPFGFKMVGHAP  105
            +QVSYYES+ +      + + PKG F L ++E HEY +  M      ++PFGFKMVGHAP
Sbjct  1    MQVSYYESKDSYK---NRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57

Query  106  KKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQ  165
            K+GYVELDVFVD+L++ ++WL+V  N L A +++ R+A    +    K + GFS +    
Sbjct  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDT-TKGVLGFSFA----  112

Query  166  PAMSPQKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDR  225
               + ++Q++ L   K + + +AL+++E AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171

Query  226  DLDFGDKLLRRLKSPTLHLFSDDsrpkstgsskgsspqrshqsGGSSPTRLPPALEISSD  285
            DL+  +KL++ ++ P  + FS                   + +   S       L +  +
Sbjct  172  DLNHSEKLIKSIRHPLRYFFS-------KTHHHEKDAMSKNNTNHRSHHHQTGILHMRKN  224

Query  286  AG------------VSDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRV  333
             G             +DLE+LA AL ELEVQA+L+N EA +S+ QI RIE  L+ +  R+
Sbjct  225  DGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRI  284

Query  334  EKQTKQASATLSAGPRLF  351
            + QT Q  A+ S    LF
Sbjct  285  QSQTTQVVAS-SGKKNLF  301

>SPRG_06336
Length=335

 Score = 193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 130/337 (39%), Positives = 194/337 (58%), Gaps = 30/337 (9%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP--KGIFYL  76
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSYY+S+      I +   P  KG F L
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKT-----IYKSDKPKEKGSFIL  63

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NALG  
Sbjct  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--  119

Query  137  RQLTRQA-IDQSVSP--GKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELE  193
            + +T QA +DQ  S   G +   GF   L+  P      Q++ ++K+K+ELL +A+  LE
Sbjct  120  KNVTPQASVDQRASALLGHRAPSGF---LTSAPV-----QLRNVNKTKEELLRKAIVTLE  171

Query  194  AAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpks  253
             A+ VG    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS     K 
Sbjct  172  HARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKK  231

Query  254  tgsskgsspqrshqsGG--SSPTRLP---PALE---ISSDAGVSDLERLAQALGELEVQA  305
               S  S   RSHQ     +SPT      PA +    ++DAG  +L++L++ L  LEV A
Sbjct  232  GTGSPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHA  291

Query  306  ELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASA  342
              ++ E  R+++QI+RI+  +     R+ +Q+ +  A
Sbjct  292  NTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 190 bits (483),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 190/336 (57%), Gaps = 28/336 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP--KGIFYL  76
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSY++S+      I +   P  KG F L
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT-----IYKSDKPKEKGSFIL  63

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NALG K
Sbjct  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG-K  120

Query  137  RQLTRQAIDQSVSP--GKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEA  194
                + + DQ  +   G +   GF   L+  P      Q++ ++K+K+ELL +A+  LE 
Sbjct  121  NVAPQASADQRATALLGHRAASGF---LTSAPV-----QLRNVNKTKEELLRKAIVTLEH  172

Query  195  AKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkst  254
            A+ VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS     K  
Sbjct  173  ARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKG  232

Query  255  gsskgsspqrsh--qsGGSSPTRLPPALEIS------SDAGVSDLERLAQALGELEVQAE  306
              S  S   RSH  Q+  +SPT   P+   S      +DAG  +L++L++ L  LEV A 
Sbjct  233  AGSPKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHAN  292

Query  307  LLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASA  342
             ++ E  R+++QI+RI+  +     RV +Q+ +  A
Sbjct  293  TISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H310_09223
Length=333

 Score = 168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/338 (32%), Positives = 173/338 (51%), Gaps = 22/338 (7%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76
            K   TSCEGYVTKRGH  K+W+ R++V+ G  L V+YY+S+            PKG F L
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI----YKSNGPPKGSFVL  62

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
            S  E  +  +   G + KPFGFK +GH P +GY E  VFV+T  D+ KWL VA NALG  
Sbjct  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  137  RQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAK  196
              +   +++     G K   G  +SL        + QI+ + K+  ELL QA+ + + A 
Sbjct  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172

Query  197  LVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstgs  256
             +G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+     K +  
Sbjct  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKR  232

Query  257  skgsspqrshqsGGSS-PTRLPPALEIS-------SDAGVSDLERLAQALGELEVQAELL  308
             K  +  +    G S+  +R+P  +++               L+ L++ L +L   A+ +
Sbjct  233  GKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTI  292

Query  309  NGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346
            +    R+++Q++RI+  +T+V  RV K+ K   + L A
Sbjct  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>H257_06294
Length=358

 Score = 166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 183/355 (52%), Gaps = 31/355 (9%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76
            K   TSCEGYVTKRGH  KSW+ R++V++G  L VSYY+S+            PKG F L
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI----YTSKGHPKGSFVL  62

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+V++  D+ KWL VA NALG  
Sbjct  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  137  ---RQLTRQAIDQSVSP-----------GKKNLFGFSVSLSPQPA---MSPQKQIQTLSK  179
               ++   Q I++   P            ++++   +     + A    S + Q++ + K
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  180  SKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239
            +  ELL QA+ + + A  +G    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  240  PTL----HLFSDDsrpkstgsskgsspqrshqsGGSSPTRL---PPALEISSDAGVSD-L  291
            P L    HLF+     K  G    +    +  S  S  +R+   PP  + ++     D L
Sbjct  241  PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL  300

Query  292  ERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSA  346
            ++L++ L +L   A+ ++    R+++Q++RI+  +T+V  RV+K+ K   A L A
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>CCI45127
Length=202

 Score = 106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/211 (33%), Positives = 109/211 (52%), Gaps = 25/211 (12%)

Query  153  KNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEK  212
            K + GFS +       + ++Q++ L   K + + +AL+++E AK  G  AC+EIV QGE+
Sbjct  5    KGVLGFSFA-----GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQ  59

Query  213  LDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDsrpkstgsskgsspqrshqsGGSS  272
            L  +EQ+LS I+ DL+  +KL++ ++ P  + FS                   + +   S
Sbjct  60   LGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFS-------KTHHHEKDAMSKNNTNHRS  112

Query  273  PTRLPPALEISSDAG------------VSDLERLAQALGELEVQAELLNGEAGRSSQQIE  320
                   L +  + G             +DLE+LA AL ELEVQA+L+N EA +S+ QI 
Sbjct  113  HHHQTGILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQIT  172

Query  321  RIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351
            RIE  L+ +  R++ QT Q  A+ S    LF
Sbjct  173  RIEGQLSGINDRIQSQTTQVVAS-SGKKNLF  202

>PYAR_23286
Length=607

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 20/119 (17%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ V+ GS+  VSYY      + P G+P A   
Sbjct  379  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLA---  433

Query  73   IFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                      E V+  +   D +PFGF  +       Y    V+ D   +R KW+   R
Sbjct  434  ----------EVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALR  478

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W++R+ V+ G+ L+
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  221

 Score = 34.7 bits (78),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEGY+T+RGH   S R  + V++G++L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>HYAP_08645
Length=1514

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 21/117 (18%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL +SYY      +   G+P A          
Sbjct  305  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLA----------  352

Query  80   EPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGA  135
               E +V  + + D +PFGF  + +     Y    V+ D   +RNKW+  A N L A
Sbjct  353  ---EVLVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWMN-ALNKLNA  401

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            CEGY+TKRGH   +W+ R+  + G+ L+  YY
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  142

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            SCEGY+TKRGH   S R+ + V++G++L     Q +Y E+++A
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  249

>PHYRA_84916
Length=1541

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 50/107 (47%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  402  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLA----------  449

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                 V  V     +PFGF  + +     Y    V+ D   +RNKW+
Sbjct  450  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWM  490

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  241

 Score = 38.9 bits (89),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>PHYSO_361747
Length=1523

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 53/116 (46%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  411  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLA----------  458

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGA  135
                 V  V     +PFGF  +       Y    V+ D   +RNKW+  A N L A
Sbjct  459  --EVLVEDVQKWDGEPFGFMFMTTEQVPYY----VYADNDRERNKWMN-ALNKLNA  507

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  250

 Score = 38.9 bits (89),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>PYU1_G006347
Length=1095

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 50/107 (47%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL +SYY      +   G+P A          
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKPLAEVA-------  442

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                 V  V     +PFGF  +        V   V+ D   +RNKW+
Sbjct  443  -----VEDVQKWDGEPFGFMFM----TSEQVPYYVYADNDRERNKWM  480

 Score = 38.9 bits (89),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W+ R+ V+ G  L+
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE  227

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            SCEGY+T+RGH   S R+ + V++G++L     Q +Y ++++A
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA  336

>PYIW_17381
Length=952

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 63/129 (49%), Gaps = 25/129 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL ++Y+      +   G+P        L+ +
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKP--------LAEV  452

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQL  139
                 V  V     +PFGF  +        V   V+ D   +RNKW+    NAL   R+L
Sbjct  453  T----VEDVQKWDGEPFGFMFMTSE----QVPYYVYADNDRERNKWM----NAL---RKL  497

Query  140  TRQAIDQSV  148
            T  A + +V
Sbjct  498  TTVAEEPTV  506

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W+ R+ V+ G+ L+
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE  238

 Score = 38.1 bits (87),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 5/42 (12%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            CEGY+T+RGH   S R+ + V++G++L     Q +Y E+++A
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  347

>PPTG_18898
Length=1559

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  405  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  452

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                 V  V     +PFGF  + +     Y    V+ D   +R KW+
Sbjct  453  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM  493

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  244

 Score = 38.9 bits (89),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

>PITG_20562
Length=1559

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G+   +SYY      +   G+P A          
Sbjct  406  PVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLA----------  453

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                 V  V     +PFGF  + +     Y    V+ D   +R KW+
Sbjct  454  --EVLVEDVQKWDGEPFGFMFMTNEQVPYY----VYADNDRERTKWM  494

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

 Score = 38.9 bits (89),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

>CCI44752
Length=1526

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (45%), Gaps = 18/125 (14%)

Query  6    VPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
            V  H  T + +   P +C GY+TK+GH RKSW+ R+ ++ G+   +SYY+     +   G
Sbjct  401  VSNHSNTTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNAKG  458

Query  66   QPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
            +         L+ ++    V  V     + FGF  +       Y    V+ D   +R KW
Sbjct  459  KA--------LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW  502

Query  126  LEVAR  130
            +   R
Sbjct  503  MSALR  507

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            EGY+TKRGH   +W+ RF V+ G+ L+  YY S
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSS  253

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEGY+T+RGH   S RV + V+ G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

>SPRG_06058
Length=1258

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 60/130 (46%), Gaps = 19/130 (15%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76
            K  P +C G++TK+GH RKSW+ R+ V+ G+ L  SYY    A +   G+         L
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  192

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
            S +   +  VG        F F  + + P        VF D   D+ KW+   + A+GA 
Sbjct  193  SDVSLKD--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGAD  244

Query  137  RQLTRQAIDQ  146
              L  + ID+
Sbjct  245  -TLAIETIDE  253

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 11/66 (17%)

Query  3   ILRVPE--HGATASG-------DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
           +LRV E  HGA A           ARP  CEGY+TKRGH   S+R+R+ V+ GS   V Y
Sbjct  18  VLRVRELQHGARALAPGARRLLHCARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKY  75

Query  54  YESRAA  59
           Y    A
Sbjct  76  YSDETA  81

>PHYKE_1990
Length=1499

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 48/107 (45%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ ++ GS   +SYY      +   G+  A          
Sbjct  403  PVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALA----------  450

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                 V  V     +PFGF  +       Y    V+ D   +RNKW+
Sbjct  451  --EVLVEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM  491

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  242

 Score = 38.5 bits (88),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            SCEGY+TKRGH   S R+ + V++G++L+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

>PYIR_21589
Length=1568

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 50/111 (45%), Gaps = 18/111 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ ++ G NL ++YY      +   G+  A          
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRALA----------  450

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                 V  V     +PFGF  +       Y    V+ D   +RNKW+   R
Sbjct  451  --EVTVEDVQKWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALR  495

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++TKRGH   +W+ R+ V+ G+ L+
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE  238

 Score = 38.1 bits (87),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            SCEGY+T+RGH   S R+ + V++G++L     Q +Y ++++A
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRDNQSA  347

>H257_06722
Length=1482

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 20/119 (17%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKG  72
            A+    +P +C G++TK+GH RKSW+ R+ V+ G+ L  +YY    A +   G+P     
Sbjct  342  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLG---  396

Query  73   IFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                      E  V  + A D +P GF  + +     Y    VF D   D+ KWL   R
Sbjct  397  ----------EVTVREVSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALR  441

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            CEGY+TKRGH   S+R+R+ V+ GS ++  YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  285

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 26/44 (59%), Gaps = 3/44 (7%)

Query  13   ASGDKARPTS--CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            AS D + P+     GY+TKRGH   +W+ RF V+     ++SYY
Sbjct  143  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  185

>PYVX_20438
Length=1346

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 52/111 (47%), Gaps = 18/111 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ ++ G++  +SY+      +   G+         L+ +
Sbjct  316  PVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKA--------LAEV  365

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                 V  V     +PFGF  +       Y    V+ D   +RNKW+   R
Sbjct  366  T----VEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALR  408

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  Y+ S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

 Score = 38.1 bits (87),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 5/43 (12%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNL-----QVSYYESRAA  59
            SCEGY+TKRGH   S R+ + V+ G+ L     Q +Y E+++A
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  260

>CCA18875
Length=1514

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (45%), Gaps = 18/125 (14%)

Query  6    VPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
            V  H  T + +   P +C GY+TK+GH RKSW+ R+ ++ G+   +SYY+     +   G
Sbjct  401  VFNHTNTLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANHVKG  458

Query  66   QPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
            +         L+ ++    V  V     + FGF  +       Y    V+ D   +R KW
Sbjct  459  KA--------LAEVQ----VEDVQKWDGEAFGFMFMTTEQVPYY----VYADNERERKKW  502

Query  126  LEVAR  130
            +   R
Sbjct  503  MSALR  507

 Score = 40.8 bits (94),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            EGY+TKRGH   +W+ RF V+ G+ L+  YY S
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSS  253

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEGY+T+RGH   S RV + V+ G+ L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

>PHYKE_2479
Length=171

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 7/53 (13%)

Query  5    RVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            R P   +T+S  K      EGYVTKRGH  ++W++RF  ++G NL VSYYE++
Sbjct  62   RPPHSNSTSSRSK-----WEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>PYAP_16997
Length=1018

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 20/119 (17%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ V+ G++  ++Y+      +   G+  A   
Sbjct  392  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKALA---  446

Query  73   IFYLSSIEPHEYVVGVMGAAD-KPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
                      E +V  +   D +PFGF  +        V   V+ D   +R KW+   R
Sbjct  447  ----------EVIVEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  491

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEG++TKRGH   +W++R+ V+ G+ L+
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE  234

 Score = 35.0 bits (79),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            +CEG++T+RGH   S R  + V++G++L+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>PYU1_G001063
Length=783

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYES+ 
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKV  179

>PYAP_17290
Length=835

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
             EGYVTKRGH  ++W++RF  ++G+NL  SYYE++ 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  185

>PYIR_15309
Length=937

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
             EGYVTKRGH  ++W+ RF  ++G+NL  SYYES+ 
Sbjct  147  WEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

>PYIW_13172
Length=939

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYES+ 
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  182

>H310_00231
Length=1495

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (46%), Gaps = 18/112 (16%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSS  78
            +P +C G++TK+GH RKSW+ R+ V+ G+ L  +YY    A +    +P     +  +S+
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASNMRHSRPLGEVTVREVST  405

Query  79   IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVAR  130
             +             +P GF  V        V   VF D   D+ KWL   R
Sbjct  406  WD------------GEPGGFMFV----TNDNVPYYVFADNERDQAKWLTALR  441

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 23/28 (82%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEGY+TKRGH   S+R+R+ V+ G++++
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            GY+TKRGH   +W+ RF V+     ++SYY
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  185

>SDRG_12762
Length=1392

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 56/118 (47%), Gaps = 18/118 (15%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76
            K  P +C G++TK+GH RKSW+ R+ V+ G+ L  SY+    A +  +G     K +  +
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLG-----KALSEV  406

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALG  134
            S  +   +   V G     F F  + + P        VF D   D+ KW+   + A+G
Sbjct  407  SVKDVAPWDGEVCG-----FMFVTLENVPYY------VFADNERDQAKWMTALKKAVG  453

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            P  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  292

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            GY+TKRGH   +W+ RF  +  S  ++SYY
Sbjct  164  GYLTKRGHVITNWKTRFFALR-SQGRLSYY  192

>SDRG_12763
Length=1317

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 2/36 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            +P SC GY+TK+GH RKSW+ R+ V+ G+ L  SYY
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY  253

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 29/136 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            C GY+TKRGH   +W+ RF V+    + + YY   +     +GQ        +L  + P 
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADDSMVK-KLGQ-------VHLVKVAPW  60

Query  83   EYVVGVMGAA---------DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL-------  126
            EY     G +         +  FGF M     +  Y    V+ +  A+R +WL       
Sbjct  61   EYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLY  116

Query  127  EVARNALGAKRQLTRQ  142
             V  NA   +  LT++
Sbjct  117  VVTSNATDCEGYLTKR  132

>PYAR_19914
Length=788

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W+ RF  ++G+NL  SYYE++ 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKV  178

>H257_06721
Length=1238

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            G   +P +C GY+TK+GH RKSW+ R+ V+ GS L  SYY
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 34/62 (55%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
           C GY+TKRGH   +W++R+ V+   +  +SYYE  +     +GQ        +L+ + P 
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYEDESMAK-KLGQ-------VHLAKVAPW  64

Query  83  EY  84
           EY
Sbjct  65  EY  66

>PYVX_13574
Length=950

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G NL VSYYES+ 
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESKV  191

>CCI41225
Length=981

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G+ L  SYYES+ 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKV  172

>H310_00230
Length=1248

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 52/122 (43%), Gaps = 21/122 (17%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIF  74
            G   +P +C GY+TK+GH RKSW+ R+ V+ G+ L  SYY             SA K   
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYYTDYE---------SANKQCL  266

Query  75   YLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALG  134
                IE  +   G M       GF          Y    V+ DT  +R KWL   +  L 
Sbjct  267  AEVGIEDVQVWDGEM------HGFMFTTTEQVMYY----VYADTERERQKWLVALKALLD  316

Query  135  AK  136
            A+
Sbjct  317  AQ  318

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
           C GY+TKRGH   +W++RF V+   +  +SYYE  +         S   G  +L+ + P 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESM--------SKKLGQVHLAKVAPW  62

Query  83  EY  84
           EY
Sbjct  63  EY  64

>SPRG_06059
Length=1312

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 56/136 (41%), Gaps = 29/136 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            C GY+TKRGH   +W+ RF V+    +   Y +   A    +GQ        +L  + P 
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMA--KKLGQ-------VHLVKVAPW  62

Query  83   EYVVGVM---------GAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL-------  126
            EYV             G+ +  FGF M     +  Y    V+ +  A+R KWL       
Sbjct  63   EYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDLY  118

Query  127  EVARNALGAKRQLTRQ  142
             V  NA   +  LT++
Sbjct  119  VVTSNATDCEGYLTKR  134

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 2/36 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            +P SC GY+TK+GH RKSW+ R+ V+ G  L  +YY
Sbjct  222  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY  255

>PHALS_06533
Length=930

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  143

>PITG_18067
Length=924

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   ATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  90   SMSSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PPTG_13401
Length=927

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 8/54 (15%)

Query  11   ATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            + +SGD A  +        EGYVTKRGH  ++W++RF  ++G NL VSYYE++ 
Sbjct  90   SMSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PHYRA_77834
Length=936

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EGYVTKRGH  ++W++RF  ++G NL VSYYE++
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  150

>CCA16487
Length=975

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYVTKRGH  ++W++RF  ++G+ L  SYYE++ 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKV  170

>CCI42457
Length=906

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYV KRGH  ++W++RF  ++G+  +VSYYES+ 
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKG  162

>PHYCA_503112
Length=214

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EGYVTKRGH  ++W+ RF  ++G NL VSYYE++
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>PYU1_G008848
Length=765

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (46%), Gaps = 28/133 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY----ESRAACHPPIGQPSAPKGIFYLSSI  79
            EGYV K+G +   W  R+LV+DG+ L  +YY    E+R+A +         +G   +S +
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  183

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--GAKR  137
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+  G K 
Sbjct  184  RPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKH  231

Query  138  QLTRQAIDQSVSP  150
             +   ++D  V P
Sbjct  232  SVNGNSMDSDVVP  244

>CCA17102
Length=884

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            EGYV KRGH  ++W++RF  ++G+ L  SYYES+ 
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKG  142

>PPTG_19371
Length=1195

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 69/166 (42%), Gaps = 26/166 (16%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            M+ L V    A+           EGYV K+G +   W  R+L++DG+ L  +YY S+   
Sbjct  48   MDDLLVDSSTASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  105

Query  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120
                      +G   +S + P  Y         K  GF +      +G+    +   T  
Sbjct  106  RSARNL----RGRMIISKVRPENY--------GKAHGFLI----ETQGHKHFHLCCTTEL  149

Query  121  DRNKWLEVARNAL--GAKRQLTR------QAIDQSVSPGKKNLFGF  158
            +++ W+E+ + A+  G +   +R      +A+    SP + +L GF
Sbjct  150  EKDMWVEMMQAAIEEGVRHAHSRLSMEGMEALQMQTSPTQVDLRGF  195

>PYIR_18382
Length=1154

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 28/133 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY----ESRAACHPPIGQPSAPKGIFYLSSI  79
            EGYV K+G +   W  R+LV+DG+ L  +YY    E+R+A +         +G   +S +
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  178

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--GAKR  137
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+  G K 
Sbjct  179  RPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKH  226

Query  138  QLTRQAIDQSVSP  150
             L   ++D    P
Sbjct  227  SLNGSSVDPETLP  239

>PHYSO_544598
Length=1163

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 27/144 (19%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  72

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL------GAKR  137
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+      GA  
Sbjct  73   Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  120

Query  138  QLT---RQAIDQSVSPGKKNLFGF  158
            +++    +A+    SP + +L GF
Sbjct  121  RVSMEGMEALQMQASPTQVDLRGF  144

>PYIR_17453
Length=2619

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 7/112 (6%)

Query  23    CEGYVTKRGHFR-KSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEP  81
             CEGYV  R HF   +WR RF V++ + L + Y ++ AA      Q +  K    ++  + 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL-YPDTSAALSEGREQKALEKHDL-IAVKKW  2217

Query  82    HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             H      +G     FGF++   A   GY+E  V ++   ++ KWL    NA+
Sbjct  2218  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIED--EQTKWLAAITNAV  2265

>SDRG_00080
Length=298

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 24/109 (22%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P +  GYV K+G F K+W+ R++V+    L   YY S  A        + P+G F     
Sbjct  70   PPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT-------TKPRGFF-----  115

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYV------ELDVFVDTLADR  122
                 V G+  A D P G    G   ++         E D + DTL++R
Sbjct  116  ----RVTGIAYAPDLPHGLIADGTGTRRLKFTLADNDECDAWYDTLSER  160

>CCI10489
Length=777

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ KRGH  +SWR RF V+ G+ L  SYY S+
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PITG_19213
Length=1201

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/143 (24%), Positives = 63/143 (44%), Gaps = 26/143 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   ++ + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEAR----SARNLRGRMIINKVRPEN  124

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--GAKRQLTR  141
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+  G +   +R
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  142  ------QAIDQSVSPGKKNLFGF  158
                  +A+    SP + +L GF
Sbjct  173  LSMEGMEALQLQTSPTQVDLRGF  195

>PHALS_04098
Length=1183

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 65/141 (46%), Gaps = 24/141 (17%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +  + P  
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNM----RGRMTVYKVRPEN  128

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL--GAKRQLTR  141
            Y         K  GF +   + K    +  +   T  +++ W+E+   A+  GA+++ +R
Sbjct  129  Y--------GKAHGFLLETQSHK----QFHLCCATELEKDMWVEMMHAAVEEGARQRNSR  176

Query  142  QAID----QSVSPGKKNLFGF  158
             +++      +SP + +L GF
Sbjct  177  LSVEGMEILQISPTQVDLRGF  197

>PHYRA_82543
Length=1199

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 64/147 (44%), Gaps = 26/147 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   +S + P  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  114

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTR--  141
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+    + T+  
Sbjct  115  Y--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAIEEGVRHTQSS  162

Query  142  ------QAIDQSVSPGKKNLFGFSVSL  162
                  +A+    SP + +L GF ++ 
Sbjct  163  MSMEGMEALQMQSSPTQVDLRGFYLAF  189

>PITG_11303
Length=293

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            CEGY+TKRGH   +W+ R+  + G+ L+  YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

>SPRG_16312
Length=261

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 24/109 (22%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
            P    GYV K+G F K+W+ RF+V+    L   YY S  A        + P+G F ++S 
Sbjct  38   PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTS-  87

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYV------ELDVFVDTLADR  122
                    V  A D P G    G   ++         E D + DTL++R
Sbjct  88   --------VAYAPDLPHGLIADGTGTRRLRFTLADSDECDAWYDTLSER  128

>PHALS_06699
Length=884

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 56/133 (42%), Gaps = 14/133 (11%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPK  71
            T++ D A   S  G++ KRGH  K+W+ R+ V+  S L+   Y S A C    G+     
Sbjct  325  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEV----  377

Query  72   GIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
             + +      H   V V G  D  F  + VG         L +  + L+DR  W+    +
Sbjct  378  -LLFHPQTCVHYVDVHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIED  430

Query  132  ALGAKRQLTRQAI  144
            AL  +     Q +
Sbjct  431  ALLCRDSYQNQQV  443

>PHYSO_556164
Length=765

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    G+      + +
Sbjct  214  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCSKLKGEV-----LLF  265

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGA  135
                  H   V V G  D  F  ++    P      L +    L DR  W+    +AL  
Sbjct  266  HPQTRVHYVDVHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDALLC  319

Query  136  KRQLTRQAIDQSVSP  150
            +     Q + +   P
Sbjct  320  RDSYHPQGMTEGPEP  334

>PYAP_18636
Length=1009

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 59/140 (42%), Gaps = 26/140 (19%)

Query  13   ASGDKARPTSC------EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQ  66
            ASG    PT        EGYV K+G +   W  R+LV+DG+ L  +YY ++         
Sbjct  86   ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR----S  139

Query  67   PSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWL  126
                +G   +S + P  Y         K  GF +       G+    +   T  +++ W+
Sbjct  140  GRNLRGRMIISKVRPENY--------GKAHGFLLE----TMGHKHFHLCCSTELEKDMWV  187

Query  127  EVARNAL--GAKRQLTRQAI  144
            E+ + A+  G K +L R  I
Sbjct  188  EMMQAAIDEGVKHKLERSLI  207

>PITG_17893
Length=747

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 52/118 (44%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    G+      + +
Sbjct  212  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEV-----LLF  263

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                  H   V V G  D  F  + VG      Y  L +    L DR  W+    +AL
Sbjct  264  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  315

>PYIW_21108
Length=2593

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 10/130 (8%)

Query  6     VPEHGATASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVVDGSNLQVSYYESRAACHPPI  64
             + +   ++ G  A+    EGYV  R HF  + WR RF V++G+ L + Y +S AA     
Sbjct  2139  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDR  2197

Query  65    GQPSAPKGIFYLSSIEP-HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRN  123
              + +  K    L ++E  H      +G+  + FGF++   A   GY+E    V T  ++ 
Sbjct  2198  ERTALEK--HDLIAVEKWHPTYSANLGSGSR-FGFRVENEA--GGYLECT--VTTEDEQT  2250

Query  124   KWLEVARNAL  133
             KWL V  +A+
Sbjct  2251  KWLAVVSDAV  2260

 Score = 32.3 bits (72),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 24/124 (19%), Positives = 53/124 (43%), Gaps = 12/124 (10%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGY+ KRG    + + R+ V+ G+ L  +YY +   C     + + P+ +  +      +
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKGTML--AYYTNEDEC----KRQATPRDVLEVVQARDWD  55

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQA  143
                +       F    +G A  + +       D+L D+  W++  ++AL    ++ +  
Sbjct  56   GASALRQHYKHAFEIDYLGGATYQCH------CDSLEDKQLWMQAIQHALDEPNRIVQDE  109

Query  144  IDQS  147
            I+ +
Sbjct  110  IEDA  113

>PYU1_G010818
Length=169

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 53/110 (48%), Gaps = 5/110 (5%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EG++TK+GH  ++ + R+ V+    L     +        + QPS  KG+  L++ +   
Sbjct  62   EGFLTKKGHVLRTQKERYFVLRQHTLSYFRVKQSEKKAKSVIQPSTLKGVLELTASD---  118

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             +V     +D+ F  + +  A  K Y +LD+   +  +R +W++  R  +
Sbjct  119  -IVTPAPHSDQWFRIQKLPDAEGKIY-KLDLKASSQTERQEWIDALRATI  166

>PPTG_04553
Length=904

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 52/118 (44%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y + ++C    G+      + +
Sbjct  355  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGE-----VLLF  406

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                  H   V V G  D  F  + VG      Y  L +    L DR  W+    +AL
Sbjct  407  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  458

>PYIW_19873
Length=185

 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 60/123 (49%), Gaps = 9/123 (7%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH--PPIGQPSAPKGIFYLSSIEP  81
            EG++ K+GH  ++ + R+ V+    L  SY+ ++       P   PS+ KG+  L+  + 
Sbjct  56   EGFLVKKGHVLRTQKERYFVLRAHTL--SYFRAKWGEKKGKPAMLPSSLKGVLELAPSD-  112

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTR  141
               +V     +D+ F  + +  A  K Y +LD+ V    +R +W++  R A      L +
Sbjct  113  ---IVTPAPHSDQWFRIQKLPDAGGKSY-KLDLKVANAEERQEWIDAIRGACRNTLLLKQ  168

Query  142  QAI  144
            QA+
Sbjct  169  QAM  171

>PHYRA_73535
Length=875

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 55/135 (41%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y +  +C    G+      + +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEV-----LLF  384

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGA  135
                  H   V V G  D  F  ++    P+     L +    L DR  W+    +AL  
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDALLC  438

Query  136  KRQLTRQAIDQSVSP  150
            +     Q +     P
Sbjct  439  RDSYHPQGMTSGPGP  453

>SPRG_02939
Length=2161

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 84/181 (46%), Gaps = 26/181 (14%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI--  79
            + EGY+ K+GHF  + + +++V+ G++L   +Y S  A    + + +A  G   ++S+  
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLRGNHL--FFYASYDAY---MAKTTADVGCSQVASVGD  518

Query  80   -EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLE-----VARNAL  133
             + H  ++        PF  + V HA      ++     T ++++KW+      +A++A+
Sbjct  519  WDGHTLLLTY----PHPFRIETVAHA------QVLCSAPTASEKDKWMRGLRAAIAKHAI  568

Query  134  GAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELE  193
            GAK   T  + D  + P  + L     S   +   +    I TL K  D   SQ L  L+
Sbjct  569  GAK---TSTSSDVVLDPAVQALQTLLSSYYNEHNPTKHDDIPTLLKLFDGRESQLLSHLD  625

Query  194  A  194
            A
Sbjct  626  A  626

>H310_00912
Length=2182

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 63/123 (51%), Gaps = 18/123 (15%)

Query  24    EGYV-TKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
             EG+V  +R HF  +W+  + V+ G  L  + Y++R       G+P++ + + ++      
Sbjct  1797  EGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKREVVFVG-----  1849

Query  83    EYVVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW---LEVARNALGAKRQ  138
             ++  GV  G A   F  + +    + G+VE   +VD  AD+ +W   L+ A ++L A + 
Sbjct  1850  DWYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLKADQL  1903

Query  139   LTR  141
             +TR
Sbjct  1904  VTR  1906

>PYVX_18338
Length=746

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query  9    HGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            HG   S + A  T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  70   HG---SIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>PYIW_16987
Length=821

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 26/114 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY----ESRAACHPPIGQPSAPKGIFYLSSI  79
            EGYV K+G +   W  R+LV+DG+ L  +YY    E+R+A +         +G   +S +
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  169

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  170  RPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>PHYSO_343629
Length=977

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
            EGYVTKRGH  ++W++RF  ++G+ +  ++
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>PHYSO_344112
Length=813

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYCA_506137
Length=810

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PYVX_23349
Length=924

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 50/112 (45%), Gaps = 14/112 (13%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEP  81
            S  G++ K GH RK+W+ R+ V++ S L+    ESR+     +        + +  +   
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRLKGEV--------LLFHPATRV  495

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            H   + + G  D  F  + VG      Y  L +  + L+DR  W+    +AL
Sbjct  496  HYVDIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>SPRG_14312
Length=661

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query  3    ILRVPEHGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH  61
            I   P+H   A   D   P S  G + K+ +  K+W+ RF+V+ G +L   YY S AA  
Sbjct  90   ITSFPDHNPEAECPDFYAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYYVSGAA--  145

Query  62   PPIGQPSAPKGIFYLSSIEPHEYVVGVMGAA--DKPFGFKMVGHAPKKGYVELDVFVDTL  119
                + S PKG+  L  +E     V ++  A   K F F++        Y  L +     
Sbjct  146  ---SEDSYPKGLISLVGVE-----VQLVDVARFKKQFCFEL----SHPYYRPLYLMAKNE  193

Query  120  ADRNKWLEVARNA  132
            AD  +W+   ++A
Sbjct  194  ADLTQWMSCIKSA  206

>PPTG_05519
Length=810

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYRA_79281
Length=809

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>PYIW_18480
Length=755

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EGYV K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>PITG_02762
Length=810

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>H310_06378
Length=837

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V K+GH  ++W+VR+  ++G+ L  SYYE++
Sbjct  58  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>HYAP_08026
Length=798

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>PHYRA_73534
Length=1210

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFY  75
            D A   S  G++ KRGH RK+W+ R+ V++ S L+   Y +  +C    G+      + +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGE-----VLLF  384

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
                  H   V V G  D  F  ++    P+     L +    L DR  W+    +AL
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDAL  436

>SDRG_05567
Length=980

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 40/156 (26%), Positives = 68/156 (44%), Gaps = 30/156 (19%)

Query  13   ASGDKARPTS-------CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
            AS   A+PT+         GY++KRG +RK+W+ R+ ++   +  + Y +S       +G
Sbjct  118  ASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLE-LVG  176

Query  66   QPSAPKGIFYLSSIEPHEYVV-GVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNK  124
            Q   P        I P+  V+   +G    PF F++  H P++    L +   T+ +  K
Sbjct  177  Q--VP--------ITPNTRVIDNSIGCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRK  221

Query  125  WLEVARNA--LGAKRQLTRQAIDQSV----SPGKKN  154
            W+   R    L   R++    + QS     SP   N
Sbjct  222  WIRSIRETVELVRSREIGENYVTQSCVVRPSPTDTN  257

>SPRG_09128
Length=620

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            G++ K GH RKSW+ RF V+DGS LQ  YY
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  295

>PYAP_22646
Length=815

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>PYAR_15463
Length=1091

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG+ L  +YY S+             +G   +S + P  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGRNL----RGRMIISKVRPEN  131

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  132  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>H257_13567
Length=836

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V K+GH  ++W+VR+  ++G+ L  SYYE++
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>CCA21715
Length=782

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCI39367
Length=2046

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 23/117 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            G++ K+GH  KSWRVRF V+  DG+   ++YY  R       G     +GI  +  I+  
Sbjct  86   GWLRKQGHLWKSWRVRFFVLYTDGT---LAYYRKRGDVKMK-GYIKLNEGIIGIQYIDAW  141

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQL  139
            +         ++ + F++     +KG+  L     T  +   W+ V R+     RQL
Sbjct  142  K--------TNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSVLRST----RQL  181

>PHALS_03540
Length=904

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query  4   LRVPEHGATASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACH  61
           L+       A+G  AR + C+  G+  K+G   KSW+ RF V+ G  L   Y+E R+   
Sbjct  23  LKATSRNVIAAGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERS---  77

Query  62  PPIGQPSAPKGIFYLSSIE  80
            P G+    KG   +S +E
Sbjct  78  -PSGKGIDEKGRLRISGVE  95

 Score = 32.3 bits (72),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++ KRG     W+ R+ ++ G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>PYVX_13312
Length=1016

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 49/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+L++DG+ L  +YY S+             +G   LS + P  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGRNL----RGRMQLSRVRPEN  129

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+
Sbjct  130  Y--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>SDRG_08800
Length=881

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V+K+GH  ++W++R+  ++ SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>H257_09823
Length=654

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (43%), Gaps = 8/110 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEY  84
            G++ K GH RK+W+ RF V+DGS LQ  Y+        P  +    KG   L   +   +
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLLFHKDTTVH  322

Query  85   VVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             V + +   D  F  +  G     G   L +   +L +R  W+     A+
Sbjct  323  YVDIHLTGRDYTFAVETSG-----GDYSLVLQAASLDEREDWIFAIEEAI  367

>PHYKE_5678
Length=809

 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ V+ G  +  SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSK  134

>SPRG_05449
Length=723

 Score = 38.9 bits (89),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG+V+K+GH  ++W++R+  ++ SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PYAP_16161
Length=889

 Score = 38.9 bits (89),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPI  64
           EGY+ K+G   K W+ R+ V DG  L  SYY SR    P +
Sbjct  30  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKPSV  68

>SPRG_17022
Length=107

 Score = 36.6 bits (83),  Expect = 0.042, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYU1_G004386
Length=837

 Score = 38.9 bits (89),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            D    T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>CCA18023
Length=1138

 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (45%), Gaps = 26/114 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY----ESRAACHPPIGQPSAPKGIFYLSSI  79
            EGYV K+G +   W  R+LV+DG+ L  +YY    E+R+A           +G   +  +
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSA--------RNLRGKMMIVKV  174

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  175  RPENY--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  216

>PYAP_23478
Length=897

 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 72/167 (43%), Gaps = 27/167 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKG--IFYLSSIEPH  82
            G++ K GH RK+W++R+ V+D S L+  YY             +  KG  + +  + + H
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGM--------TRLKGEVLLFHPATQVH  429

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKR---QL  139
               +      D  F  ++    P+     L +  + LADR  W+    +AL  +    Q 
Sbjct  430  YVDIHESRGKDHTFAIQV---GPE---YTLLLQAERLADRENWMYCIEDALLCRDSYLQD  483

Query  140  TRQAIDQSVSPGKKNLFG-----FSVSL-SPQPAMSPQKQIQTLSKS  180
             ++A D   S  ++  F      FS+S  SP   ++P   +   SKS
Sbjct  484  PKRAQDVRESVARRRNFSSESILFSLSTGSPHDGINPMNMVMLHSKS  530

>CCI46235
Length=1155

 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (45%), Gaps = 26/114 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY----ESRAACHPPIGQPSAPKGIFYLSSI  79
            EGYV K+G +   W  R+LV+DG+ L  +YY    E+R+A           +G   +  +
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSA--------RNLRGKMMIVKV  169

Query  80   EPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  170  RPENY--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>PHALS_03645
Length=830

 Score = 38.9 bits (89),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            D    T  EGY+ K+GH  +SWR R+ V+ G+    SYY S+
Sbjct  96   DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  135

>PYIR_24588
Length=909

 Score = 38.9 bits (89),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 48/109 (44%), Gaps = 14/109 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEY  84
            G++ K GH RK+W+ R+ V++ S L+    ES A     +        + +  +   H  
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARLKGEV--------LLFHPATRVHYV  463

Query  85   VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             + + G  D  F    VG    K Y  L +  D L+DR  W+    +AL
Sbjct  464  DIHLSGGKDCTFAIH-VG----KDYALL-LQADQLSDRENWMYCIEDAL  506

>SDRG_14286
Length=670

 Score = 38.5 bits (88),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            G++ K GH RK+W+ RF V+DGS LQ  YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>PYIR_13120
Length=814

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  +SWR R+ ++ G+    SYY S+
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>PYAR_19883
Length=833

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            T  EGY+ K+GH  ++WR R+ ++ G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  134

>SDRG_01407
Length=815

 Score = 38.5 bits (88),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (44%), Gaps = 18/119 (15%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIF  74
            G  A     EGYV K+G +   W  R+LV+DG++L  +YY ++             +G  
Sbjct  76   GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR----SGRNLRGRM  129

Query  75   YLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             ++ + P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  130  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  176

>SPRG_06021
Length=983

 Score = 38.5 bits (88),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEY  84
            GY++KRG +RK+W+ R+ ++   +  + Y +S       +GQ   P        I P+  
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLE-LVGQ--VP--------ITPNTR  187

Query  85   VV-GVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            V+   +G    PF F++  H P++    L +   T+ +  KW+   R  +
Sbjct  188  VIDNSIGCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETV  232

>SPRG_11900
Length=605

 Score = 38.1 bits (87),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 3/47 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
            +P  C GY+ K+G   K+WR R+  +DG + Q+SY ++  A  PP G
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDADGA--PPKG  277

 Score = 34.7 bits (78),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPP  63
            G+V K+G   KSW+ RFLVV G +  V+YY+   + H P
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQGRH--VTYYDR--SVHEP  41

>H257_03931
Length=695

 Score = 38.1 bits (87),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 54/124 (44%), Gaps = 14/124 (11%)

Query  9    HGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPS  68
            H      D   PTS  G + K+ +  K+W+ RF+V+ G ++   YY S  +      + +
Sbjct  97   HDGHHESDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTS-----SEET  149

Query  69   APKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEV  128
             P+G+  LS ++ H           K F F+ + H     Y  L +     AD  +WL  
Sbjct  150  FPRGVISLSGVDVHPLDTAKFK---KQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSS  202

Query  129  ARNA  132
             ++A
Sbjct  203  IKSA  206

>PYU1_G003229
Length=810

 Score = 38.1 bits (87),  Expect = 0.081, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  11   ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            AT +      T   G++ K+GH  KSW+ RF VV+GS   ++Y+E
Sbjct  388  ATVTSGSDSGTRKTGWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            CEG++ KRG    +W+ RF  ++G  LQ
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 41/84 (49%), Gaps = 9/84 (11%)

Query  9   HGATASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQ  66
           +   A G  A+ T C+  G+ +K+G   KSW+ R+ V+ G  L   Y+  R+    P G+
Sbjct  13  NNVIAVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERS----PSGK  66

Query  67  PSAPKGIFYLSSIE-PHEYVVGVM  89
               KG   +  +E   E+  G++
Sbjct  67  GINEKGRLKIVGVEFTPEFTNGLL  90

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (46%), Gaps = 25/129 (19%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKG  72
            AS D + P  C G++ K G   K+W++R+  + G+ L  +Y++S      P+        
Sbjct  693  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKSDKG---PL--------  738

Query  73   IFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
               L +++    V  V+    K F  ++     +K    L +  DT A+ ++WL     A
Sbjct  739  ---LKALK----VCYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQA  787

Query  133  LGAKRQLTR  141
            + A+++  R
Sbjct  788  VSAEKEKDR  796

>SPRG_08217
Length=687

 Score = 38.1 bits (87),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 58/217 (27%), Positives = 89/217 (41%), Gaps = 66/217 (30%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            EG++TKR  H    W  R+ ++DG+NL+  YY+ R       G P AP+G + L+     
Sbjct  2    EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLTD----  47

Query  83   EYVVG-VMGAADKP--------FGFKMVGHAPKKGYVELDVFVD----TLADRNKWLEVA  129
              VVG V  + +K         F       A +K Y + D FVD    T A  N+W    
Sbjct  48   GCVVGKVFNSEEKHKHHEPVWMFRITFAVEAGEKSY-KKDRFVDLGAKTEALANEW----  102

Query  130  RNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKD------E  183
                       ++ ++Q++S G K +F               K ++T+    D      E
Sbjct  103  -----------KKTLEQTIS-GVKEMF---------------KHVRTMKYEADHGATNPE  135

Query  184  LLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDL  220
            ++S+ L E E   L   +  N    QG  L  +E  L
Sbjct  136  VVSKLLAEDENISLFNLDEDNAKAEQGWWLARVEDGL  172

>SDRG_05150
Length=787

 Score = 38.1 bits (87),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>SDRG_04871
Length=687

 Score = 37.7 bits (86),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 58/217 (27%), Positives = 89/217 (41%), Gaps = 66/217 (30%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            EG++TKR  H    W  R+ ++DG+NL+  YY+ R       G P AP+G + L+     
Sbjct  2    EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLTD----  47

Query  83   EYVVG-VMGAADK--------PFGFKMVGHAPKKGYVELDVFVD----TLADRNKWLEVA  129
              VVG V  + +K         F       A +K Y + D FVD    T A  N+W    
Sbjct  48   GCVVGKVFNSEEKHKHHEPVWMFRITFAVEAGEKSY-KKDRFVDLGAKTEALANEW----  102

Query  130  RNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKD------E  183
                       ++ ++Q++S G K +F               K ++T+    D      E
Sbjct  103  -----------KKTLEQTIS-GVKEMF---------------KHVRTMKYEADLGATNPE  135

Query  184  LLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDL  220
            ++S+ L E E   L   +  N    QG  L  +E  L
Sbjct  136  VVSKLLAEDENISLFNLDEDNAKAEQGWWLARVEDGL  172

>SPRG_08346
Length=797

 Score = 37.7 bits (86),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ V+ G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYIW_21901
Length=913

 Score = 37.7 bits (86),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 49/112 (44%), Gaps = 14/112 (13%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEP  81
            S  G++ K GH RK+W+ R+ V+D S L+    ES A     +        + +  +   
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARLKGEV--------LLFHPATRV  474

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            H   + + G  D  F    VG    K Y  L +  + L+DR  W+    +AL
Sbjct  475  HYVDIHLSGGKDGTFAIH-VG----KDYALL-LQAEQLSDRENWMYCIEDAL  520

>H257_05175
Length=678

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 27/121 (22%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            EG++TKR  H    W  R+ +++GSNL+  YY+ R       G P+ P+G + L+    +
Sbjct  2    EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83   EYVVGVMGAA-------DKPFGFKM---VGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            E VVG +  +       D+ + F++   VG A +K Y + D F+D  A   K  E  + A
Sbjct  48   ECVVGKVFNSEEKHKHHDQVWMFRITFSVG-AGEKSY-KKDRFIDLGAKDEKMAEAWKKA  105

Query  133  L  133
            L
Sbjct  106  L  106

>H310_06667
Length=896

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 3/52 (6%)

Query  8   EHGATASGDKARPTSC-EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
           EH   +S     PT   EGY+ K+G   K W+ R+ V DG +L  SY+ ++A
Sbjct  20  EHAGLSSRPGFDPTFMKEGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKA  69

>H257_03361
Length=699

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 9/61 (15%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP-KGIFYLSSIEPH  82
           +G++ K+G    SW+ R+LV+ G N  +SY++        +  P A  KG F L+ ++P+
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFDKE------VSNPRAKEKGSFVLAGVQPN  62

Query  83  E  83
           +
Sbjct  63  K  63

>PITG_02109
Length=522

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
            G+V K+G   K+W+ RF+V+ G   Q++YY++ +  +P +     PKG F + ++E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNPTV----KPKGSFQVITVE  186

>H310_06666
Length=887

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  SYY S+
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>SDRG_06927
Length=847

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 25/93 (27%), Positives = 45/93 (48%), Gaps = 3/93 (3%)

Query  25   GYVTKRGHFRKSWRVRFLV-VDGSNL-QVSYYESRAACHPP-IGQPSAPKGIFYLSSIEP  81
            G++ K G F K W+ R+ V V G++  ++ YY+S  A HP  +   +   G+ YL +++ 
Sbjct  20   GWLRKLGRFSKRWQRRYFVFVKGTDAKELRYYDSSTATHPEGVMSLADATGVCYLDAVQA  79

Query  82   HEYVVGVMGAADKPFGFKMVGHAPKKGYVELDV  114
                 G   ++D  F      +    G+ + DV
Sbjct  80   RSSSPGEASSSDHKFAILTAENVWLLGFNDHDV  112

>SPRG_09805
Length=838

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 39/76 (51%), Gaps = 3/76 (4%)

Query  25  GYVTKRGHFRKSWRVRFLV-VDGSNL-QVSYYESRAACHPP-IGQPSAPKGIFYLSSIEP  81
           G++ K G F K W+ R+ V V G++  ++ YY+S  A HP  +   +   G+ YL +++ 
Sbjct  19  GWLRKLGRFSKRWQRRYFVFVKGTDAKELRYYDSTTATHPEGVMSLADATGVCYLDTVQA  78

Query  82  HEYVVGVMGAADKPFG  97
                G   ++D  F 
Sbjct  79  RSPSPGEAASSDHKFA  94

>H257_03093
Length=975

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG++L  +YY S+          +  +G   ++ + P  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEAR----TGTNLRGRMIITKVLPEN  157

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +       G+    +   T  +++ W+E+ + A+
Sbjct  158  Y--------GKAHGFLI----ETMGHKHFHLCCTTELEKDMWVEMMQAAI  195

>H310_04843
Length=968

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EGYV K+G +   W  R+LV+DG++L  +YY S+
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSK  134

>SPRG_00890
Length=883

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 50/110 (45%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGYV K+G +   W  R+LV+DG++L  +YY ++             +G   ++ + P  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR----SGRNLRGRMIITRVLPEN  84

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  85   Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAI  122

>H310_04667
Length=680

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 27/121 (22%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            EG++TKR  H    W  R+ +++GSNL+  YY+ R       G P+ P+G + L+    +
Sbjct  2    EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83   EYVVGVMGAA-------DKPFGFKM---VGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            E +VG +  +       D+ + F++   VG A +K Y + D F+D  A   K  E  + A
Sbjct  48   ECIVGKVFNSEEKHKHHDQVWMFRITFSVG-AGEKSY-KKDRFIDLGAKDEKMAEAWKKA  105

Query  133  L  133
            L
Sbjct  106  L  106

>HYAP_04457
Length=1203

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 2/57 (4%)

Query  1   MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           M+ + +    A+ S         EGYV K+G +   W  R+L++DG  L  +YY S+
Sbjct  39  MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  93

>H310_07070
Length=680

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 14/117 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFY  75
            D   PTS  G + K+ +  K+W+ RF+V+ G ++   YY S         + + P+G+  
Sbjct  114  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTT-----SEETYPRGVIS  166

Query  76   LSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            LS ++ H   V       K F F+ + H     Y  L +     AD  +W+   ++A
Sbjct  167  LSGVDVHPLDVSKF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>H310_13627
Length=678

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (42%), Gaps = 8/110 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEY  84
            G++ K+GH  K+W+ RF V+DGS L+  Y+        P       KG   L   +   +
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLKGEVLLFHKDTTVH  327

Query  85   VVGV-MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
             V + +   D  F     G     G   L +   +L +R  W+    +A+
Sbjct  328  YVDIHLSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAI  372

>H257_02642
Length=975

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (53%), Gaps = 5/51 (10%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP  70
           P   EGY+ KRG +   W    +V+DG  L+VSYY+       P  +P AP
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLDG---PPAKPHAP  72

>PPTG_14630
Length=398

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
           G+V K+G   K+W+ RF+V+ G   Q++YY++ +   P +     PKG F + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLVPTV----KPKGSFQVITVE  60

>HYAP_06101
Length=984

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 54/113 (48%), Gaps = 27/113 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L     +
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNKGR--------KKIKGCMQL-----N  186

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARN  131
            + VV V    +  A+K + F++     +KG+ +L  +  +  +   W+   R+
Sbjct  187  DGVVSVQHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALRS  234

>SDRG_06288
Length=641

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
            +P  C G + K+G   K+WR R+  +DG + Q+SY  S A   PP G
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPPKG  301

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 4/41 (10%)

Query  23  CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPP  63
             G+V K+G   KSW+ RFLVV G +  VSYY+   + H P
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGRH--VSYYDR--SVHEP  41

>H257_01308
Length=897

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  SYY ++
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>PYAR_14615
Length=517

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EG++ K+G   KSW+ R+ V DG  L  SYY SR
Sbjct  35  TMKEGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  69

>PHYKE_4911
Length=46

 Score = 32.3 bits (72),  Expect = 0.30, Method: Composition-based stats.
 Identities = 13/32 (41%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           G+V K+G   K+W+ RF+V+ G   Q++YY++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT  38

>PYAR_19291
Length=711

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (44%), Gaps = 18/128 (14%)

Query  8    EHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQP  67
            +H   +  D     S  G++ K GH RK+W++R+ V++ S L+  YY   A         
Sbjct  195  DHPTASPFDDTFLDSMCGWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEAM--------  244

Query  68   SAPKG--IFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKW  125
            +  KG  + +  + + H   + +    D  F  + VG      Y  L +  D ++DR  W
Sbjct  245  TRLKGEVLLFHPAAQVHYVDIHLSNGRDNTFAIQ-VG----PDYTLL-LEADRVSDRENW  298

Query  126  LEVARNAL  133
            +    +AL
Sbjct  299  MYCIEDAL  306

>HYAP_09304
Length=1144

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      +SYY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>PHYKE_6662
Length=765

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 48/110 (44%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EG+V K+G +   W  R+L++DG+ L  +YY S+             +G   +  + P  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEAR----SARNLRGRMIIVKVRPEN  125

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNAL  133
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+
Sbjct  126  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAI  163

>PHYKE_7856
Length=346

 Score = 35.8 bits (81),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYY  54
           G++TK+GH  KSW+ RF V+  DG+  +   +
Sbjct  63  GWLTKQGHMWKSWKTRFFVLFSDGTQFEAELW  94

>H257_07514
Length=810

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EGYV K+GH  ++WR R+ ++ G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>H310_07701
Length=811

 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           T  EGYV K+GH  ++WR R+ ++ G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PYVX_14593
Length=964

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query  7    PEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            P+  AT S D  +   C G++ K+G    SW+ R+  + GS L+  YY+S
Sbjct  592  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

>PHYRA_94409
Length=1270

 Score = 36.2 bits (82),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            G++TK+GH  KSW+ RF V+  DG+    +YY+++             KG   L+     
Sbjct  113  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR--------KKIKGCMQLN-----  156

Query  83   EYVVGV----MGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            + VV V    +  ADK + F++     +KG+ +L  +  +  +   W+   R+ 
Sbjct  157  DGVVSVQHVDVRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVAALRSV  205

>PYIR_13168
Length=1353

 Score = 36.2 bits (82),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 54/110 (49%), Gaps = 19/110 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            G++TK+GH  K+W+ RF V+  DG+    +YY+++       G      GI  +  ++  
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGT---FAYYKNKGK-KKMQGCLMLNDGIVTVKHVDVR  171

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
            +  +G      KP+ F++     +KG+ +L  +  +  +   W+   R+A
Sbjct  172  K--IG------KPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>PHYKE_4910
Length=375

 Score = 35.4 bits (80),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (9%)

Query  12   TASGDKAR--PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            T SG   R  P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  115  TVSGAMGRTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  159

>SDRG_05608
Length=121

 Score = 33.9 bits (76),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 49/127 (39%), Gaps = 33/127 (26%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG-------  65
            A  D A+P   EG +TKR  + K WR R+ V+ G+ L    Y  RA    P G       
Sbjct  3    AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  57

Query  66   ----------------QPSAPKGIFYL--SSIEPHEYVVGVMGAADKPFGFKMVGHAPKK  107
                            + + P+  +Y+   S E  +  +G +G A   F     G     
Sbjct  58   LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DD  114

Query  108  GYVELDV  114
            GY E DV
Sbjct  115  GYDEEDV  121

>H257_06469
Length=76

 Score = 32.7 bits (73),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSY  53
           EGYV K+GH  KSW+ R+  +D S   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>SPRG_01860
Length=674

 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  53

>SDRG_08236
Length=864

 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  53

>PHALS_06568
Length=388

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
           G+V K+G   KSW+ R++V+ G   Q++YY++       + Q   PKG   + ++E
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYYDT-----AKVDQKVKPKGSCQVITVE  60

 Score = 32.0 bits (71),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            S D +   +  G++ K G   KSWR RF V+ G++L  SY+ S
Sbjct  142  SEDGSEQVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNS  182

>PITG_02106
Length=1015

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 63/147 (43%), Gaps = 41/147 (28%)

Query  7    PEHGATAS-----GDK--ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            PE+ A +S     GD+  A    C G++ K G   KSW+ R+  + GS L  SYY+S   
Sbjct  653  PEYDAISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKSE--  708

Query  60   CHPPIGQPSAPKGIFYLS----SIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVF  115
                       KG    S    SIEPH  V           G  +  H+ +K    L + 
Sbjct  709  -----------KGSLLRSVSVVSIEPHPTV---------SLGLVVSTHSGRK----LIMQ  744

Query  116  VDTLADRNKWLEVARNALGA--KRQLT  140
             D+  + ++WL   + A+    +R+LT
Sbjct  745  ADSNEEFDRWLSAIQGAVAGENERKLT  771

>SPRG_04912
Length=261

 Score = 35.0 bits (79),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSI  79
           P    GYV K+G F K+W+ R + +    L   YY S  A        + P+G+F ++S+
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRIMALHDDTL--FYYVSERAM-------AKPRGVFRVTSV  88

>CCI40991
Length=801

 Score = 35.8 bits (81),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVVDGS  47
            T  EGY+ K+GH  +SWR R+ V+ G+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGT  132

>PHYSO_248481
Length=1283

 Score = 35.8 bits (81),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
            G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  92   GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  123

>PYU1_G000724
Length=189

 Score = 34.7 bits (78),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 25/36 (69%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRA  58
            G++TK+GH  KSW+ RF V+  DG+    +YY+++ 
Sbjct  111  GWLTKQGHMWKSWKTRFFVLFADGT---FAYYKNKG  143

>PITG_03318
Length=1343

 Score = 35.8 bits (81),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
            G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  170

>PPTG_16044
Length=1378

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESR  57
            G++TK+GH  KSW+ RF V+  DG+    +YY+++
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  170

>H310_14019
Length=683

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 65/164 (40%), Gaps = 35/164 (21%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL  76
            +A   S EG++ KRG   K+W+ R+  ++G  L+  Y E         G  + PKG    
Sbjct  166  RASMRSFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG----  210

Query  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136
                 +  VVGV    + P+    +   P +    LDV  ++  ++  W++   +A G  
Sbjct  211  -----YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQRILDACG--  259

Query  137  RQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180
                        +          V+LS  PA  PQ+   +L  +
Sbjct  260  ---------HVAATTPPPPPVLHVTLSSAPATPPQQLAASLQST  294

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  8    EHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59
            ++G  +S D A  T+CEG++ K+G   K+W+ R+  + G  L     +S  A
Sbjct  331  DYGIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  380

>PYAR_15792
Length=121

 Score = 33.5 bits (75),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
           EG +TKR  + K WR RF V+ G+ L    Y  RAA  P  G
Sbjct  16  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  53

>SPRG_02502
Length=121

 Score = 33.5 bits (75),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query  15  GDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIF  74
            D A+P   EG +TKR  + K WR R+ V+ G+ L    Y  RA       Q  AP G+ 
Sbjct  5   ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRA-------QGEAPHGVI  52

Query  75  YLS  77
            LS
Sbjct  53  DLS  55

>PHALS_06336
Length=511

 Score = 35.0 bits (79),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 8/56 (14%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            ++I+++ E G      +  P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  118  LSIIQIREMG------REDPATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  165

>PYU1_G012859
Length=1183

 Score = 35.4 bits (80),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 36/65 (55%), Gaps = 7/65 (11%)

Query  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            M++++ P    + S    +P    G++ K+GH  +SW+ R+ V+ G +LQ  Y+E+    
Sbjct  476  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN--ID  528

Query  61   HPPIG  65
             PP G
Sbjct  529  KPPRG  533

 Score = 35.0 bits (79),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
            +G++ K G   K+W+ RF+V+ G+ L  SYY       PP+G
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADETPSSPPLG  236

 Score = 32.7 bits (73),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            A   +CEG++ K+GH  K W+ R+  ++   L+
Sbjct  354  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

>PYVX_19982
Length=700

 Score = 35.0 bits (79),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 75/176 (43%), Gaps = 38/176 (22%)

Query  24   EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G P AP+G + L+     
Sbjct  2    EGWLTKRRDHMNLIWLERYFVLDGN--QLRYYRKR-------GDP-APRGTYVLTD----  47

Query  83   EYVVG-VMGAADK--------PFGFKMVGHAPKKGYVE---LDVFVDTLADRNKWLEVAR  130
              +VG V  + DK         F       A +K Y +   LD+   T  +  +W +   
Sbjct  48   GCLVGPVFNSEDKHKHHGPVWMFRITFAVEAGEKSYKKDRFLDLGAKTEENAKEWRKALE  107

Query  131  NALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLS  186
            +A+ + R+L    + Q       +LFG        PA S    +  L K+ ++ +S
Sbjct  108  SAVRSIRELV---LHQRKMKTDADLFG--------PATSSSTTVPRLLKADEDTVS  152

>PYVX_16882
Length=970

 Score = 35.0 bits (79),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 20/125 (16%)

Query  92   ADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQ---SV  148
            AD P     + HA       LD+ VD    +  W++ A N++     LT +AI     +V
Sbjct  537  ADAPLTCTAIVHA------SLDIGVDPEDRKRTWMDDAENSISRGALLTAKAIYAYALTV  590

Query  149  SPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSK---DELLSQALRELEAAKLVGREACNE  205
             PGKK+++  ++SL        +KQ+    K+    + LL +A+     A+++   A  E
Sbjct  591  FPGKKSVWLRAISL--------EKQLNKDGKNNEAVEHLLQKAVTSCPNAEILWLMAAKE  642

Query  206  IVVQG  210
            + + G
Sbjct  643  VWMNG  647

>PPTG_18989
Length=1213

 Score = 35.0 bits (79),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>HYAP_13757
Length=262

 Score = 34.7 bits (78),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
           G++ KRGH  K+W+ RF +++G+ L  +YY+
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  43

>CCI42088
Length=1007

 Score = 35.0 bits (79),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 1/34 (3%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            +G++ KRGH +K+W+ RF  V+   LQ  + E+R
Sbjct  666  DGFLWKRGHLKKNWKKRFFRVENGQLQY-FTENR  698

>PYAP_13647
Length=266

 Score = 34.7 bits (78),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 39/71 (55%), Gaps = 5/71 (7%)

Query  174  IQTLSKSKDEL-----LSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLD  228
            ++TL K  D L     LSQ  +++E  K++  E  N+++ +GEK+D +      + +D  
Sbjct  118  METLMKKYDNLKIETPLSQVRQKMEKVKMIMIENVNQLMERGEKIDLLVMRTDKLQQDAL  177

Query  229  FGDKLLRRLKS  239
              DK  ++LK+
Sbjct  178  KYDKTAKKLKN  188

>H257_08182
Length=859

 Score = 35.0 bits (79),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 28/42 (67%), Gaps = 6/42 (14%)

Query  18   ARPTSC----EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            +R TSC    EG++ K+G   KSW+ R+ VV G++L  +YY+
Sbjct  654  SRRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYK  693

>H310_13911
Length=369

 Score = 34.7 bits (78),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 35/75 (47%), Gaps = 10/75 (13%)

Query  8   EHGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQ  66
           E  AT++     P     G++ K+    K+W  RF  + GS L  SYY+S          
Sbjct  12  EQSATSTASANAPKIVLSGWMRKQKAHLKTWNRRFFALSGSTL--SYYDSEDI-------  62

Query  67  PSAPKGIFYLSSIEP  81
             AP+GI  ++S+ P
Sbjct  63  SGAPRGILEVASVHP  77

>PYU1_G007423
Length=928

 Score = 35.0 bits (79),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 18/130 (14%)

Query  6    VPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
             PE     + D +   S  G++ K GH RK+W+ R+ V++ S L+  YY   +       
Sbjct  417  TPEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YYSDDSM------  468

Query  66   QPSAPKG--IFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRN  123
              +  KG  + +  +   H   + + G  D  F  + VG    K Y  L +  D L+ R 
Sbjct  469  --TRLKGEVLLFHPATRVHYVDIHLSGGRDCTFAIQ-VG----KDYTLL-LQADQLSVRE  520

Query  124  KWLEVARNAL  133
             W+    +AL
Sbjct  521  NWMYCIEDAL  530

>SDRG_02135
Length=306

 Score = 34.7 bits (78),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 4/34 (12%)

Query  24  EGYVTKRGHFRKSWRVRFL-VVDGSNLQVSYYES  56
           EGY+ K+GH  K+WR R+  +VD S   ++YY+S
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDAS---LAYYDS  32

>H310_01921
Length=341

 Score = 34.7 bits (78),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE-PHE  83
           G+V K+G   KSW+ R++V+   N Q++Y+ES       +   S  KG F + ++E  H+
Sbjct  24  GWVYKQGSMIKSWKKRYMVL--KNKQLTYFESE-----KVEGNSKAKGSFQVITVEIAHD  76

Query  84  YVVGVM  89
              G++
Sbjct  77  IKNGLL  82

>H257_03363
Length=316

 Score = 34.7 bits (78),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE-PHE  83
           G+V K+G   KSW+ R++V+   N Q++Y+E     +  I   S  KG F + +IE  H+
Sbjct  8   GWVYKQGSMVKSWKKRYMVL--KNKQLTYFE-----NEKIEGNSKAKGSFQVITIEIAHD  60

Query  84  YVVGVM  89
              G++
Sbjct  61  IKNGLL  66

>PHYKE_1044
Length=521

 Score = 34.7 bits (78),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHP  62
           EG++ K+G   K W+ R+ V DG  L  SYY SR    P
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRKP  74

>CCA15513
Length=1341

 Score = 35.0 bits (79),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 19/110 (17%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPH  82
            G+++K+GH  K WR RF V+  DG+   ++YY  R       G     +GI  +  I+  
Sbjct  86   GWLSKQGHLWKGWRSRFFVLYADGT---LAYYRRRGNVKMK-GYIKLNEGIIGIQYID--  139

Query  83   EYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNA  132
                  +    + + F++     +KG+  L     T  +   W+   R+A
Sbjct  140  ------VWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVNHLRSA  178

>PYAR_16228
Length=862

 Score = 34.7 bits (78),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 2/41 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPI  64
           EG + K+G   K W+ R+ V DG  L  SYY +R    P +
Sbjct  30  EGPLQKKGQMLKGWKQRWFVCDGRTL--SYYSNRRESRPSV  68

>PHYRA_81944
Length=1149

 Score = 35.0 bits (79),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>PHYCA_504801
Length=398

 Score = 34.7 bits (78),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
           G+V K+G   K+W+ RF+V+ G   Q++YY++ A  +P     +  KG F + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNP----TTKAKGSFQVITVE  60

>PHALS_07930
Length=1200

 Score = 34.7 bits (78),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F KSWR RF ++      + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>CCI43793
Length=1117

 Score = 34.7 bits (78),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            GY+ K+G F KSWR RF ++      ++YY S+
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASK  207

>PYIR_15118
Length=1222

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F K+WR R+ ++      +SYY+S
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>PYU1_G009508
Length=328

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G + K+WR R+ ++      +SYY+S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>SPRG_14955
Length=635

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  3   ILRVPEHGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
           +L   E  A+  G K +      G + KRGH RK+W  RF V+  ++L+  YY+
Sbjct  5   VLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>SDRG_14487
Length=964

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (57%), Gaps = 9/60 (15%)

Query  22  SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP-KGIFYLSSIE  80
           + EG++ K+G    +W+ R++V+ G +  ++YY+        +  P A  KG F L+++E
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKGRH--IAYYDKE------VSNPRAKEKGTFTLAAVE  56

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            G++ K G   KSW+ RF V+ G++L  +YY+
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>PITG_10462
Length=1028

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  118  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  149

>PYAP_13695
Length=348

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 55/122 (45%), Gaps = 20/122 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHEY  84
            G++ K+G   K+W+ RF+V+ G   Q++YY++     P + +    KG F + ++E    
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSFQVITVEL---  61

Query  85   VVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAKRQLTRQAI  144
                  ++D   G  + G    +G   L ++ D+  + N W     +A          A+
Sbjct  62   ------SSDIQNGLIVHG----RGGRVLKLYTDSTDNTNGWYHAIMDATNNTGGGGGSAV  111

Query  145  DQ  146
            D+
Sbjct  112  DR  113

>PHYSO_559234
Length=1544

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 38/88 (43%), Gaps = 4/88 (5%)

Query  52   SYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            S++E  A CH  + +  AP     LS+  P E     + AA   FG+K V   P K  VE
Sbjct  587  SFFEHLAVCHTVMPE-RAPDNSLRLSASSPDE---QALVAAAACFGYKFVARGPGKAMVE  642

Query  112  LDVFVDTLADRNKWLEVARNALGAKRQL  139
                VD   D      VA +A+G    L
Sbjct  643  YFSCVDHPEDMVCNQPVAGHAVGTYEVL  670

>PYAR_26065
Length=314

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  52   SYYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVE  111
            S++E  + CH  + +  AP G   LS+  P E     + AA   FG+K    AP K +VE
Sbjct  91   SFFEHLSVCHTVMPE-RAPDGSVRLSASSPDEQA---LVAAAACFGYKFSARAPGKAFVE  146

>PHYSO_558498
Length=967

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PHYSO_478611
Length=522

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
            G+V K+G   K+W+ RF+V+ G   Q++YY++ A   P +      KG F + ++E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDPTVKA----KGSFQVITVE  189

>PYIR_23372
Length=1415

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            S EGY+ K+    +SW+  + V++G  +  +YYESR
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  355

>PHALS_09729
Length=949

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PYIW_18911
Length=1196

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            GY+ K+G F K+WR R+ ++      +SYY+S
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>SPRG_02752
Length=831

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (57%), Gaps = 9/58 (16%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP-KGIFYLSSIE  80
           EG++ K+G    +W+ R++V+ G +  ++YY+        +  P A  KG F L+++E
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYDKE------VTNPRAKEKGTFTLAAVE  56

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            G++ K G   KSW+ RF V+ G++L  +YY+
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>PPTG_08785
Length=944

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>PYU1_G009249
Length=2580

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 5/57 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPS-APKGIFYLSSI  79
             EGY+ KRGH   S R R+ V+      + YY    A H     PS AP G F + ++
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVDTV  1231

>SDRG_14070
Length=630

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  3   ILRVPEHGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
           +L   E  A+  G K +      G + KRGH RK+W  RF V+  ++L+  YY+
Sbjct  5   VLHPQESSASMGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>PYIW_19613
Length=1314

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 7/71 (10%)

Query  53   YYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVEL  112
            ++E    CH  + +  AP G   LS+  P E     + AA   FG+K V  AP K  VE 
Sbjct  608  FFEHLGICHTVMPE-KAPDGSLRLSASSPDE---QALVAAAACFGYKFVARAPGKAMVE-  662

Query  113  DVFVDTLADRN  123
              +   L D++
Sbjct  663  --YFSCLGDQD  671

>PYAP_22195
Length=901

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V +G  L  SYY SR
Sbjct  38  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISR  69

>PHYCA_564296
Length=957

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  69

>CCA27255
Length=1125

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (49%), Gaps = 3/68 (4%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYL--SSIEPH  82
            GY+ K+G +R++W+ RF ++        YY+S+   H  +G     K    L  +S E  
Sbjct  167  GYLLKQGSWRRNWKSRFFMLRQDYPSFCYYKSQHKLH-LLGHVRITKDTIVLQRTSSESG  225

Query  83   EYVVGVMG  90
            +Y   V G
Sbjct  226  KYYFQVRG  233

>PHALS_05587
Length=1361

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 25/36 (69%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYESRA  58
            G++ K+GH  KSW+ RF V+  DG+   V YY++++
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYKNKS  171

>PHYRA_82040
Length=1054

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  143  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  174

>PPTG_11714
Length=2444

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 52/126 (41%), Gaps = 26/126 (21%)

Query  13    ASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVVDGSNLQVSYYESRAACH-PPIGQPSAP  70
             A  D    T  +GY+  R H   S WR RF+V++GS L V + E+   C     G+P  P
Sbjct  2013  AGNDNTDTTQTKGYLRVRHHNLGSIWRERFVVLEGSTLTV-FSEN---CQLDEEGKPRFP  2068

Query  71    KGIFYLSSIEPHEYV-----------VGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119
                    ++E HE V           +G  G+  K  GF+    A     V L+    T 
Sbjct  2069  D-----LAVEKHELVGVEKWHPVFTSLGRSGSGLKGTGFR----AETSSGVYLEFIATTA  2119

Query  120   ADRNKW  125
              D  KW
Sbjct  2120  EDAFKW  2125

>PYAP_18434
Length=1042

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 27/56 (48%), Gaps = 10/56 (18%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
           G++ KR    KSW+ RF  ++GS L   YY  R          + PKGI  L+  E
Sbjct  27  GHLYKRTGLAKSWKTRFFSLEGSVL---YYYKREG-------DTVPKGIVVLTGCE  72

>CCA17832
Length=1125

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 56/156 (36%), Gaps = 22/156 (14%)

Query  11   ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP  70
             T+ G        EGY+ KR  + K W   + V++G  L   Y     A H P       
Sbjct  26   VTSYGMTMAQIHWEGYLQKRSDWLKHWETFYFVLNGRYL-YCYLSEEDARHQPDKSRIKN  84

Query  71   KGIFYLS---------SIEPHEYVVGVMG-----AADKPFGFKMVGHAPKKGYVELDVFV  116
              +F  S          +E   +V  ++       A   F F+      K  ++E     
Sbjct  85   GKLFAFSHRITVMKAWDVEDPLHVAAMVSNDARTTAPNSFSFRFTLQTEKGHHLEFR--T  142

Query  117  DTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGK  152
            ++ A +  WL+ A  A+ A   L     DQS  P K
Sbjct  143  NSEASKQTWLQFASTAIVAFDHL-----DQSTLPPK  173

>PYIW_15014
Length=702

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G P AP+G + L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QMRYYRKR-------GDP-APRGTYVLT  46

>PYAP_23744
Length=123

 Score = 32.3 bits (72),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 29/56 (52%), Gaps = 5/56 (9%)

Query  10  GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIG  65
           G  ++ D + P   EG +TKR  + K WR R+ V+ G+ L    Y  RAA  P  G
Sbjct  3   GDFSNCDLSNPDY-EGELTKRSVWLKEWRRRYFVLKGNKL----YFCRAANEPAHG  53

>SPRG_21393
Length=494

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 22/111 (20%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIEPHE  83
            EGY+ K+    K W++R+ V+  + L  S    R        +P A   + +L ++    
Sbjct  8    EGYLHKQSQHLKLWKIRYFVLTTTALLYSKKSGR--------KPKATYALQHLDALTDQN  59

Query  84   YVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVD--TLADRNKWLEVARNA  132
             VV      D  F  ++        Y +L ++V   T ADR KW+ + +N 
Sbjct  60   LVVH-----DHNFVLEL-------RYKKLRLYVSAPTEADRAKWVHLIKNC  98

>CCI43456
Length=126

 Score = 32.3 bits (72),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  14  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
           S D+ +  + EG +TKR  + K WR R+ ++ G+ L  S
Sbjct  11  SIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  49

>PYIW_21944
Length=1317

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (71%), Gaps = 5/34 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVV--DGSNLQVSYYES  56
            G++TK+GH  K+W+ RF V+  DG+    +YY++
Sbjct  105  GWLTKQGHMWKTWKTRFFVLYSDGT---FAYYKN  135

>PYIR_14494
Length=819

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQ  50
            A    CEG++ KRG    +W+ RF  ++G  LQ
Sbjct  260  AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

 Score = 33.1 bits (74),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 31/52 (60%), Gaps = 4/52 (8%)

Query  6    VPEHG-ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            VP  G    S D++ P  C G++ K G   K+W++R+  ++G+ L  SY++S
Sbjct  699  VPYVGMGCVSLDESFP-GCSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

>PHALS_09273
Length=663

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 24/44 (55%), Gaps = 4/44 (9%)

Query  20   PTS---CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60
            PTS    EG + KRGH  K+W+ RF  +    L+  Y E++  C
Sbjct  326  PTSYIHMEGRLLKRGHLNKNWKTRFFRIQQGELRY-YTENQNKC  368

>PYIR_21473
Length=667

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G P AP+G + L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QMRYYRKR-------GDP-APRGTYVLT  46

>PYVX_23432
Length=1510

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 29/60 (48%), Gaps = 4/60 (7%)

Query  53   YYESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVEL  112
            ++E  A CH  + + +A  G   LS+  P E     + AA   FGFK V  AP K  VE 
Sbjct  578  FFEHLAVCHTVMPERAA-DGSLRLSASSPDE---QALVAAAACFGFKFVARAPGKAMVEF  633

>PHALS_00896
Length=1010

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 13/104 (13%)

Query  112  LDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSV---SPGKKNLFGFSVSLSPQPAM  168
            LDV VD    +  W++ A N++     LT +AI  +     PGKK+++  +V+L      
Sbjct  591  LDVDVDPEDRKRTWMDDAENSISRGALLTAKAIYAAALKFFPGKKSIWLRAVAL------  644

Query  169  SPQKQIQ--TLSKSKDELLSQALRELEAAKLVGREACNEIVVQG  210
              +KQIQ    S+S ++LL +A+     A+++   A  E+   G
Sbjct  645  --EKQIQDGKSSESVEQLLQKAVTSCPHAEILWLMAAKEVWSNG  686

>H257_01309
Length=895

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           EGY+ K+G   K W+ R+ V DG  L  SY+ +
Sbjct  48  EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHT  78

>PYAR_16674
Length=651

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLS  77
           EG++TKR  H    W  R+ V+DG+  Q+ YY  R       G P AP+G + L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGN--QLRYYRKR-------GDP-APRGTYVLT  46

>PYAR_13491
Length=1080

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  27  VTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
           +TK+G +R++W+ RF ++      +SYY+S
Sbjct  2   LTKQGSWRRNWKTRFFILRSDYPSLSYYKS  31

>PYU1_G006732
Length=954

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
           EGY+ K+G   K W+ R+ V D   L  SYY SR
Sbjct  21  EGYLQKKGQRLKGWKRRWFVCDARTL--SYYISR  52

>PYVX_14527
Length=1269

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSSIE  80
            G+V K+G   ++W+ RF+V+ G   Q++YY++ A   P +      KG F L ++E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT-ARLTPSV----KAKGSFTLITVE  951

 Score = 32.3 bits (72),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            G+V K G   +SW+ RFLV  G++L  +YY++
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKN  618

>PYVX_16714
Length=1030

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            EG++ K+G   K W+ R+ V DG  L  SYY SR
Sbjct  160  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISR  191

>PITG_17594
Length=694

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLS  77
           EG++TKR  H    W  R+ ++DG+  Q+ YY  R       G P AP+G + LS
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGN--QLRYYRKR-------GDP-APRGTYILS  46

>PYU1_G012274
Length=873

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            S EGY+ K+    +SW+  + V++G  +  +YYESR
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESR  343

>CCI45857
Length=905

 Score = 33.9 bits (76),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
           EGY+ K+G   K W+ R+ V DG  L  SYY
Sbjct  40  EGYLQKKGQRLKGWKQRWFVCDGRTL--SYY  68

>CCA19118
Length=125

 Score = 32.0 bits (71),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (56%), Gaps = 0/45 (0%)

Query  8   EHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVS  52
           E+    S ++ +  + EG +TKR  + K WR R+ ++ G+ L  S
Sbjct  4   ENEENLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFS  48

>CCA23572
Length=868

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
           EGY+ K+G   K W+ R+ V DG  L  SYY
Sbjct  3   EGYLQKKGQRLKGWKQRWFVCDGRTL--SYY  31

>PYVX_14287
Length=652

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 22/38 (58%), Gaps = 5/38 (13%)

Query  20   PTS---CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
            PTS    EG + KRGHF K+W+ RF  ++   L   YY
Sbjct  305  PTSYIHMEGCLMKRGHFNKNWKNRFFRIEKGELL--YY  340

>PHALS_06334
Length=1064

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRA  58
            C G++ K G   KSW+ R+  + GS L  SYY+S+ 
Sbjct  726  CVGWLKKEGKNVKSWKWRYFTLYGSKL--SYYKSKT  759

>PHALS_12503
Length=340

 Score = 33.1 bits (74),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYE  55
            G++ KRGH  K+W+ RF +++G  + ++YY+
Sbjct  101  GWLWKRGHSFKTWKKRFFLLNG--VALTYYK  129

>H310_14473
Length=613

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 18/30 (60%), Gaps = 2/30 (7%)

Query  25  GYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54
           G + KRGH RK+W  RF V+    L+  YY
Sbjct  27  GILLKRGHLRKNWLTRFFVLTSGALR--YY  54

>PYAR_23366
Length=828

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESR  57
            K  P   EGYV +RG +   W   +L +DG  L+  +YES+
Sbjct  69   KMLPILWEGYVRRRGDWLPRWEEMYLTMDGRWLR--FYESK  107

>PYAP_16734
Length=1314

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVVDGSNLQVSYYES  56
            G +TK+G +R++W+ RF ++   +  + YY+S
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKS  212

Lambda      K        H        a         alpha
   0.315    0.132    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22974963336

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40