Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_18455147551321326963e-95
PPTG_17126147551361326331e-85
PHYSO_321155147551361305992e-80
PHYCA_11834147551341305922e-79
PHALS_06479147551361305905e-79
PHYRA_95903147551341305774e-77
PHYKE_8392147551381325576e-74
HYAP_07103147551641645059e-66
PYVX_18180147551351314482e-57
PYAP_17747147551341323944e-49
PYIW_19970147551301223526e-43
PYU1_G001736147551231233492e-42
CCA17542147551201233333e-40
CCI44820147551231233083e-36
PYIR_13454147551291243075e-36
H257_06293147551231212762e-31
H310_09224147551231212674e-30
SDRG_01782147551231242613e-29
SPRG_06335147551231242536e-28
HYAP_084991114710861870.002
HYAP_085006526017261870.004
PHALS_115641114710756840.006
PHYKE_58411114712160840.007
PITG_137391114710560820.010
CCA175211114710459820.011
PYU1_G0059631114710358820.012
PPTG_092521114710560810.015
PHYSO_3150171114710944810.016
PHYRA_751931416310461810.017
CCI442321114710592800.022
PYIW_142931416310457770.051
PYVX_208541114710458750.11
PYVX_151505606474680780.13
PHYRA_816751114710644700.47
PHYKE_5532815812242710.49
PHYCA_5404611416310461690.70
PHYCA_5353801114710844681.0
PYVX_18358141636254651.2
H310_07567111479854652.2
CCA240562362427061692.2
PYIW_19705254234075682.2
PHYSO_5143231416310461652.7
PITG_177011416310461653.0
PYIR_182231416310557643.2
PPTG_156551416311261643.7
CCA270641416310088643.8
PYIR_250991018051770663.9
SDRG_149121114710554634.8
SPRG_128831114710554634.8
PYAP_248671340314776636.1
H257_07358111479866618.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18455

Length=132
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18455                                                            272        3e-95
PPTG_17126                                                            248        1e-85
PHYSO_321155                                                          235        2e-80
PHYCA_11834                                                           232        2e-79
PHALS_06479                                                           231        5e-79
PHYRA_95903                                                           226        4e-77
PHYKE_8392                                                            219        6e-74
HYAP_07103                                                            199        9e-66
PYVX_18180                                                            177        2e-57
PYAP_17747                                                            156        4e-49
PYIW_19970                                                            140        6e-43
PYU1_G001736                                                          139        2e-42
CCA17542                                                              132        3e-40
CCI44820                                                              123        3e-36
PYIR_13454                                                            122        5e-36
H257_06293                                                            110        2e-31
H310_09224                                                            107        4e-30
SDRG_01782                                                            105        3e-29
SPRG_06335                                                            102        6e-28
HYAP_08499                                                            38.1       0.002
HYAP_08500                                                            38.1       0.004
PHALS_11564                                                           37.0       0.006
PHYKE_5841                                                            37.0       0.007
PITG_13739                                                            36.2       0.010
CCA17521                                                              36.2       0.011
PYU1_G005963                                                          36.2       0.012
PPTG_09252                                                            35.8       0.015
PHYSO_315017                                                          35.8       0.016
PHYRA_75193                                                           35.8       0.017
CCI44232                                                              35.4       0.022
PYIW_14293                                                            34.3       0.051
PYVX_20854                                                            33.5       0.11 
PYVX_15150                                                            34.7       0.13 
PHYRA_81675                                                           31.6       0.47 
PHYKE_5532                                                            32.0       0.49 
PHYCA_540461                                                          31.2       0.70 
PHYCA_535380                                                          30.8       1.0  
PYVX_18358                                                            29.6       1.2  
H310_07567                                                            29.6       2.2  
CCA24056                                                              31.2       2.2  
PYIW_19705                                                            30.8       2.2  
PHYSO_514323                                                          29.6       2.7  
PITG_17701                                                            29.6       3.0  
PYIR_18223                                                            29.3       3.2  
PPTG_15655                                                            29.3       3.7  
CCA27064                                                              29.3       3.8  
PYIR_25099                                                            30.0       3.9  
SDRG_14912                                                            28.9       4.8  
SPRG_12883                                                            28.9       4.8  
PYAP_24867                                                            28.9       6.1  
H257_07358                                                            28.1       8.4  

>PITG_18455
Length=132

 Score = 272 bits (696),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/132 (100%), Positives = 132/132 (100%), Gaps = 0/132 (0%)

Query  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
            MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL
Sbjct  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

Query  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF
Sbjct  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  121  MNRKSGPPRPIF  132
            MNRKSGPPRPIF
Sbjct  121  MNRKSGPPRPIF  132

>PPTG_17126
Length=136

 Score = 248 bits (633),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)

Query  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
            M ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFR+HGD TDP+EVSALIQRAQSSLSYL
Sbjct  5    MRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYL  64

Query  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            KIVTPRAESN GVQRYIYRNGQRVNA EFEEKG ENARWK QDMEGGL+RHHQLL+RQYF
Sbjct  65   KIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYF  124

Query  121  MNRKSGPPRPIF  132
            ++RKSGPPRPIF
Sbjct  125  LDRKSGPPRPIF  136

>PHYSO_321155
Length=136

 Score = 235 bits (599),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)

Query  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
            ELRPLYKKLLRLAQSLPEPKR+ S+DQIRR+FRSHGD TDP+ VSALIQRAQSSLSYLKI
Sbjct  7    ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKI  66

Query  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122
            VTPR ESNTGVQR+IYRNGQRVNAAEFE KG ENAR+K QD+E GLKRHHQLL+RQYFM+
Sbjct  67   VTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126

Query  123  RKSGPPRPIF  132
            RKSGPPRPIF
Sbjct  127  RKSGPPRPIF  136

>PHYCA_11834
Length=134

 Score = 232 bits (592),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)

Query  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
            ELRPLYKKLLRLAQSLPEPKRQ+SIDQIRR+FRSH D TDPKEVS L+QRAQSSL YLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64

Query  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122
            VTPRAESNTGVQR+IYR+G+RVNA E E KG ENARWK QDME GLKRHHQLL+RQYFM+
Sbjct  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124

Query  123  RKSGPPRPIF  132
            RKSGPPRPIF
Sbjct  125  RKSGPPRPIF  134

>PHALS_06479
Length=136

 Score = 231 bits (590),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)

Query  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
            ELRPLYKKLLRLAQ+LP+ KRQSSIDQIRR+FR H D TDPKEVS  IQRAQSSLSYLKI
Sbjct  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66

Query  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122
            +TPR ESNTGVQR+IYRNGQRVNAA+FE+KG ENARWK QDME G KRHHQLL+RQYFM+
Sbjct  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126

Query  123  RKSGPPRPIF  132
            RKSGPPRPIF
Sbjct  127  RKSGPPRPIF  136

>PHYRA_95903
Length=134

 Score = 226 bits (577),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)

Query  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
            ELRPLYKKLLRLAQSLPEPKRQ S+DQIRR+FRSH + TDPKEVSALIQRAQSSL YLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64

Query  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122
            VTPRAESN G+QRYIYRNGQRVNA E E  G ENAR+K QD+EGGLKRHHQLL+RQ+FM+
Sbjct  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124

Query  123  RKSGPPRPIF  132
            RKSGPPRPIF
Sbjct  125  RKSGPPRPIF  134

>PHYKE_8392
Length=138

 Score = 219 bits (557),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 119/132 (90%), Gaps = 2/132 (2%)

Query  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
            ELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FR+HGD +DPKEVS L+Q AQSSLSYLKI
Sbjct  7    ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLKI  66

Query  63   VTPR--AESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            VTPR   ESN+GVQRYIYRNGQRVNAAE EEKG ENAR+K QDME GLKRHHQL++RQ+F
Sbjct  67   VTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHF  126

Query  121  MNRKSGPPRPIF  132
            M+RKSGPPRP+F
Sbjct  127  MDRKSGPPRPMF  138

>HYAP_07103
Length=164

 Score = 199 bits (505),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 121/164 (74%), Gaps = 35/164 (21%)

Query  4    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIV  63
            +RPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGD TDPKEVS+L+QRAQSS+ +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  64   TPRAE-----------------------------------SNTGVQRYIYRNGQRVNAAE  88
            TPRAE                                   S+TG+QR++YR+G+R++AAE
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  89   FEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRKSGPPRPIF  132
             ++KG ENAR+K QD+E G+KRHHQLL+RQ+FM+RKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 177 bits (448),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)

Query  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
            +ELRPLYKKLLRLAQSLPEPKR S++ QIR +FRSH + TD  EV+ L+QRAQS L YLK
Sbjct  5    AELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLK  64

Query  62   IVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFM  121
            IVTPR  S +GV+RYIYRNGQRV+A   E  G + AR+K  DMEG LKRHHQLL+RQ+FM
Sbjct  65   IVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFM  124

Query  122  NRKSGPPRPIF  132
            +R   PPRPIF
Sbjct  125  DRGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 156 bits (394),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 106/132 (80%), Gaps = 2/132 (2%)

Query  2    SELRPLYKKLLRLAQSLP-EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
            SELRPLYK+LLRLA+SLP E KR++++ QIR +FRS  D  DPKEV+AL+QRAQ+ + YL
Sbjct  4    SELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYL  63

Query  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            KIVTPR+ ++ GV+ ++Y NG+RV++++ + +  E AR+K  D EG ++RH+QLL+RQ+F
Sbjct  64   KIVTPRSTADAGVKSFVYVNGKRVDSSDVQTRE-EGARYKTIDFEGNMRRHNQLLRRQHF  122

Query  121  MNRKSGPPRPIF  132
            M+R   PP+PIF
Sbjct  123  MDRGVAPPKPIF  134

>PYIW_19970
Length=130

 Score = 140 bits (352),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 96/122 (79%), Gaps = 3/122 (2%)

Query  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
            +LRP+YKKLL+LA++LPE KR+++  QIR +FRS  + +DPKE++AL+ RAQSS+SYLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122
            VTPR  S+ GV+ YIY+NGQRV AA   E G   A++++ D  G + RH +LL+RQ+FM+
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  123  RK  124
            RK
Sbjct  129  RK  130

>PYU1_G001736
Length=123

 Score = 139 bits (349),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 95/123 (77%), Gaps = 3/123 (2%)

Query  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
            S+LRP+YKKLL+LAQ+LP  KRQ++++QIRR+FR+H    DPKE++AL+ RAQSS+ YLK
Sbjct  4    SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLK  63

Query  62   IVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFM  121
            IVTPRA S+ GV+ Y+Y  G+RV AA   E   + AR+K  D    ++RH QLL+RQ+FM
Sbjct  64   IVTPRATSDAGVKNYVYIKGKRVEAAGAAE---DGARYKTADYNAQMQRHVQLLRRQHFM  120

Query  122  NRK  124
            +RK
Sbjct  121  DRK  123

>CCA17542
Length=120

 Score = 132 bits (333),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 95/123 (77%), Gaps = 3/123 (2%)

Query  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
            MS+ R +YK+L+RLA+SLP  K+ +++  IR +FR H D +DP ++S L++RAQS++ YL
Sbjct  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60

Query  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            KIVTP   S++GV+R+++++G+R+   E   K  E AR+K+QD+  GLKRHHQLL+RQ+F
Sbjct  61   KIVTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHF  117

Query  121  MNR  123
            M+R
Sbjct  118  MDR  120

>CCI44820
Length=123

 Score = 123 bits (308),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 93/123 (76%), Gaps = 3/123 (2%)

Query  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
            ++E R ++KK+++LA+SLP  K+  ++  IR +FR H D  DP +++ L++RAQS++ YL
Sbjct  4    VNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYL  63

Query  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            KIVTP   S++GV+ ++Y++G+R+   E   +  E A++K+QDME GLKRH+QL++RQYF
Sbjct  64   KIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYF  120

Query  121  MNR  123
            M+R
Sbjct  121  MDR  123

>PYIR_13454
Length=129

 Score = 122 bits (307),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 94/124 (76%), Gaps = 3/124 (2%)

Query  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
            + +LRP+YKKLL+LA++LPE KR +++ QIR +FR+  D +DPKE++AL+ RAQSS+ YL
Sbjct  9    LGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68

Query  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            KIVTPR  S+ GV+ YIY+NGQRV A    E G   A++ + D    ++RH +LL+RQ+F
Sbjct  69   KIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRRQHF  125

Query  121  MNRK  124
            M+RK
Sbjct  126  MDRK  129

>H257_06293
Length=123

 Score = 110 bits (276),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 86/121 (71%), Gaps = 2/121 (2%)

Query  4    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIV  63
            +R  YKKL++LAQSLP  ++ +++D+IR DFRS G  +  +E+  L+ +AQS +SYLKIV
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64

Query  64   TPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNR  123
            TP+    +G QR+IY++G+R+++   ++ G  N   K  D+   ++RH +L++RQ+FM+R
Sbjct  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDR  122

Query  124  K  124
            K
Sbjct  123  K  123

>H310_09224
Length=123

 Score = 107 bits (267),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 82/121 (68%), Gaps = 2/121 (2%)

Query  4    LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIV  63
            +R  YKKL++LAQSLP  ++  ++D++R +FRSHG  T   ++  ++ +AQS +SYLKIV
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64

Query  64   TPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNR  123
            TP+    T  QRYIY++G+R++    ++    NA  K  D    ++RH +L++RQ+FM+R
Sbjct  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQST--NATIKTVDFNAMMERHVKLVRRQHFMDR  122

Query  124  K  124
            K
Sbjct  123  K  123

>SDRG_01782
Length=123

 Score = 105 bits (261),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 85/124 (69%), Gaps = 4/124 (3%)

Query  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
            + +R  YKKLL+LA+S+P+ +R  +++++R +FR+H     P+E+  L+++AQS +SYLK
Sbjct  3    ATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLK  62

Query  62   IVTP-RAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            IVTP ++ S+T    ++Y+NGQR++  E      ++A  K  D    + +H QL++RQ+F
Sbjct  63   IVTPKKSSSSTQGSHFVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHF  119

Query  121  MNRK  124
            M+RK
Sbjct  120  MDRK  123

>SPRG_06335
Length=123

 Score = 102 bits (253),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 83/124 (67%), Gaps = 4/124 (3%)

Query  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
            + +R  YKKLL+LA+S+P+ +R  +++++R +FR+H     P+E+  L+++AQS +SYLK
Sbjct  3    TTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLK  62

Query  62   IVTPRAESNTGV-QRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120
            IVTP+   + G    ++Y+NGQR++  E      ++A  K  D    + +H QL++RQ+F
Sbjct  63   IVTPKKSPSPGQGNHFVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHF  119

Query  121  MNRK  124
            M+RK
Sbjct  120  MDRK  123

>HYAP_08499
Length=108

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 38/61 (62%), Gaps = 0/61 (0%)

Query  2   SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
           +E+  +Y+++L+LAQ  P  KRQS I  I+ +FR++ + +D ++V   +   Q+ +  L 
Sbjct  5   NEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELS  64

Query  62  I  62
           +
Sbjct  65  M  65

>HYAP_08500
Length=172

 Score = 38.1 bits (87),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 38/61 (62%), Gaps = 0/61 (0%)

Query  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
            +E+  +Y+++L+LAQ  P  KRQS I  I+ +FR++ + +D ++V   +   Q+ +  L 
Sbjct  69   NEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELS  128

Query  62   I  62
            +
Sbjct  129  M  129

>PHALS_11564
Length=107

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  7   LYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
           +Y++LL+LAQ  P  KR++ I  I+ +F ++   TD +++   +  A + +  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>PHYKE_5841
Length=121

 Score = 37.0 bits (84),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 35/60 (58%), Gaps = 0/60 (0%)

Query  1   MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           + E+  +Y+++L+LAQ  P  KR S I  I+ +F +H   TD +++   +  A++ +  L
Sbjct  4   VKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>PITG_13739
Length=105

 Score = 36.2 bits (82),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 37/60 (62%), Gaps = 0/60 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
           E+  +Y+++L+LAQ  P  KR+S I  I+ +F ++ D TD +++   +   ++ ++ L +
Sbjct  6   EVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELSM  65

>CCA17521
Length=104

 Score = 36.2 bits (82),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 0/59 (0%)

Query  2   SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           +++  LY+++LRLA+  P  KR + I+ IR +FR   D T    +   I  A + +  L
Sbjct  4   TQIFGLYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PYU1_G005963
Length=103

 Score = 36.2 bits (82),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 0/58 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           E+  +Y+++L+LA   P  KR + I  I+ +FR +   TD   + A +Q A+  +  L
Sbjct  6   EVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63

>PPTG_09252
Length=105

 Score = 35.8 bits (81),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 37/60 (62%), Gaps = 0/60 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62
           E+  LY+++L+LAQ  P  KR+S I  I+ +F ++ + TD +++   +   ++ ++ L +
Sbjct  6   EVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65

>PHYSO_315017
Length=109

 Score = 35.8 bits (81),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 30/44 (68%), Gaps = 0/44 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEV  46
           E+  +Y+++L+LAQ  P  KR+S I  I+ +F ++ D TD +++
Sbjct  6   EVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKI  49

>PHYRA_75193
Length=104

 Score = 35.8 bits (81),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  7   LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLS-YLKIV  63
           LY+  +RLAQ +     K Q+  D +RR+F    D TDP++V AL   A   LS YL + 
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANAIRGLSNYLMLA  73

Query  64  T  64
            
Sbjct  74  N  74

>CCI44232
Length=105

 Score = 35.4 bits (80),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 8/92 (9%)

Query  7   LYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI---V  63
           LY+++LRLA+  P  KR + ++ IR +FR   +   P  +   I  A + +  L +   +
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKELMMYANL  68

Query  64  TPRAESNTGVQRYIYRNGQRVNAAEFEEKGVE  95
            P  E+N  V+  I R  ++  AA+ ++K VE
Sbjct  69  NP-VEANWTVE--IGRPSEK--AADIDQKRVE  95

>PYIW_14293
Length=104

 Score = 34.3 bits (77),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 3/57 (5%)

Query  7   LYKKLLRLAQSLP-EPKRQSSI-DQIRRDFRSHGDPTDPKEVSALIQRAQSSLS-YL  60
           LY+  +RLA+ +    K+ S+I D IRR+F    D TDP+++ AL   A   LS YL
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEALKTNAIRGLSNYL  69

>PYVX_20854
Length=104

 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (57%), Gaps = 0/58 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           E+  LY+++L+LAQ  P  KR S +  I+ +F  +   +D ++V   I  A++ +  L
Sbjct  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>PYVX_15150
Length=746

 Score = 34.7 bits (78),  Expect = 0.13, Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQI--RRDFRSHGDPTDPKEVSALIQ--RAQSS  56
            +SEL   +  +  LA+ L  P    + + +     FRS  D ++   V  +++  R+  S
Sbjct  579  ISELDCDFDDVAILAKELARPSSLVAQNVLCWSYSFRSEADTSESGRVEGILEMLRSNCS  638

Query  57   LSYLKIVTPRAESNTGVQRY  76
            L YL +V PR + +  ++R+
Sbjct  639  LQYLSLVMPREQHDASLERF  658

>PHYRA_81675
Length=106

 Score = 31.6 bits (70),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEV  46
           E+  +Y+++L+LAQ  P  KR S I  I+ +F ++   TD +++
Sbjct  6   EVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKI  49

>PHYKE_5532
Length=122

 Score = 32.0 bits (71),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query  27  IDQIRRDFRSHGDP---TDPKEVSALIQRAQSSLSYLKIVTP  65
           ID +  DF  HGD     D   VS +  R QS++ +L ++  
Sbjct  45  IDLVNTDFEGHGDIKKLVDGYAVSGVAVRIQSAILFLSLIVA  86

>PHYCA_540461
Length=104

 Score = 31.2 bits (69),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  7   LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLS-YLKIV  63
           LY+  LRLA+ +     K Q+  D +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  64  T  64
            
Sbjct  74  N  74

>PHYCA_535380
Length=108

 Score = 30.8 bits (68),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 27/44 (61%), Gaps = 0/44 (0%)

Query  3   ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEV  46
           E+  +Y+++L+LA   P  KR+S I  I+ +F ++   TD + +
Sbjct  6   EVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRI  49

>PYVX_18358
Length=62

 Score = 29.6 bits (65),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  7   LYKKLLRLAQSLP-EPKRQSSI-DQIRRDFRSHGDPTDPKEVSALIQRAQSSLS  58
           LY+  LRLA+ +  + K+  +I + +RR+F      TDP+++ AL   A   LS
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEALKANAIRGLS  54

>H310_07567
Length=98

 Score = 29.6 bits (65),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  7   LYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           +Y+++L+LA+  P  KR   ++ I+ +F  +   TDP ++   +  A   +  L
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQL  63

>CCA24056
Length=4270

 Score = 31.2 bits (69),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 4/61 (7%)

Query  56    SLSYLKIVTPRAESNTGVQRYI----YRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRH  111
             S+  L +V P+ ES   V   +    YR G R++A +      +N R K  D E     H
Sbjct  2039  SMEQLSMVVPKQESKDSVDEILGPVRYREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFH  2098

Query  112   H  112
             H
Sbjct  2099  H  2099

>PYIW_19705
Length=340

 Score = 30.8 bits (68),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 9/75 (12%)

Query  19   PEPKRQSSIDQI-----RRDFRSHGDPTDPK--EVSALIQRAQSSLSYLKIVTP--RAES  69
            PEPKR+S +D       RRD        D +  + +ALI R++S+++ L+ +T   RA +
Sbjct  231  PEPKRESDVDLTALLRQRRDILMKLSKLDQEKAKTNALISRSKSTIANLRRITSNGRAST  290

Query  70   NTGVQRYIYRNGQRV  84
            ++G   Y    G  V
Sbjct  291  SSGPHSYSLSRGSSV  305

>PHYSO_514323
Length=104

 Score = 29.6 bits (65),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  7   LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLS-YLKIV  63
           LY+  +RLA+ +     K Q+  + +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  14  LYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  64  T  64
            
Sbjct  74  N  74

>PITG_17701
Length=104

 Score = 29.6 bits (65),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  7   LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLS-YLKIV  63
           LY+  LRLA+ +     K Q+  + +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIRELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  64  T  64
            
Sbjct  74  N  74

>PYIR_18223
Length=105

 Score = 29.3 bits (64),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 3/57 (5%)

Query  7   LYKKLLRLAQSLP-EPKRQSSIDQ-IRRDFRSHGDPTDPKEVSALIQRAQSSLS-YL  60
           LY+  +RLA+ +  + K+  +I   +RR+F    D TDP+++ AL   A   LS YL
Sbjct  14  LYRDCMRLAKHIGGKSKKGIAIKSLVRREFEKARDETDPEKIEALKTNAIRGLSNYL  70

>PPTG_15655
Length=112

 Score = 29.3 bits (64),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 3/61 (5%)

Query  7   LYKKLLRLAQSLP--EPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLS-YLKIV  63
           LY+  LRLA+ +     K Q+  + +RR+F      TDP+++ AL   A   LS YL + 
Sbjct  22  LYRDCLRLAKHIGGNSKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  81

Query  64  T  64
            
Sbjct  82  N  82

>CCA27064
Length=100

 Score = 29.3 bits (64),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 43/88 (49%), Gaps = 5/88 (6%)

Query  7   LYKKLLRLAQSLP-EPKRQSSIDQ-IRRDFRSHGDPTDPKEVSALIQRAQSSLS-YLKIV  63
           LY+  LRLA+ +    K+  +I + +RR+F      TDP+++ AL   A   LS YL  V
Sbjct  14  LYRDCLRLAKHIGGSSKKGLAIKELVRREFDKGKLETDPEKIEALKANAVRGLSNYL--V  71

Query  64  TPRAESNTGVQRYIYRNGQRVNAAEFEE  91
              A  +  ++  +  +      AEF E
Sbjct  72  MANASKDIKLKNAMKTDANAPQEAEFRE  99

>PYIR_25099
Length=517

 Score = 30.0 bits (66),  Expect = 3.9, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 6/70 (9%)

Query  12  LRLAQSLPEPKRQSSIDQIRRDFRSHG-----DPTDPKEVSALIQRAQSSLSYLKIVTPR  66
           L +A S  +  + +S+ ++R DFR H      DP  P EV A ++      + L    P 
Sbjct  14  LFIATSSSDAHKHTSMHKLR-DFRGHSYHVHFDPEGPTEVQAPVEEKYYEHAILDHFAPL  72

Query  67  AESNTGVQRY  76
           A      QRY
Sbjct  73  AGRKYWKQRY  82

>SDRG_14912
Length=105

 Score = 28.9 bits (63),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 27/54 (50%), Gaps = 0/54 (0%)

Query  7   LYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           +Y+++L+LAQ  P  K+   +  I+ +F  +   TD  ++   I  A   +  L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>SPRG_12883
Length=105

 Score = 28.9 bits (63),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 27/54 (50%), Gaps = 0/54 (0%)

Query  7   LYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60
           +Y+++L+LAQ  P  K+   +  I+ +F  +   TD  ++   I  A   +  L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>PYAP_24867
Length=147

 Score = 28.9 bits (63),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 21/76 (28%), Positives = 35/76 (46%), Gaps = 3/76 (4%)

Query  2   SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61
           S++   Y + LR+ Q L E  R+    QIR  F  +    D K+V   I++ +  L +  
Sbjct  20  SQVLAQYHEFLRITQPLAEDTRRDVRQQIRAAFDMYRHVEDEKQVMQFIRQGREQLKH--  77

Query  62  IVTPRAESNTGVQRYI  77
            V+   +S    QR +
Sbjct  78  -VSDLVDSAVARQRVV  92

>H257_07358
Length=98

 Score = 28.1 bits (61),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 33/66 (50%), Gaps = 3/66 (5%)

Query  7   LYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK---IV  63
           +Y+++L+LA   P  K++  +  I+ +F  +   TDP ++   I  A   +  L     +
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIAIKGIQQLNQYVAL  69

Query  64  TPRAES  69
            P A+S
Sbjct  70  DPNAQS  75

Lambda      K        H        a         alpha
   0.317    0.133    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3315890592

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40