Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_184531475425225212048e-169
PPTG_171251475428323211671e-162
PHYCA_1294851475425123211015e-153
PHYRA_811021475425123210182e-140
PHYRA_725046951625123210182e-140
PHYRA_7182580282542318142e-109
PITG_0971680282502327465e-99
PHYRA_81103712622522347465e-99
PPTG_0889380282512327404e-98
PPTG_16851236932492327282e-96
PHYCA_12149480282482327213e-95
PHYCA_10034368662742327155e-94
PHYSO_26126580282472537092e-93
PHYKE_6286599492502327041e-92
PHYSO_254108170262462306701e-87
PHYCA_118548170262462306674e-87
PHYRA_74356698952442306613e-86
PPTG_07664170262452306535e-85
PHYCA_9298368522482336475e-84
PHYRA_74306205112452306441e-83
PITG_22053170262452306431e-83
PITG_19936157132492326441e-83
PITG_04208205112452306432e-83
PPTG_17049237772552336432e-83
PHYCA_132252157132492336302e-81
PHYCA_118674205112812326332e-81
PITG_19938353892452286275e-81
PITG_0424836902452306232e-80
PHYSO_526774157132492386206e-80
PHYSO_526832353892492336181e-79
PHYCA_11855136902452306171e-79
PHYRA_52440170262432286162e-79
PPTG_0767136902462306152e-79
PHYSO_526623599492492336144e-79
PHYSO_52607137012492336128e-79
PITG_0420036612472316042e-77
PHYRA_74343698872492336032e-77
PITG_0426737012792335983e-76
PHYRA_74307422182492335954e-76
PHYCA_122048693172362315883e-75
PHYRA_72386459152452315867e-75
PHYRA_72344817002452315867e-75
PPTG_15224963762462305868e-75
PHYRA_74310599492492325841e-74
PHYCA_107869246513422345913e-74
PHYCA_123779173642772365853e-74
PHYSO_329843510942392325813e-74
PHYRA_76249246513262345884e-74
PPTG_19331246513682305916e-74
PHYKE_2376459153222315876e-74
PHYSO_507736135312362305771e-73
PHYSO_249692459152482315772e-73
PHYRA_5242336901932015694e-73
PHYSO_527352600202452315728e-73
PPTG_15230817002522315739e-73
PHYCA_129784817002462315711e-72
PPTG_17409743732352305673e-72
PPTG_06973368661651665571e-71
PHYCA_11951135312342275622e-71
PHYRA_71477693172382305632e-71
PHYCA_9358368552522405633e-71
PPTG_08017207076162345903e-71
PHYRA_71404563202452315623e-71
PHYRA_72433694822452315614e-71
PPTG_15233231122352295604e-71
PPTG_17245238632572395625e-71
PHYKE_4438758943392345686e-71
PHYRA_72438135312362295596e-71
PHYSO_406265173642322365596e-71
PHYRA_4287689222132325542e-70
PYVX_22467135312362345562e-70
PHYRA_71308231122362295552e-70
PHYCA_108039563202152345506e-70
PPTG_0766037012162205482e-69
PHYCA_11835636612522325512e-69
PHYSO_259736247322312305492e-69
PITG_22668173645192365703e-69
PHYRA_71618578972432345475e-69
PHYSO_25411236902242285455e-69
PHYKE_5753763302382305466e-69
PHYRA_71931510942392315441e-68
PHYSO_468315563202552315442e-68
PPTG_08005173647592365782e-68
PHYRA_71588693332422335423e-68
PHYKE_494670892632365417e-68
PYU1_G011237817002352295371e-67
PPTG_18464243182472335363e-67
PHYKE_7564459204732315543e-67
PYU1_G011231459142382285344e-67
PHYRA_72475695022432345336e-67
PHALS_06162173644882365528e-67
PHYRA_72345517562402315321e-66
PHYCA_18373353892462115311e-66
PPTG_19330563203162355362e-66
PHYSO_397673703072242305264e-66
PPTG_07089202542552365294e-66
PHYCA_119748423082612365295e-66
PHYSO_414520550602132325238e-66
PITG_22916720282482325269e-66
PYIR_13251817002362285241e-65
PHYRA_74617699543372345312e-65
PPTG_07661600202232255212e-65
PHYRA_72165599392402345232e-65
PHYCA_10840970892822365253e-65
PHYSO_334487517562582315233e-65
PPTG_12852223223312365293e-65
PPTG_12847511263312365294e-65
PHYSO_51088870892552325224e-65
PPTG_1285370893422365304e-65
PHYSO_334498517572292185196e-65
PYU1_G011233694602392295206e-65
PHYRA_49009690712162315169e-65
PPTG_19506247322232255171e-64
PHYCA_69480391942132325151e-64
PHYCA_69477391922132325142e-64
PHYKE_7566459142602295173e-64
PPTG_13769592663492345244e-64
PHYRA_74630202543432345235e-64
PPTG_13736226162362315127e-64
PPTG_15231135312582295131e-63
PYU1_G011235963762382295111e-63
PHYKE_5655578972432345112e-63
PYIR_13252817012362285093e-63
HYAP_0924370892662295113e-63
PPTG_2217436987712315433e-63
PHYKE_4541759501471475003e-63
PHYRA_83592763302372305041e-62
PITG_0852270893822365152e-62
PHYRA_52960691982232285003e-62
PHYRA_52955691972232285003e-62
PYU1_G011236135312372325014e-62
PHYSO_249751459202382305015e-62
PHYRA_46230550602122314985e-62
PYU1_G011230817012382284998e-62
PPTG_07277203402982365048e-62
PHYRA_5432770892192304971e-61
PHYCA_69479391932132324942e-61
PHYRA_43347688002202054933e-61
PYIR_13275135312372334944e-61
PYIW_25259817002462414955e-61
PHYRA_72390592662372304928e-61
PITG_22734422181681534841e-60
PHYRA_72477695042382334893e-60
PITG_16866135312382304875e-60
PHYRA_45457517571992014836e-60
PHYRA_86968733682392334866e-60
PHYSO_330015511262412334851e-59
HYAP_06628642572452314832e-59
PHYCA_683589222102164794e-59
PHYSO_526541599392392334814e-59
PHYCA_12462369161771634755e-59
PHYRA_44405688542322314805e-59
PHYCA_132529435382322364806e-59
PHYRA_72385694602372304798e-59
PHYSO_336498177692382324772e-58
PHYSO_490000575402412544772e-58
PHYSO_496064578972542444782e-58
PHYCA_123205425681771634703e-58
PHYKE_7568608783722294854e-58
PHYRA_39489686262372314736e-58
PPTG_15234608782352294727e-58
PHYRA_71307608782372294728e-58
PHYSO_254099368522352334729e-58
PHYRA_71310459142372304721e-57
PPTG_004608462592274731e-57
PHYCA_69457511262132324691e-57
PHYRA_84273720242372324667e-57
HYAP_08306563202862324707e-57
PHYSO_255972205112152314639e-57
PHALS_0608470892602364671e-56
PHYRA_75425176762372294651e-56
PHYRA_41766511262092314621e-56
PPTG_13026694282382314641e-56
PHYRA_52426600201521604561e-56
PHYSO_560790608782372314642e-56
PHYSO_329114510052362024632e-56
PHYCA_129892608782342294614e-56
PPTG_17295238912382324606e-56
PHYCA_576423176762342294599e-56
PPTG_14652229162572324609e-56
PHYRA_76657703212392334581e-55
PHYRA_84277720282402344562e-55
PPTG_07991207012762344583e-55
PHYSO_423056554102332194544e-55
PHYKE_8391147537781414854e-55
HYAP_07436646842672284558e-55
PPTG_04799194622452394539e-55
PHYRA_72531695292362324511e-54
HYAP_07925649412672284541e-54
PHYSO_365942537682332234502e-54
PHALS_13513157132402374502e-54
PITG_23211177602452294484e-54
PHYRA_52260691692342294466e-54
PITG_23228177692542474477e-54
PHYCA_123797207012412344461e-53
PHYRA_5242737011241324351e-53
PPTG_00471720282392274451e-53
PYVX_22469517584742314621e-53
PPTG_17453177692542484461e-53
PITG_22981175962592284462e-53
PITG_009578462982344482e-53
PHYSO_365377537622202274412e-53
PHYCA_553546452582802724462e-53
PHYSO_52785036611951764393e-53
PPTG_11469451342532484443e-53
PHYRA_72403694692392334414e-53
PHYSO_334500517582352294414e-53
PHYRA_47241690031761604355e-53
PHYKE_208743731871604365e-53
PHYSO_504553689972572454418e-53
PHYCA_109174413332772744428e-53
PHYCA_124462426702802724438e-53
PHYRA_83851719182392354381e-52
PHYSO_521124595742542424382e-52
PPTG_18463452582542504372e-52
PHALS_14425357673022304412e-52
PPTG_08703209012542484373e-52
PHYCA_109095413122772714375e-52
PHYSO_482931571392542474356e-52
PHYCA_109089173962772704367e-52
PHYRA_72430461762382314329e-52
PHYRA_72306694282382314329e-52
PHYRA_76603703072392334329e-52
PHYSO_254223422182272344311e-51
PHALS_1442380283792354412e-51
PHYCA_544885451342562494322e-51
PHYCA_124383426672802714332e-51
PITG_23076176682762714323e-51
PHYSO_514298591312642424304e-51
PHYRA_72541695342392334284e-51
PHYCA_109192413382782764314e-51
PHYSO_328418509152192284265e-51
PITG_23051176512802444298e-51
PPTG_13004176512552454271e-50
PHYSO_480321570042542474261e-50
PHYCA_10570176672782754281e-50
PHYSO_253029461762522334261e-50
PHYSO_246397456772642434252e-50
PHYCA_114913419272242274222e-50
PHYCA_108964694282772714263e-50
PPTG_15262459142332324223e-50
PHYRA_47103689972262224204e-50
PHALS_12600147542672294235e-50
PHALS_13512353892432284208e-50
HYAP_04977634662622264218e-50
PHYSO_516261592662272324181e-49
PHYCA_69122177692492474191e-49
HYAP_14846685472212384161e-49
HYAP_05559637032622264201e-49
PPTG_05581173962752704211e-49
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18453

Length=252
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18453                                                            468        8e-169
PPTG_17125                                                            454        1e-162
PHYCA_129485                                                          428        5e-153
PHYRA_81102                                                           396        2e-140
PHYRA_72504                                                           396        2e-140
PHYRA_71825                                                           318        2e-109
PITG_09716                                                            291        5e-99 
PHYRA_81103                                                           291        5e-99 
PPTG_08893                                                            289        4e-98 
PPTG_16851                                                            285        2e-96 
PHYCA_121494                                                          282        3e-95 
PHYCA_10034                                                           280        5e-94 
PHYSO_261265                                                          277        2e-93 
PHYKE_6286                                                            275        1e-92 
PHYSO_254108                                                          262        1e-87 
PHYCA_118548                                                          261        4e-87 
PHYRA_74356                                                           259        3e-86 
PPTG_07664                                                            256        5e-85 
PHYCA_9298                                                            253        5e-84 
PHYRA_74306                                                           252        1e-83 
PITG_22053                                                            252        1e-83 
PITG_19936                                                            252        1e-83 
PITG_04208                                                            252        2e-83 
PPTG_17049                                                            252        2e-83 
PHYCA_132252                                                          247        2e-81 
PHYCA_118674                                                          248        2e-81 
PITG_19938                                                            246        5e-81 
PITG_04248                                                            244        2e-80 
PHYSO_526774                                                          243        6e-80 
PHYSO_526832                                                          242        1e-79 
PHYCA_118551                                                          242        1e-79 
PHYRA_52440                                                           241        2e-79 
PPTG_07671                                                            241        2e-79 
PHYSO_526623                                                          241        4e-79 
PHYSO_526071                                                          240        8e-79 
PITG_04200                                                            237        2e-77 
PHYRA_74343                                                           236        2e-77 
PITG_04267                                                            234        3e-76 
PHYRA_74307                                                           233        4e-76 
PHYCA_122048                                                          231        3e-75 
PHYRA_72386                                                           230        7e-75 
PHYRA_72344                                                           230        7e-75 
PPTG_15224                                                            230        8e-75 
PHYRA_74310                                                           229        1e-74 
PHYCA_107869                                                          232        3e-74 
PHYCA_123779                                                          229        3e-74 
PHYSO_329843                                                          228        3e-74 
PHYRA_76249                                                           231        4e-74 
PPTG_19331                                                            232        6e-74 
PHYKE_2376                                                            230        6e-74 
PHYSO_507736                                                          226        1e-73 
PHYSO_249692                                                          226        2e-73 
PHYRA_52423                                                           223        4e-73 
PHYSO_527352                                                          224        8e-73 
PPTG_15230                                                            225        9e-73 
PHYCA_129784                                                          224        1e-72 
PPTG_17409                                                            223        3e-72 
PPTG_06973                                                            219        1e-71 
PHYCA_11951                                                           221        2e-71 
PHYRA_71477                                                           221        2e-71 
PHYCA_9358                                                            221        3e-71 
PPTG_08017                                                            231        3e-71 
PHYRA_71404                                                           221        3e-71 
PHYRA_72433                                                           220        4e-71 
PPTG_15233                                                            220        4e-71 
PPTG_17245                                                            221        5e-71 
PHYKE_4438                                                            223        6e-71 
PHYRA_72438                                                           219        6e-71 
PHYSO_406265                                                          219        6e-71 
PHYRA_42876                                                           218        2e-70 
PYVX_22467                                                            218        2e-70 
PHYRA_71308                                                           218        2e-70 
PHYCA_108039                                                          216        6e-70 
PPTG_07660                                                            215        2e-69 
PHYCA_118356                                                          216        2e-69 
PHYSO_259736                                                          216        2e-69 
PITG_22668                                                            224        3e-69 
PHYRA_71618                                                           215        5e-69 
PHYSO_254112                                                          214        5e-69 
PHYKE_5753                                                            214        6e-69 
PHYRA_71931                                                           214        1e-68 
PHYSO_468315                                                          214        2e-68 
PPTG_08005                                                            227        2e-68 
PHYRA_71588                                                           213        3e-68 
PHYKE_4946                                                            213        7e-68 
PYU1_G011237                                                          211        1e-67 
PPTG_18464                                                            211        3e-67 
PHYKE_7564                                                            218        3e-67 
PYU1_G011231                                                          210        4e-67 
PHYRA_72475                                                           209        6e-67 
PHALS_06162                                                           217        8e-67 
PHYRA_72345                                                           209        1e-66 
PHYCA_18373                                                           209        1e-66 
PPTG_19330                                                            211        2e-66 
PHYSO_397673                                                          207        4e-66 
PPTG_07089                                                            208        4e-66 
PHYCA_119748                                                          208        5e-66 
PHYSO_414520                                                          206        8e-66 
PITG_22916                                                            207        9e-66 
PYIR_13251                                                            206        1e-65 
PHYRA_74617                                                           209        2e-65 
PPTG_07661                                                            205        2e-65 
PHYRA_72165                                                           206        2e-65 
PHYCA_108409                                                          206        3e-65 
PHYSO_334487                                                          206        3e-65 
PPTG_12852                                                            208        3e-65 
PPTG_12847                                                            208        4e-65 
PHYSO_510888                                                          205        4e-65 
PPTG_12853                                                            208        4e-65 
PHYSO_334498                                                          204        6e-65 
PYU1_G011233                                                          204        6e-65 
PHYRA_49009                                                           203        9e-65 
PPTG_19506                                                            203        1e-64 
PHYCA_69480                                                           202        1e-64 
PHYCA_69477                                                           202        2e-64 
PHYKE_7566                                                            203        3e-64 
PPTG_13769                                                            206        4e-64 
PHYRA_74630                                                           206        5e-64 
PPTG_13736                                                            201        7e-64 
PPTG_15231                                                            202        1e-63 
PYU1_G011235                                                          201        1e-63 
PHYKE_5655                                                            201        2e-63 
PYIR_13252                                                            200        3e-63 
HYAP_09243                                                            201        3e-63 
PPTG_22174                                                            213        3e-63 
PHYKE_4541                                                            197        3e-63 
PHYRA_83592                                                           198        1e-62 
PITG_08522                                                            202        2e-62 
PHYRA_52960                                                           197        3e-62 
PHYRA_52955                                                           197        3e-62 
PYU1_G011236                                                          197        4e-62 
PHYSO_249751                                                          197        5e-62 
PHYRA_46230                                                           196        5e-62 
PYU1_G011230                                                          196        8e-62 
PPTG_07277                                                            198        8e-62 
PHYRA_54327                                                           196        1e-61 
PHYCA_69479                                                           194        2e-61 
PHYRA_43347                                                           194        3e-61 
PYIR_13275                                                            194        4e-61 
PYIW_25259                                                            195        5e-61 
PHYRA_72390                                                           194        8e-61 
PITG_22734                                                            191        1e-60 
PHYRA_72477                                                           192        3e-60 
PITG_16866                                                            192        5e-60 
PHYRA_45457                                                           190        6e-60 
PHYRA_86968                                                           191        6e-60 
PHYSO_330015                                                          191        1e-59 
HYAP_06628                                                            190        2e-59 
PHYCA_6835                                                            189        4e-59 
PHYSO_526541                                                          189        4e-59 
PHYCA_12462                                                           187        5e-59 
PHYRA_44405                                                           189        5e-59 
PHYCA_132529                                                          189        6e-59 
PHYRA_72385                                                           189        8e-59 
PHYSO_336498                                                          188        2e-58 
PHYSO_490000                                                          188        2e-58 
PHYSO_496064                                                          188        2e-58 
PHYCA_123205                                                          185        3e-58 
PHYKE_7568                                                            191        4e-58 
PHYRA_39489                                                           186        6e-58 
PPTG_15234                                                            186        7e-58 
PHYRA_71307                                                           186        8e-58 
PHYSO_254099                                                          186        9e-58 
PHYRA_71310                                                           186        1e-57 
PPTG_00460                                                            186        1e-57 
PHYCA_69457                                                           185        1e-57 
PHYRA_84273                                                           184        7e-57 
HYAP_08306                                                            185        7e-57 
PHYSO_255972                                                          182        9e-57 
PHALS_06084                                                           184        1e-56 
PHYRA_75425                                                           183        1e-56 
PHYRA_41766                                                           182        1e-56 
PPTG_13026                                                            183        1e-56 
PHYRA_52426                                                           180        1e-56 
PHYSO_560790                                                          183        2e-56 
PHYSO_329114                                                          182        2e-56 
PHYCA_129892                                                          182        4e-56 
PPTG_17295                                                            181        6e-56 
PHYCA_576423                                                          181        9e-56 
PPTG_14652                                                            181        9e-56 
PHYRA_76657                                                           181        1e-55 
PHYRA_84277                                                           180        2e-55 
PPTG_07991                                                            181        3e-55 
PHYSO_423056                                                          179        4e-55 
PHYKE_8391                                                            191        4e-55 
HYAP_07436                                                            179        8e-55 
PPTG_04799                                                            179        9e-55 
PHYRA_72531                                                           178        1e-54 
HYAP_07925                                                            179        1e-54 
PHYSO_365942                                                          177        2e-54 
PHALS_13513                                                           177        2e-54 
PITG_23211                                                            177        4e-54 
PHYRA_52260                                                           176        6e-54 
PITG_23228                                                            176        7e-54 
PHYCA_123797                                                          176        1e-53 
PHYRA_52427                                                           172        1e-53 
PPTG_00471                                                            176        1e-53 
PYVX_22469                                                            182        1e-53 
PPTG_17453                                                            176        1e-53 
PITG_22981                                                            176        2e-53 
PITG_00957                                                            177        2e-53 
PHYSO_365377                                                          174        2e-53 
PHYCA_553546                                                          176        2e-53 
PHYSO_527850                                                          173        3e-53 
PPTG_11469                                                            175        3e-53 
PHYRA_72403                                                           174        4e-53 
PHYSO_334500                                                          174        4e-53 
PHYRA_47241                                                           172        5e-53 
PHYKE_208                                                             172        5e-53 
PHYSO_504553                                                          174        8e-53 
PHYCA_109174                                                          174        8e-53 
PHYCA_124462                                                          175        8e-53 
PHYRA_83851                                                           173        1e-52 
PHYSO_521124                                                          173        2e-52 
PPTG_18463                                                            172        2e-52 
PHALS_14425                                                           174        2e-52 
PPTG_08703                                                            172        3e-52 
PHYCA_109095                                                          172        5e-52 
PHYSO_482931                                                          172        6e-52 
PHYCA_109089                                                          172        7e-52 
PHYRA_72430                                                           171        9e-52 
PHYRA_72306                                                           171        9e-52 
PHYRA_76603                                                           171        9e-52 
PHYSO_254223                                                          170        1e-51 
PHALS_14423                                                           174        2e-51 
PHYCA_544885                                                          171        2e-51 
PHYCA_124383                                                          171        2e-51 
PITG_23076                                                            171        3e-51 
PHYSO_514298                                                          170        4e-51 
PHYRA_72541                                                           169        4e-51 
PHYCA_109192                                                          170        4e-51 
PHYSO_328418                                                          168        5e-51 
PITG_23051                                                            169        8e-51 
PPTG_13004                                                            169        1e-50 
PHYSO_480321                                                          168        1e-50 
PHYCA_10570                                                           169        1e-50 
PHYSO_253029                                                          168        1e-50 
PHYSO_246397                                                          168        2e-50 
PHYCA_114913                                                          167        2e-50 
PHYCA_108964                                                          168        3e-50 
PPTG_15262                                                            167        3e-50 
PHYRA_47103                                                           166        4e-50 
PHALS_12600                                                           167        5e-50 
PHALS_13512                                                           166        8e-50 
HYAP_04977                                                            166        8e-50 
PHYSO_516261                                                          165        1e-49 
PHYCA_69122                                                           166        1e-49 
HYAP_14846                                                            164        1e-49 
HYAP_05559                                                            166        1e-49 
PPTG_05581                                                            166        1e-49 
PHYSO_249691                                                          164        2e-49 
PITG_22709                                                            166        2e-49 
PHYRA_52296                                                           164        4e-49 
HYAP_05558                                                            164        5e-49 
PHYCA_109162                                                          164        6e-49 
PPTG_03796                                                            164        6e-49 
PHYSO_251206                                                          161        4e-48 
PPTG_15220                                                            160        1e-47 
PHYCA_123587                                                          160        2e-47 
PHYCA_109163                                                          159        2e-47 
PPTG_16647                                                            159        4e-47 
PITG_23094                                                            158        6e-47 
PPTG_06202                                                            159        7e-47 
PPTG_10591                                                            158        9e-47 
PPTG_04504                                                            157        2e-46 
PHYCA_133546                                                          158        2e-46 
PHYSO_480350                                                          157        3e-46 
PPTG_11475                                                            157        4e-46 
PHYCA_544875                                                          155        2e-45 
PPTG_00542                                                            154        5e-45 
HYAP_14784                                                            154        5e-45 
PHALS_08447                                                           152        1e-44 
PPTG_15218                                                            152        1e-44 
PPTG_05868                                                            152        2e-44 
PHALS_02474                                                           151        3e-44 
PITG_23075                                                            152        4e-44 
PHYCA_10715                                                           150        5e-44 
PHYRA_45462                                                           149        7e-44 
PHYRA_72357                                                           150        7e-44 
PHALS_08480                                                           150        1e-43 
PHALS_08947                                                           149        4e-43 
PHALS_03592                                                           149        6e-43 
PHYKE_7565                                                            146        1e-42 
PHYCA_133455                                                          145        1e-42 
PPTG_15219                                                            147        2e-42 
PHYSO_263794                                                          146        2e-42 
PHYSO_449487                                                          143        2e-42 
PHYKE_5284                                                            145        1e-41 
PHALS_08445                                                           144        3e-41 
PHYCA_118700                                                          143        3e-41 
PITG_23062                                                            143        1e-40 
PHALS_08945                                                           142        2e-40 
PHYCA_59113                                                           138        3e-40 
PPTG_07667                                                            138        4e-40 
PPTG_15860                                                            139        4e-40 
PITG_23055                                                            140        4e-40 
PYAP_24304                                                            140        5e-40 
PHYCA_132177                                                          140        7e-40 
PHYSO_481543                                                          137        8e-39 
HYAP_08846                                                            138        1e-38 
PYAP_24757                                                            137        1e-38 
PHALS_05391                                                           137        1e-38 
PPTG_11648                                                            138        2e-38 
PHYCA_5621                                                            135        4e-38 
PPTG_07668                                                            132        6e-38 
PHYSO_327908                                                          142        2e-37 
PHYCA_109151                                                          130        8e-37 
PYAP_24339                                                            130        2e-36 
PHYSO_246660                                                          130        6e-36 
PHALS_01213                                                           129        1e-35 
PHYSO_338051                                                          128        2e-35 
PHYSO_327912                                                          125        5e-34 
PHYSO_260049                                                          124        7e-34 
PHYSO_327911                                                          124        8e-34 
HYAP_07033                                                            123        9e-34 
PHYCA_109441                                                          123        1e-33 
PYAR_24955                                                            123        2e-33 
PHYSO_342831                                                          121        2e-33 
PHYSO_508915                                                          120        1e-32 
PHYCA_11676                                                           120        2e-32 
PHYSO_251461                                                          120        2e-32 
PITG_10839                                                            117        5e-32 
PHYSO_526791                                                          116        2e-31 
PHYSO_245789                                                          115        6e-31 
PHYRA_39486                                                           115        7e-31 
PHYSO_477165                                                          113        8e-31 
PHYSO_264058                                                          115        8e-31 
PHALS_05247                                                           117        9e-31 
PHYKE_1224                                                            113        1e-30 
PHYRA_39485                                                           114        1e-30 
PPTG_11479                                                            115        5e-30 
PYIW_24350                                                            112        9e-30 
PHYSO_257244                                                          114        1e-29 
PPTG_07690                                                            110        1e-29 
PHYSO_444351                                                          107        8e-29 
PHALS_13274                                                           110        5e-28 
PHYCA_73404                                                           104        9e-28 
PHYRA_44618                                                           105        2e-27 
PHYRA_52174                                                           107        3e-27 
PHYCA_507156                                                          103        8e-27 
HYAP_07922                                                            102        2e-26 
PPTG_23721                                                            109        2e-26 
HYAP_05562                                                            104        2e-26 
PHYCA_59410                                                           100        3e-26 
PHYSO_341539                                                          102        4e-25 
PHYSO_509491                                                          97.4       4e-25 
PYAR_25201                                                            99.8       6e-25 
PHYCA_73400                                                           96.3       1e-24 
PHYCA_18619                                                           96.3       5e-24 
PHYSO_333132                                                          95.5       2e-23 
PYAR_21977                                                            97.1       3e-23 
PHYSO_335497                                                          95.1       2e-22 
PHYSO_261711                                                          93.2       5e-22 
PPTG_11420                                                            91.3       2e-21 
PHALS_14424                                                           86.3       3e-20 
PHYCA_119285                                                          84.3       5e-20 
PHYSO_526695                                                          83.6       2e-19 
PHYKE_7051                                                            84.0       2e-19 
PITG_22876                                                            82.8       6e-19 
HYAP_07496                                                            82.0       6e-19 
PYAR_26314                                                            82.0       1e-18 
PYU1_G011232                                                          80.1       2e-18 
PHYCA_73406                                                           79.3       4e-18 
PHYCA_73407                                                           79.3       4e-18 
PHYSO_245887                                                          80.1       8e-18 
PHYKE_4231                                                            79.3       9e-18 
PHYSO_264049                                                          77.4       4e-17 
PHYKE_6288                                                            77.0       4e-17 
PHYSO_445618                                                          76.6       5e-17 
HYAP_07372                                                            78.6       6e-17 
PHYSO_377094                                                          73.6       4e-16 
PPTG_05373                                                            75.9       7e-16 
PPTG_08713                                                            72.4       5e-15 
PITG_23039                                                            71.2       2e-14 
HYAP_08078                                                            67.8       4e-13 
PHYCA_108999                                                          66.2       6e-13 
PPTG_11472                                                            66.6       1e-11 
PHYSO_515401                                                          62.0       2e-11 
PYIW_25932                                                            59.3       1e-10 
PHYSO_336673                                                          58.9       5e-10 
PPTG_19242                                                            58.2       6e-10 
PPTG_23679                                                            58.9       9e-10 
PYAR_26415                                                            55.8       2e-09 
HYAP_11184                                                            56.2       3e-09 
PHYSO_260072                                                          55.1       2e-08 
PPTG_20067                                                            53.9       2e-08 
PHYRA_85280                                                           54.7       1e-07 
HYAP_08850                                                            50.8       1e-06 
HYAP_03446                                                            48.1       1e-06 
PPTG_04456                                                            47.4       2e-06 
PPTG_17455                                                            48.1       2e-06 
PYVX_16508                                                            49.7       5e-06 
PPTG_19622                                                            45.4       7e-06 
PHYSO_335499                                                          48.5       1e-05 
PYIR_26577                                                            45.1       1e-05 
PHYKE_6287                                                            44.3       2e-05 
PPTG_20194                                                            46.2       2e-05 
HYAP_12828                                                            44.3       2e-05 
PHYSO_333483                                                          38.1       0.014 
PYVX_21088                                                            38.1       0.033 
PYIW_15316                                                            33.5       0.089 
CCI50250                                                              35.4       0.19  
PPTG_23150                                                            30.4       1.2   
H257_13592                                                            33.5       1.3   
PHYCA_98739                                                           32.0       1.4   
H310_06403                                                            33.1       1.9   
PYAP_24306                                                            31.2       2.1   
CCI45005                                                              32.3       2.7   
PHYCA_120366                                                          32.3       3.3   
H257_14098                                                            32.0       3.8   
HYAP_08851                                                            29.6       4.3   
PYIW_20226                                                            31.6       4.7   
H310_03591                                                            31.6       4.9   
PPTG_07814                                                            30.8       9.6   
PHYRA_74557                                                           30.8       9.7   
PHYSO_554926                                                          30.8       9.8   

>PITG_18453
Length=252

 Score = 468 bits (1204),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 252/252 (100%), Positives = 252/252 (100%), Gaps = 0/252 (0%)

Query  1    MSFRavliaataslaagvlgQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPY  60
            MSFRAVLIAATASLAAGVLGQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPY
Sbjct  1    MSFRAVLIAATASLAAGVLGQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPY  60

Query  61   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPA  120
            PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPA
Sbjct  61   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPA  120

Query  121  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLE  180
            PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLE
Sbjct  121  PLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLE  180

Query  181  YYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDG  240
            YYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDG
Sbjct  181  YYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDG  240

Query  241  EFDELLNKAWPF  252
            EFDELLNKAWPF
Sbjct  241  EFDELLNKAWPF  252

>PPTG_17125
Length=283

 Score = 454 bits (1167),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 214/232 (92%), Positives = 224/232 (97%), Gaps = 0/232 (0%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            QVIGHNQVRPF EPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD
Sbjct  52   QVIGHNQVRPFPEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  111

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVP PLILRLFGHRHNWEYAIVWI
Sbjct  112  GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPVPLILRLFGHRHNWEYAIVWI  171

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNPELENSTILGVS+SAS+ YAS+TPPE  +VDG+SVKL+YYYNHL GSTSLQLTE TGE
Sbjct  172  DNPELENSTILGVSMSASVGYASQTPPETRYVDGDSVKLKYYYNHLLGSTSLQLTEATGE  231

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+TWD+L+KLARYSLN+TDWDETLFNLAGLKMPLKDG FDELLNKAWPF
Sbjct  232  FQDLITWDELSKLARYSLNHTDWDETLFNLAGLKMPLKDGVFDELLNKAWPF  283

>PHYCA_129485
Length=251

 Score = 428 bits (1101),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 199/232 (86%), Positives = 218/232 (94%), Gaps = 0/232 (0%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            QVIGH+QVRPF +P+PVT S KAAVK+KPQLKI DGCHPYPAVQKDGSI+GGLKWSGPQD
Sbjct  20   QVIGHDQVRPFPQPKPVTVSDKAAVKFKPQLKIADGCHPYPAVQKDGSITGGLKWSGPQD  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            GECTGSKLGSQIYARS WVNDVWAIMYAWYFPKGRGAVP PLI RLFGHRHNWEY IVWI
Sbjct  80   GECTGSKLGSQIYARSAWVNDVWAIMYAWYFPKGRGAVPLPLITRLFGHRHNWEYVIVWI  139

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP+ +NSTILGVS+SA++ YAS+TPPEA +VDG+SVKLEYYYNHL GSTSLQLTEDTGE
Sbjct  140  DNPKSKNSTILGVSMSAAVGYASQTPPEAMYVDGDSVKLEYYYNHLLGSTSLQLTEDTGE  199

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+TWD+L+KLARYSLN+TDWDETLF+LAGLKMPLKDG F ELL+KAWPF
Sbjct  200  FQDLITWDELSKLARYSLNHTDWDETLFDLAGLKMPLKDGVFQELLDKAWPF  251

>PHYRA_81102
Length=251

 Score = 396 bits (1018),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 204/232 (88%), Gaps = 0/232 (0%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            QVIGH+QVRPF +P+PVT SQK AVK+KPQLKI+ GCHPYPAVQKDGS+SGGLKWSGPQD
Sbjct  20   QVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            GECTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   P  LR FGHRHNWEY +VWI
Sbjct  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP LEN+T+LGVS+SASI Y+ + P +  +VDG SVK+ YYYNHL G+T+LQLTEDTGE
Sbjct  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQL+ LARYSLN+TDWD+TLF LAGLKMPLKDG F+ELL+K WPF
Sbjct  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251

>PHYRA_72504
Length=251

 Score = 396 bits (1018),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 180/232 (78%), Positives = 204/232 (88%), Gaps = 0/232 (0%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            QVIGH+QVRPF +P+PVT SQK AVK+KPQLKI+ GCHPYPAVQKDGS+SGGLKWSGPQD
Sbjct  20   QVIGHDQVRPFPQPDPVTVSQKTAVKFKPQLKIDAGCHPYPAVQKDGSMSGGLKWSGPQD  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            GECTGS+LGSQIYARS WVNDVWAIMYAWYFPKGR A   P  LR FGHRHNWEY +VWI
Sbjct  80   GECTGSRLGSQIYARSAWVNDVWAIMYAWYFPKGRAATVPPDFLRFFGHRHNWEYVVVWI  139

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP LEN+T+LGVS+SASI Y+ + P +  +VDG SVK+ YYYNHL G+T+LQLTEDTGE
Sbjct  140  DNPGLENATVLGVSMSASIGYSKQAPTDVKYVDGTSVKVAYYYNHLLGNTALQLTEDTGE  199

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQL+ LARYSLN+TDWD+TLF LAGLKMPLKDG F+ELL+K WPF
Sbjct  200  FQDLIQWDQLSSLARYSLNHTDWDQTLFGLAGLKMPLKDGVFEELLDKTWPF  251

>PHYRA_71825
Length=254

 Score = 318 bits (814),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 180/231 (78%), Gaps = 0/231 (0%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +I H+ V PF +P P T ++KAAVKYKP+L +EDGCHPY AVQ DG+ISGGL+WSGPQDG
Sbjct  24   IIPHDTVEPFAQPRPKTDAEKAAVKYKPRLLVEDGCHPYAAVQADGAISGGLEWSGPQDG  83

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            EC GS LGSQ+YAR   V DVWAIMYAWYFPKGR  +P PL LR FGHR+ WEYA+VW+D
Sbjct  84   ECRGSPLGSQVYARWMKVKDVWAIMYAWYFPKGRAPLPVPLSLRFFGHRNGWEYAVVWLD  143

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            N   +NST+L  S+SA++ ++ E PP+  + DG S+ + YYYNH+FG+T+++ TED GEF
Sbjct  144  NLNAKNSTVLATSLSAAVGWSKEAPPKEKYFDGTSLMVSYYYNHIFGNTAVKYTEDAGEF  203

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            Q L+TWDQL  LAR +LNNTDWD T  N+A +KMP+KDG F E L  A+PF
Sbjct  204  QPLITWDQLPDLARKALNNTDWDATPSNVARVKMPMKDGVFLEKLEGAYPF  254

>PITG_09716
Length=250

 Score = 291 bits (746),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 177/232 (76%), Gaps = 3/232 (1%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            +VI ++ ++PF +P P T +QKA +KYKPQLK+E+GCHPYPAVQ++G IS GL+WSGP+D
Sbjct  22   KVIPYDTLQPFPQPIPTTDAQKAILKYKPQLKVEEGCHPYPAVQRNGDISSGLRWSGPED  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS LGSQIYARSK   D WA+MY WYFPKGR  +P    LR  GHRH WEYA+VW+
Sbjct  82   IGCKGSSLGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPG---LRSSGHRHGWEYAVVWL  138

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D  +  +STILG S+SA++ +A E+P    ++DG S+K+ YY+N  F +T+++ T+D G 
Sbjct  139  DRLDANSSTILGTSLSAAVGWAKESPTPKEYLDGHSLKVAYYFNDDFSNTAVKYTQDGGA  198

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQL+  AR SL NTDWDETLFN+A +KMP+KDG F+E L+ A+PF
Sbjct  199  FQDLIQWDQLSDPARASLINTDWDETLFNVARVKMPMKDGVFEEKLSGAYPF  250

>PHYRA_81103
Length=252

 Score = 291 bits (746),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 174/234 (74%), Gaps = 12/234 (5%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGP-QDG  81
            I H+QV+PF +P  +T SQKAAVK+KPQLK  DGC+PYPAVQ DGS SGGL+W+   Q G
Sbjct  27   IPHDQVQPFAQPNSITVSQKAAVKFKPQLKTLDGCYPYPAVQADGSTSGGLRWTVVGQRG  86

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR---GAVPAPLILRLFGHRHNWEYAIV  138
            +CT   LGSQIYARS W  DVWAIMY WYFPKG    G +         GHRHNWE+ +V
Sbjct  87   DCTDPPLGSQIYARSTWYRDVWAIMYTWYFPKGSETSGGIG-------LGHRHNWEFVVV  139

Query  139  WIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198
            WIDNP L+NSTILGVS+SASI Y+   PP++ ++DG SVK+ Y+Y+ +FG+T+L+LTED 
Sbjct  140  WIDNPALDNSTILGVSMSASIGYSKRAPPKSKYIDGTSVKVSYFYSIVFGNTALELTEDA  199

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            GE QDL+ WDQL  +AR +L NTDWD TL+NL   +MPLKD  F + L K+WPF
Sbjct  200  GETQDLIMWDQLPDVARDAL-NTDWDTTLWNLGNAQMPLKDDVFTKKLKKSWPF  252

>PPTG_08893
Length=251

 Score = 289 bits (740),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 176/232 (76%), Gaps = 3/232 (1%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            +VI ++ V+PF +P P T +QKA +KYKPQLK+E+GC PYPAVQ+DG+IS GL+WSGP+D
Sbjct  23   KVIPYDTVQPFPQPVPTTEAQKAILKYKPQLKVEEGCRPYPAVQQDGAISSGLRWSGPED  82

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQIYARSK   D WA+MY WYFPKGR  +P P   R  GHRH WEYA+VW+
Sbjct  83   IGCKGSLRGSQIYARSKLFKDKWAVMYTWYFPKGRAPIPGP---RSSGHRHGWEYAVVWL  139

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D    +NSTILG S+SA++ +A E+P    ++DG S+K+ YY+N  F +T+++ T+  G 
Sbjct  140  DKLTADNSTILGTSLSAAVGWAKESPTPKEYLDGNSLKVAYYFNDDFKNTAVKYTQAGGA  199

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQL+ +AR SL+NTDWDET FN+A +KMP+KDG F+E L+ A+PF
Sbjct  200  FQDLIIWDQLSDVARASLSNTDWDETPFNVARVKMPMKDGVFEEKLSGAYPF  251

>PPTG_16851
Length=249

 Score = 285 bits (728),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 174/232 (75%), Gaps = 4/232 (2%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I ++ V+PF +  P T +QKA +KYKPQLKIE+GCHPYPAVQKDGSIS GLKWSGP +
Sbjct  22   KAIPYDSVQPFSQQVPNTDAQKAILKYKPQLKIEEGCHPYPAVQKDGSISSGLKWSGPDN  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS LGSQ+YAR+ W+   WA+MYAWYFPKGR  +PAP   R +GHRH WEYA+VW+
Sbjct  82   IGCKGSPLGSQVYARATWLKGKWAVMYAWYFPKGRAPIPAP---RSYGHRHGWEYAVVWL  138

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D     NST+LG S+SA+I +A E+P    ++DG S+K+ YY+N    +T+++ T+D GE
Sbjct  139  DKAS-ANSTLLGTSMSAAIGWAKESPTPKEYLDGNSLKVAYYFNDDSINTAVKYTQDAGE  197

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQL  +AR +L NTDWDET  N+A +KMP+KDG F E LN A+PF
Sbjct  198  FQDLIIWDQLPDVARNALVNTDWDETPLNVARVKMPMKDGVFMEKLNGAYPF  249

>PHYCA_121494
Length=248

 Score = 282 bits (721),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 171/232 (74%), Gaps = 4/232 (2%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I ++ V P       T +QKAAVKY PQL IEDGCHPY AVQ DG+IS GLKWSGPQD
Sbjct  21   KAIPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPQD  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS LGSQ+YARS WV   WAIMYAWYFP G+  VP P+ L   GHR+ WEYA++W+
Sbjct  81   GACKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVP-PVGL---GHRNGWEYAVIWL  136

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D P  +NST+LGVS+SA++ ++ E P +   +DG S+K+ YYYN++F +T+++ TE+ GE
Sbjct  137  DRPTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFRNTAVKYTEEKGE  196

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQ L+TWDQL   AR +L NTDWDET FN+A +KMP+KDG F E L  A+PF
Sbjct  197  FQTLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  248

>PHYCA_10034
Length=274

 Score = 280 bits (715),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 170/232 (73%), Gaps = 4/232 (2%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I ++ V P       T +QKAAVKY PQL IEDGCHPY AVQ DG+IS GLKWSGP D
Sbjct  47   KAIPYDTVVPIPSQTSKTDAQKAAVKYHPQLHIEDGCHPYAAVQADGAISDGLKWSGPHD  106

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS LGSQ+YARS WV   WAIMYAWYFP G+  VP P+ L   GHR+ WEYA++W+
Sbjct  107  GACKGSPLGSQVYARSTWVKGKWAIMYAWYFPMGQAPVP-PVGL---GHRNGWEYAVIWL  162

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D P  +NST+LGVS+SA++ ++ E P +   +DG S+K+ YYYN++F +T+++ TE+ GE
Sbjct  163  DRPTADNSTLLGVSLSAAVGWSKEAPAKQKWMDGNSLKVSYYYNNIFHNTAVKYTEEKGE  222

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQ L+TWDQL   AR +L NTDWDET FN+A +KMP+KDG F E L  A+PF
Sbjct  223  FQTLITWDQLPDAARNALINTDWDETPFNVARVKMPMKDGVFMEKLTGAYPF  274

>PHYSO_261265
Length=247

 Score = 277 bits (709),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 183/253 (72%), Gaps = 7/253 (3%)

Query  1    MSFRavliaataslaagvlgQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPY  60
            M+FRAVLIA  AS AA   G VI +++V PF +P PVT   K  +KYKP LKI++GCHPY
Sbjct  1    MNFRAVLIAVVASFAAAQAGNVIPYDEVHPFAQPAPVTDLHKTMLKYKPHLKIKEGCHPY  60

Query  61   PAVQKDGSISGGLKWSGPQD-GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVP  119
            PAVQK+G ISGGL+WS P D  EC GS LGSQ+YARS WV   +AIMYAWYFP GR    
Sbjct  61   PAVQKNGDISGGLEWSSPTDNAECKGSPLGSQVYARSSWVKGKFAIMYAWYFPMGR----  116

Query  120  APLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKL  179
            APL+   FGHR+ WEYAIVW+D+    NSTILG S+SA++ +A E P    ++DG ++K+
Sbjct  117  APLLP--FGHRNGWEYAIVWLDSVSSTNSTILGTSLSAAVGWAKEVPRNRKYLDGNNLKV  174

Query  180  EYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKD  239
             YY+N     T+++ TE+ GEFQD++TWDQL    R SL+NTDWD T FN+A LKMP+KD
Sbjct  175  AYYFNRDVRCTAVEYTEEIGEFQDVITWDQLPAPTRDSLSNTDWDHTPFNVALLKMPMKD  234

Query  240  GEFDELLNKAWPF  252
            G F E LN A+PF
Sbjct  235  GVFQEKLNSAYPF  247

>PHYKE_6286
Length=250

 Score = 275 bits (704),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/232 (56%), Positives = 172/232 (74%), Gaps = 5/232 (2%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +PEPV+ ++KAAVK+KPQL +  GC PYPAV  +GSIS GLKW+G  DG
Sbjct  23   TISHDQVQPFAQPEPVSDAEKAAVKFKPQLAVTYGCDPYPAVDSNGSISAGLKWAGKPDG  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +CTGS LGSQ+Y+R+ W  D WAIMYAWYFPK R      L    +GHRH W++A+VWID
Sbjct  83   DCTGSPLGSQVYSRADWYEDKWAIMYAWYFPKARQR----LSKYFYGHRHMWQWAVVWID  138

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLF-GSTSLQLTEDTGE  200
            +P  +NST+ GVS+SAS+ Y   +PP++ +VD  SVKL+ Y +  + G  SL+LTEDTGE
Sbjct  139  DPASDNSTVQGVSMSASVGYQKRSPPKSKYVDDSSVKLDSYVDFWWSGKASLRLTEDTGE  198

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             QDL+ WDQLT  AR SL++ D+DE+L+N   +KMPLKDG F + L +++PF
Sbjct  199  TQDLIQWDQLTDAARESLSSFDFDESLWNTKKIKMPLKDGVFTKNLKRSYPF  250

>PHYSO_254108
Length=246

 Score = 262 bits (670),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 163/230 (71%), Gaps = 9/230 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+P  +P PVT +QK AVKYKPQL++  GCHPYPAVQ +GS+SGGL+WSGP DG+
Sbjct  26   INHDQVQPMAQPTPVTDAQKLAVKYKPQLRVSYGCHPYPAVQANGSVSGGLEWSGPADGD  85

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+YARS W  D WA MY WYFPKGR  V        +GHRH WEYAI+W D+
Sbjct  86   CEGSSLGSQVYARSDWFKDKWATMYTWYFPKGRQDV--------WGHRHFWEYAIIWTDS  137

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P  +NST LG+S+SA + +  +TP    +++G SVKLE +Y+ L    +LQLT+D+G+FQ
Sbjct  138  PSPDNSTFLGISMSAGVGHGKQTPVLLKYMNGNSVKLESHYSVLGNKAALQLTKDSGDFQ  197

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TW QL   AR +LN   +D T F     +MPLKD  F  +LNKA+P+
Sbjct  198  DLITWGQLPVPARDALNGDAFDVTYF-FNKFEMPLKDRVFMSVLNKAYPW  246

>PHYCA_118548
Length=246

 Score = 261 bits (667),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 160/230 (70%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H+QV+PF +PEP+T SQK+AVKYKPQL I  GCHPY AVQ DGS SGGL+WSG  DG+
Sbjct  25   VNHDQVQPFAQPEPITDSQKSAVKYKPQLHISYGCHPYAAVQADGSASGGLEWSGRVDGD  84

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS+LGSQ+Y+RS W +D WAIMYAWYFPKGR          L GHRH WEYAIVW D+
Sbjct  85   CTGSQLGSQVYSRSDWYHDKWAIMYAWYFPKGR--------YHLGGHRHYWEYAIVWTDS  136

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P   NS+I GVS+SA + Y   TPP   ++DG S+K + +++ L    +LQLT++ GE Q
Sbjct  137  PTSSNSSIQGVSMSAGVGYGKATPPMLKYIDGNSIKFDSHFSLLGNKAALQLTKEAGERQ  196

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TWDQLT  AR +LN    D   +     ++P KD  F + L KA+PF
Sbjct  197  DLITWDQLTVAARDTLNGDALDGKAWFTDKDEVPFKDDIFVKRLQKAFPF  246

>PHYRA_74356
Length=244

 Score = 259 bits (661),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 158/230 (69%), Gaps = 9/230 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GLK SGP DGE
Sbjct  24   IDHDQVQPFAEPEPTTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLKGSGPADGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS LGSQ+Y+RS W  D WAIMYAWY PKG            +  RH WE A+VWID+
Sbjct  84   CTGSSLGSQVYSRSDWYEDKWAIMYAWYLPKGN---------YKYQRRHYWETAVVWIDD  134

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++       ETP +A  +DG SVKL+ Y  + +    LQ T++ GEFQ
Sbjct  135  PALSNSTILGVSMNYGRRSEFETPVQARFLDGSSVKLDSYRGYGYPKPRLQFTQEEGEFQ  194

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TW+QLT+ AR +L+  D+D  LF     KMPLKDG F+  L  AWPF
Sbjct  195  DLITWEQLTEEARDALSTADFDGPLFKKKKRKMPLKDGIFEFRLKDAWPF  244

>PPTG_07664
Length=245

 Score = 256 bits (653),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 161/230 (70%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H++V+PF + +P+T SQK+AVKYKPQL I  GCHPYPAVQ +GS SGGL+WSGP DG+
Sbjct  24   VNHDKVQPFAQLQPITDSQKSAVKYKPQLHISYGCHPYPAVQANGSASGGLEWSGPVDGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR  +         GHRH WEYAIVW D+
Sbjct  84   CTGSPLGSQVYSRSAWYKEKWAIMYAWYFPKGRYGIT--------GHRHYWEYAIVWTDS  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
                NS+I GVS+SA + +A  TPP   +VDG S+KL+ Y++ +    +LQLT++ GE Q
Sbjct  136  ATSTNSSIQGVSMSAGVGHAKATPPMLKYVDGSSIKLDSYFSFMGNKAALQLTKEHGETQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TWDQLT  AR +LN+   D  ++     ++P KD  F + L  A+PF
Sbjct  196  DLITWDQLTVAARDTLNSDALDGNVWLTNKDEVPFKDDIFMQRLKNAFPF  245

>PHYCA_9298
Length=248

 Score = 253 bits (647),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 162/233 (70%), Gaps = 6/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+QV+PF +PEP T S+K+AVKYKPQL I DGCHPYPAVQ DG++S GLKW+G   
Sbjct  21   KMIDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHPYPAVQADGAVSAGLKWAGTAS  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS LGSQ+Y+RS W  + WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  81   GQCKGSGLGSQVYSRSDWYKNKWAIMYAWYFPKGRQYISK----YRFGHRHFWSYAIVWM  136

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+   +NSTILGVS+SA + Y+ ETPP++ + VDG +VK + Y++      ++ LT   G
Sbjct  137  DSDVPDNSTILGVSMSAGVGYSKETPPKSKYVVDGTTVKFKSYHSFWGSKLAVGLTTKEG  196

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+ W+QLT  AR  L + D+D   ++   + MP+ DG F E L K +PF
Sbjct  197  ESQDLIAWEQLTDEARSGLTDADFD-VDWSFRKVVMPMTDGVFTEKLKKNYPF  248

>PHYRA_74306
Length=245

 Score = 252 bits (644),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 155/230 (67%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF EPEP+T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  24   IDHDKVQPFAEPEPMTDSEKAAVKFKPQLLVSYGCYPYPAVQADGSVSAGLRGSGPADGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR              RH WE A+VWID+
Sbjct  84   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRST--------RHQRRHFWETAVVWIDD  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++       +TP +  ++DG SVKLE Y  + F    LQ T++ G+FQ
Sbjct  136  PALANSTILGVSMNYGWRSKEQTPVKVKYLDGSSVKLESYRAYGFPKPRLQFTQEDGQFQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TW+QLT+ AR +L+  D+D  L      +MPLKD  F+  L  AWPF
Sbjct  196  DLITWEQLTEEARDALSTADFDTYLIEQKKREMPLKDDIFEYRLKDAWPF  245

>PITG_22053
Length=245

 Score = 252 bits (643),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 158/230 (69%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWTDT  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P   NS+I GVS+SA + +A  TPP   ++ G S+KL+ Y++ L    +LQLT++TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TWDQ+T  ARY+LN+   D  ++     ++P KD  F + L  A+PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLENAFPF  245

>PITG_19936
Length=249

 Score = 252 bits (644),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 162/232 (70%), Gaps = 6/232 (3%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +I H+ V+PF +PEP   SQK+AVKYKPQL I  GCHPYPAVQ+DGSIS GLKW+G  +G
Sbjct  23   MIDHDAVQPFAQPEPTMESQKSAVKYKPQLHISYGCHPYPAVQEDGSISAGLKWAGWPNG  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS LGSQ+Y+RS W    WAIMYAWYFPK R  V        FGHRH W YAIVW +
Sbjct  83   DCKGSALGSQVYSRSDWYKGKWAIMYAWYFPKSRQYVDK----YRFGHRHYWSYAIVWTN  138

Query  142  NPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            NP  +NSTILGVS+S+ + Y   +PP++ + VDG +VKL++Y++       LQLTE +GE
Sbjct  139  NPNPDNSTILGVSMSSGVGYMKRSPPKSKYVVDGTTVKLDWYWSFWGSKQGLQLTEKSGE  198

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             QDL+TW+QL++ AR +L+  D+D + +      MPLKD  F   L KA+PF
Sbjct  199  TQDLITWEQLSEEARNALSEADFDVS-WAFTKAVMPLKDDIFTSRLKKAYPF  249

>PITG_04208
Length=245

 Score = 252 bits (643),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 158/230 (69%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +   SGGL+W GP DG+
Sbjct  24   VNHDEVQPFAQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNSYASGGLEWPGPADGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D 
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWTDT  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P   NS+I GVS+SA + +A  TPP   ++ G S+KL+ Y++ L    +LQLT++TGE Q
Sbjct  136  PTSTNSSIQGVSMSAGVGHAKATPPMLKYIHGSSIKLDSYFSFLGSKAALQLTKETGEIQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TWDQ+T  ARY+LN+   D  ++     ++P KD  F + L  A+PF
Sbjct  196  DLITWDQMTVSARYTLNSDALDGNVWLTNIDEVPFKDTIFLKRLANAFPF  245

>PPTG_17049
Length=255

 Score = 252 bits (643),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 159/233 (68%), Gaps = 7/233 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            +GH++V+PF +PEP+T SQKAAVK+KPQL I  GCHPYPAVQ DG++SGGLK+SG  DG+
Sbjct  25   VGHDRVKPFPQPEPITTSQKAAVKFKPQLSIAFGCHPYPAVQADGAVSGGLKYSGKPDGD  84

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  DVWAI YAWY PKG        ++   GHRH W Y  VWI+N
Sbjct  85   CKGSALGSQVYSRSTWYRDVWAITYAWYLPKGYERFSGLSMVE--GHRHFWGYVTVWINN  142

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEY---YYNHLFGSTSLQLTEDTG  199
            P +EN+ ILGVS+S  + + ++ P +   VDG ++KLE+     +   G   L+  E  G
Sbjct  143  PAVENAYILGVSMSGQLGHDTQAPVDKKCVDGSTLKLEFDGHVMDGAKGKQGLRCVEAVG  202

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            +FQDL+TWDQLT+ AR SLN  ++D    ++    +PLKDG F  LLN  WPF
Sbjct  203  KFQDLITWDQLTEAARDSLNTYNFDSIGRDMG--TVPLKDGVFTNLLNSTWPF  253

>PHYCA_132252
Length=249

 Score = 247 bits (630),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 160/233 (69%), Gaps = 6/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+QV+PF +PEP T S+K+AVKYKPQL I DGCH YPAVQ DG++S GLKW+G   
Sbjct  22   KMIDHDQVQPFAQPEPTTNSEKSAVKYKPQLHISDGCHSYPAVQADGAVSAGLKWAGSVS  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  82   GQCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHFWSYAIVWM  137

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+   +NSTILGVS+SA + Y  +TPP++ + VDG +VK + Y +   G  ++ LT   G
Sbjct  138  DSDVPDNSTILGVSMSAGVGYNKKTPPKSKYVVDGTTVKFDSYQSFWGGKLAVGLTTKEG  197

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+TW+QLT   R  L + D+D   +++  + MP+ D  F + L K +PF
Sbjct  198  ETQDLITWEQLTDEGRTGLTDADFD-VDWSIRKVVMPMADDVFVKKLKKNYPF  249

>PHYCA_118674
Length=281

 Score = 248 bits (633),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 163/232 (70%), Gaps = 9/232 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEP T S+K+AVKYKPQL I DGCHPYPAVQ +GS+SGGLKW+G  DG+
Sbjct  57   INHDQVQPFTQPEPTTDSEKSAVKYKPQLHISDGCHPYPAVQANGSVSGGLKWAGRSDGD  116

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C  S LGSQIY+RS W ND WAIMYAWYFPKG     A       GHRH W YAIVW  +
Sbjct  117  CKRSALGSQIYSRSDWHNDKWAIMYAWYFPKG-NEFQANFDS---GHRHYWSYAIVWTGS  172

Query  143  PELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            P  ENST+LGVS+S+S  Y  + PP++ +V DG +VK + Y +      +++LT+  GE 
Sbjct  173  PNPENSTVLGVSMSSS-GYGKKAPPKSKYVIDGTTVKFDSYVSFWASKQAIRLTKKEGEA  231

Query  202  QDLVTWDQLTKLARYSLNNTDWD-ETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+TW+QLT+ AR +L+  D+  E+ F  + + MPLKD  F  +L KA+PF
Sbjct  232  QDLITWEQLTQEARTALSEADFKAESTF--SKVVMPLKDDVFSSILKKAYPF  281

>PITG_19938
Length=245

 Score = 246 bits (627),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 159/228 (70%), Gaps = 8/228 (4%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+CT
Sbjct  26   HDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGDCT  85

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
            GS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D+  
Sbjct  86   GSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWADSST  137

Query  145  LENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDL  204
              +S+I GVS+SA + +A  TPP   ++ G SVKL+ Y++ L    +LQLT++TGE QDL
Sbjct  138  STSSSIQGVSMSAGVGHAKATPPMLKYIHGSSVKLDSYFSFLGSKAALQLTKETGETQDL  197

Query  205  VTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            +TWDQ+T  AR +LN+   D  ++     ++P KD  F + L  A+PF
Sbjct  198  ITWDQMTVAARDTLNSDTLDGNVWLTNKDEVPFKDTIFLKRLEDAFPF  245

>PITG_04248
Length=245

 Score = 244 bits (623),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 154/230 (67%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+P T S+ AAVKYKPQL +  GC PYPAVQ DGS+S GLK SGP DGE
Sbjct  24   INHDEVKPFAQPKPTTDSEVAAVKYKPQLYVSYGCRPYPAVQADGSVSAGLKGSGPMDGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR           +  RH WE A+VWID+
Sbjct  84   CEGSPLGSQVYSRSTWYEDKWAIMYAWYLPKGRNTK--------YQRRHFWEAAVVWIDD  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++    + S+ P E  +++G +VKLE Y  +      L+ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRHKSKAPLERRYLEGSNVKLESYKGYGKPRPRLRFTQLKGETQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             L+TW+QLTK AR +L+N  ++  LF     +MPLKDG F++ L  A+PF
Sbjct  196  HLITWEQLTKEARDALSNAKFNTGLFKRTKREMPLKDGVFEKRLKDAYPF  245

>PHYSO_526774
Length=249

 Score = 243 bits (620),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 160/238 (67%), Gaps = 16/238 (7%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V+P  +PEP T S+K AVKYKPQL I  GCHPYPAVQ DGS+S GLKWSG  +
Sbjct  22   KMINHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWAN  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRL-----FGHRHNWEY  135
            G+C GS LGSQ+Y+RS W    WAIMYAWYFPKGR         R+      GH H W Y
Sbjct  82   GKCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGR---------RMGDGYNSGHHHYWSY  132

Query  136  AIVWIDNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQL  194
            AIVWIDNP  +NSTILGVS+SA + Y   +PP++ + VDG +VK + Y +       ++L
Sbjct  133  AIVWIDNPNPDNSTILGVSMSAGVGYRKASPPKSKYVVDGVTVKFDSYRSFWGSKQGVRL  192

Query  195  TEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            T  +G+ QDL+TW+QLT  AR +L++ D+D   ++L  + MPLKD    E L KA+PF
Sbjct  193  TTKSGDQQDLITWEQLTDEARTALSDADFDVN-WSLKNVVMPLKDDALRERLEKAYPF  249

>PHYSO_526832
Length=249

 Score = 242 bits (618),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 154/233 (66%), Gaps = 10/233 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV PF + EPV  S KAA+K+KP+L+I  GCHPYPAVQ DG++S GLKW+G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWAGKADGK  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG---RGAVPAPLILRLFGHRHNWEYAIVW  139
            C GS LGSQ+Y+RS W    +AIMYAWYFPKG   RG +        + HRH W Y ++W
Sbjct  84   CKGSGLGSQVYSRSAWFEGKFAIMYAWYFPKGFEQRGKIN-------YSHRHLWLYLVLW  136

Query  140  IDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            IDNPE EN  ILGV +  +      TPP+A  +DG S+K++YY +   G T +QLTE+ G
Sbjct  137  IDNPENENPAILGVWLRTAGGNERRTPPDAKFLDGSSLKVDYYKSSWHGKTGIQLTENPG  196

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            EFQDL+TW+Q+T+ AR +L   D+D        L +P  DGEF   L KAW F
Sbjct  197  EFQDLITWEQMTEEARIALTEADFDGHWQERKDLDVPFIDGEFTVNLKKAWVF  249

>PHYCA_118551
Length=245

 Score = 242 bits (617),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 151/230 (66%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V+PF +P+P T S+KAAVKYKPQL +  GCHPYPAVQ DGS+S GLK +GP  GE
Sbjct  24   IDHDTVKPFPQPKPKTDSEKAAVKYKPQLLVSYGCHPYPAVQADGSVSAGLKGTGPAAGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMY+WY PKGR A         +  RH WE A+VWID+
Sbjct  84   CGGSALGSQVYSRSDWYKDKWAIMYSWYLPKGRPAK--------YQRRHLWETAVVWIDD  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++    + +  P E+  +D   VKLE Y    +    L+ T   GE Q
Sbjct  136  PSLANSTILGVSLNYGWRHKTMAPIESEFLDDSRVKLESYRGFSYPRPKLRFTTHVGETQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TW+QLT  AR +L+N ++D  L      +MPLKDG F++ L  AWPF
Sbjct  196  DLITWEQLTVEAREALSNAEFDSGLIKTTRREMPLKDGVFEKRLKDAWPF  245

>PHYRA_52440
Length=243

 Score = 241 bits (616),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 157/228 (69%), Gaps = 8/228 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H+ V+PF +P PVT SQK+AVKYKPQL I  GCHPYPAV+ +G  SGGL+WSGP DG+
Sbjct  24   VNHDLVQPFAQPTPVTDSQKSAVKYKPQLYISYGCHPYPAVEANGYASGGLEWSGPNDGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W ++ WAIMYAWYFPKGR  V         GHR+ WEYAIVW D+
Sbjct  84   CKGSSLGSQVYSRSDWYHEKWAIMYAWYFPKGRYGVT--------GHRNYWEYAIVWTDS  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
               +NST+LGVS+SA + +   TPP   +++G SVKL  +++ L    +L+LT+  GEFQ
Sbjct  136  TSPDNSTLLGVSMSAGVGHDKTTPPMLKYMNGSSVKLNSHFSLLGSKAALELTKKEGEFQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            DL+TWDQLT  AR +LN+   D  ++     ++P KD  F + L  A+
Sbjct  196  DLITWDQLTVAARETLNSDALDGNVWLSNKDEVPFKDDIFVDRLEDAY  243

>PPTG_07671
Length=246

 Score = 241 bits (615),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/230 (52%), Positives = 150/230 (65%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V PF +P+P T S+KAAVKYKPQ  +  GCHPYPAVQ DGS+S GLK SGP DGE
Sbjct  24   INHDEVEPFAQPKPTTDSEKAAVKYKPQFHVSYGCHPYPAVQADGSVSAGLKGSGPMDGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D+WAIMYAWY PKGR           +  RH WE A+VWID+
Sbjct  84   CEGSPLGSQVYSRSGWYEDMWAIMYAWYLPKGRSTK--------YQRRHYWEVAVVWIDD  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++    + S+ P E  ++ G  VKLE +         L+ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRHNSQVPVEEQYLHGSRVKLESFKGFGVPRPRLRFTDLEGETQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TW+QLT+ AR +L+N  +   L       MPLKDG F++ L  A+PF
Sbjct  196  DLITWEQLTEEARDALSNAKFQRGLIKRLRGDMPLKDGVFEKRLEDAYPF  245

>PHYSO_526623
Length=249

 Score = 241 bits (614),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 157/233 (67%), Gaps = 6/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV+ +GS+S GLKW+G  D
Sbjct  22   KMINHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVEANGSVSAGLKWTGWAD  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W YAIVW 
Sbjct  82   GDCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYASQ----YRSGHRHFWSYAIVWT  137

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+ + +NSTI GVS+SA + Y   TPP++ + VDG +VK + Y++       ++ T  TG
Sbjct  138  DSDKPDNSTIQGVSMSAGVGYGKATPPKSKYVVDGVTVKFDSYFSFWGSKVGIRTTTKTG  197

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+TW+QLT  AR +L + D+D   ++   + MPL D  F E L KA+PF
Sbjct  198  ETQDLITWEQLTDEARTALTDADFD-VDWSYKKVVMPLLDDVFTEKLEKAYPF  249

>PHYSO_526071
Length=249

 Score = 240 bits (612),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 156/233 (67%), Gaps = 6/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V+P  +PEP T S+K AVKYKPQL I  GCHPYPAVQ DGS+S GLKWSG  +
Sbjct  22   KMINHDTVQPVAQPEPTTDSEKTAVKYKPQLHISYGCHPYPAVQADGSVSAGLKWSGWAN  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS LGSQ+Y+RS W    WAIMYAWYFPKGR  V         GHRH W YAIVW 
Sbjct  82   GKCKGSGLGSQVYSRSDWYKGKWAIMYAWYFPKGRQYVSK----YRKGHRHFWSYAIVWT  137

Query  141  DNPELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+ + +NSTI GVS+SA + +   TPP++ +V DG +VK + Y++       ++ T  TG
Sbjct  138  DSDKPDNSTIQGVSMSAGVGFRKATPPKSKYVIDGVTVKFDSYFSFWGSKVGIRTTTKTG  197

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+TW+QLT  AR  L N D+D   ++   + MPL D +F + L KA+PF
Sbjct  198  ESQDLITWEQLTDEARTGLTNADFD-VDWSYRKVVMPLSDEDFTDKLKKAYPF  249

>PITG_04200
Length=247

 Score = 237 bits (604),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 152/231 (66%), Gaps = 9/231 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P P T S+KAAVKYKP+L +  GCHPYPAVQ +G +S GLK SGP DGE
Sbjct  24   INHDEVKPFAQPTPTTDSEKAAVKYKPKLYVSYGCHPYPAVQANGFVSAGLKGSGPIDGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMYAWY PKGR +         +  RH WE A+VWID+
Sbjct  84   CEGSSLGSQVYSRSMWYEDKWAIMYAWYLPKGRSSK--------YQRRHFWEAAVVWIDD  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++      SE P E   +DG +VKLE Y         LQ T+  GE Q
Sbjct  136  PALANSTILGVSLNYGRRQKSEVPLELQFLDGSNVKLESYRGFGRPRPRLQFTQLEGETQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETL-FNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+TW+QLT  AR  L++ +++  L F     +MPLKDG F++ L  A+PF
Sbjct  196  DLITWEQLTDEARDGLSDAEFNTGLFFKRTRREMPLKDGVFEKRLIDAYPF  246

>PHYRA_74343
Length=249

 Score = 236 bits (603),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 156/233 (67%), Gaps = 6/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV  +GS++ GLKW+G  D
Sbjct  22   EMIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWDD  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS LGSQ+Y+RS W  D WAIMYAWYFPKGR    A       GHRH W Y IVW 
Sbjct  82   GDCKGSGLGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSAYRT----GHRHYWSYGIVWT  137

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+   +NSTILGVS+SA + +   TPP++ + VDG +VK + + +       ++LT   G
Sbjct  138  DSSSPDNSTILGVSMSAGVGFGKATPPKSKYVVDGTTVKFDSFRSFWGSKMGVKLTTKEG  197

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+TW+Q+T+ AR +L + D+D   +++  + MP+ D  F   L KA+PF
Sbjct  198  EMQDLITWEQMTEEARTALTDADFD-VDWSVRKVVMPMSDDVFMTKLKKAYPF  249

>PITG_04267
Length=279

 Score = 234 bits (598),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 157/233 (67%), Gaps = 8/233 (3%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF + +P T S+K+A+KYKPQL I DGCHPYPAVQ +GSISGGLKWSG  +G
Sbjct  53   TINHDQVQPFEQIKPATDSEKSAIKYKPQLHISDGCHPYPAVQSNGSISGGLKWSGKANG  112

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRL-FGHRHNWEYAIVWI  140
            +C    LGSQ+Y+RS W    WAIMYAWYFPKG        +LR   GHRH W YAI+W 
Sbjct  113  DCKEPGLGSQVYSRSAWFKGKWAIMYAWYFPKG-----PQFVLRFDTGHRHFWSYAILWT  167

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+P  +NSTILGVS+S S  Y  E+ P+A + V G +VKL+ Y +   G  +LQLT+  G
Sbjct  168  DDPNHDNSTILGVSMSGSRGYVKESSPKAKYIVKGTTVKLDSYASFWMGVQALQLTKKLG  227

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+TW+QLT  A  +L   D+ E+  + A + MPL D  F  +L  ++PF
Sbjct  228  ETQDLITWEQLTDEACDALTEFDF-ESDPSRAMVVMPLGDDNFTPILKDSYPF  279

>PHYRA_74307
Length=249

 Score = 233 bits (595),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 158/233 (68%), Gaps = 6/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV  +GS++ GLKW+G  D
Sbjct  22   EMIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVNANGSVNAGLKWAGWAD  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS LGSQ+Y+RS    D WAIMYAWYFPKGR  +         GHRH W Y IVW 
Sbjct  82   GDCKGSGLGSQVYSRSDSYKDKWAIMYAWYFPKGRQYIHK----YHSGHRHYWSYGIVWT  137

Query  141  DNPELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+   +NSTILGVS+SA + Y   +PP++  V DG +VK + Y +       ++LT+ TG
Sbjct  138  DSSSPDNSTILGVSMSAGVGYRKVSPPKSKFVIDGTTVKFDSYKSFWGSKQGVRLTKKTG  197

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + QDL+TW+Q+T+ AR +L +TD+D   ++L  + MPL D  F E L K++PF
Sbjct  198  DTQDLITWEQMTEEARTALVDTDFD-VEWSLKKVVMPLSDDAFTERLEKSYPF  249

>PHYCA_122048
Length=236

 Score = 231 bits (588),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 145/231 (63%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I HNQV PF +PE  T SQKAA+K+KPQ+ I +GCHPYPAV + G  SGGLK SG    
Sbjct  21   TIDHNQVVPFAQPEATTISQKAAIKFKPQIHITNGCHPYPAVNEAGETSGGLKTSGAPSS  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W N  WAIMY+WYFPK   +          GHRH+WE+ +VWID
Sbjct  81   SCKGSGWGSQVYGRSTWYNGKWAIMYSWYFPKDSPSTG-------LGHRHDWEHVVVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ N TIL  S SA   Y+   PP ++ VDG SVK+ Y  N    + +L +T  +GE 
Sbjct  134  NPDVANPTILATSPSAHSGYSFYAPPSSDSVDGTSVKVNYESNWPI-NHALDMTSKSGET  192

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQL++ ARY+LN TD+ +         +P+ DG F   L KAWPF
Sbjct  193  QDLIMWDQLSEAARYALNTTDFGKA-------NVPMNDGNFVAKLGKAWPF  236

>PHYRA_72386
Length=245

 Score = 230 bits (586),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 145/231 (63%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QVRPF +PEPVT S++AA+K+KPQL + DGCHPYPAV   G + GGLK +G    
Sbjct  30   TISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTA  89

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY RS W  D+WAIMY+WYFPK   +          GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWID  142

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ N  IL VS SA   Y+   PP A+ +DG S K+ Y  ++   + +L  T D GEF
Sbjct  143  NPDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEF  201

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W+Q++ LAR +LN         N     +P+ DG F   L+KAWPF
Sbjct  202  QDLIMWEQMSDLARQALNT-------MNFGDANVPMNDGNFVGKLDKAWPF  245

>PHYRA_72344
Length=245

 Score = 230 bits (586),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 145/231 (63%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QVRPF +PEPVT S++AA+K+KPQL + DGCHPYPAV   G + GGLK +G    
Sbjct  30   TISHDQVRPFAQPEPVTISERAAMKFKPQLNVIDGCHPYPAVNDAGEVGGGLKTTGSPTA  89

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY RS W  D+WAIMY+WYFPK   +          GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQIYGRSTWHRDIWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWID  142

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ N  IL VS SA   Y+   PP A+ +DG S K+ Y  ++   + +L  T D GEF
Sbjct  143  NPDVPNPIILAVSPSAHSGYSKYAPPGADILDGTSAKIRYESSYPM-NHALDATTDAGEF  201

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W+Q++ LAR +LN         N     +P+ DG F   L+KAWPF
Sbjct  202  QDLIMWEQMSDLARQALNT-------MNFGDANVPMNDGNFVGKLDKAWPF  245

>PPTG_15224
Length=246

 Score = 230 bits (586),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 148/230 (64%), Gaps = 8/230 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF E +P T S+KAAVKYKP++ +  GCHPYPAVQ DGS+S GLK +GP DGE
Sbjct  24   INHDQVQPFDELKPTTDSEKAAVKYKPKVYVSYGCHPYPAVQADGSVSAGLKGTGPIDGE  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W    WAIMYAWY PKG  A  +P        RH WE A+VWID+
Sbjct  84   CGGSDLGSQVYSRSSWYKGKWAIMYAWYLPKG-WAYRSP-------RRHFWETAVVWIDD  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P   NS+ILGV++++ +      P E  +VDG SV+LE           L+ T  +GE Q
Sbjct  136  PSPTNSSILGVTLNSGLRRKKYVPVERQYVDGSSVQLESCKGRGRPRPMLRFTTISGESQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+ W+QLT  ARY+L N ++D   F      MPLKD  F++ L  AWPF
Sbjct  196  DLIMWEQLTDKARYALANAEFDTGFFKKKRRNMPLKDDRFEKGLEDAWPF  245

>PHYRA_74310
Length=249

 Score = 229 bits (584),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 153/232 (66%), Gaps = 6/232 (3%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +I H+ V+PF +PEP T S+K AVK+KPQL I  GCHPYPAV  +GS++ GLKW+G  DG
Sbjct  23   MIDHDTVQPFAQPEPTTDSEKTAVKFKPQLHISYGCHPYPAVDANGSVNAGLKWAGWADG  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS +GSQ+Y+RS W  D WAIMYAWYFPKGR            GHRH W Y IVW D
Sbjct  83   DCKGSAMGSQVYSRSDWYKDKWAIMYAWYFPKGRQYTSK----YRAGHRHYWSYGIVWTD  138

Query  142  NPELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            +   +NSTILGVS+SA + +   TPP++ +V DG +VK + +++       ++LT   G 
Sbjct  139  SSSPDNSTILGVSMSAGVGFGKATPPKSKYVIDGTTVKFDSFWSFWGSKLGVKLTTKEGA  198

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             Q L+TW+Q+T+ AR +L + D+D   ++   + MP+ D  F + L KA+PF
Sbjct  199  TQALITWEQMTEEARTALTDADFD-VDWSFRKVVMPMSDDVFTKKLKKAYPF  249

>PHYCA_107869
Length=342

 Score = 232 bits (591),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 148/234 (63%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEPVT S+KAAVKYKPQ+ I +GCHPYPAV + G  SGGLK  G     
Sbjct  128  IDHDQVKPFAQPEPVTISEKAAVKYKPQIHIVNGCHPYPAVNEAGETSGGLKTKGAPSAG  187

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  188  CKGSGWGSQVYGRSTWVRGVWAIMYSWYFPKDSPS-------SGLGHRHDWEHVIVWIDN  240

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDT  198
            P++EN  IL V+ SA   Y+ + PP+A+ VDG SVK++Y      NH   STS     + 
Sbjct  241  PDIENPKILAVTPSAHSGYSKQVPPKADCVDGTSVKVKYESKWPVNHALDSTS-----EG  295

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G+FQDL+ WDQL++ AR ++N   W +          P  DG F   L+KAWPF
Sbjct  296  GDFQDLIMWDQLSENARRAMNGVGWGKA-------NTPFNDGNFLPKLDKAWPF  342

>PHYCA_123779
Length=277

 Score = 229 bits (585),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 148/236 (63%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V PF +PEPVT S KAA+K+KPQL I +GCHPYPAV   G  SGGLK SG   
Sbjct  57   KIIDHDAVVPFKQPEPVTISDKAAIKFKPQLHITNGCHPYPAVNAIGQTSGGLKTSGAPS  116

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  117  AGCKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWI  169

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            DNPE+    ILGV+ SA   Y+S+ PP+A+ VDG SVK++Y      NH     +L+ T 
Sbjct  170  DNPEVPEPKILGVTPSAHSGYSSQVPPDADKVDGSSVKVKYLSKWPINH-----ALESTG  224

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + G+FQDL+ W Q+T  AR  L+ T W +         +P+ DG F+  L KAWPF
Sbjct  225  EGGDFQDLIMWTQMTDAAREGLSKTGWGKA-------NVPMVDGNFEAKLGKAWPF  273

>PHYSO_329843
Length=239

 Score = 228 bits (581),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 147/232 (63%), Gaps = 15/232 (6%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+QV PF +PE VT SQKAAVK+KPQ+ I +GCHPYPA  + G  SGGLK +G   
Sbjct  23   EIIDHDQVVPFAQPEAVTISQKAAVKFKPQIHITNGCHPYPAANEAGQTSGGLKPTGAPS  82

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQ+Y RS W +  WAIMY+WYFPK   +          GHRH+WE+ +VWI
Sbjct  83   SSCKGSGWGSQVYGRSTWYSGRWAIMYSWYFPKDSPSTG-------LGHRHDWEHVVVWI  135

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP++EN TIL  S SA   Y+   PP A+ +DG SVK+  Y +H   + +L +T ++GE
Sbjct  136  DNPDVENPTILSTSPSAHSGYSYYVPPSADSIDGTSVKVN-YESHWPINHALDMTSESGE  194

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQL+  AR +LN T       +     +P+ DG F   L KAWPF
Sbjct  195  FQDLIMWDQLSDAARLALNTT-------SFGSANVPMNDGNFLTKLGKAWPF  239

>PHYRA_76249
Length=326

 Score = 231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 145/234 (62%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEP+T S+KA VK+KPQ+ + +GCHPYPAV + G   GGLK  G     
Sbjct  112  IDHDQVKPFAQPEPITISEKAGVKFKPQIHVTNGCHPYPAVNEAGETGGGLKTKGAPSAG  171

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  172  CKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  224

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDT  198
            P++EN  IL V+ SA   Y+ + PP A+ VDG SVK+EY      NH   STS       
Sbjct  225  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSVKVEYKSKWPINHALESTS-----QG  279

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G+FQDL+ WDQL++ AR +LN+  W +          P+ DG F   L KAWPF
Sbjct  280  GDFQDLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFQNKLGKAWPF  326

>PPTG_19331
Length=368

 Score = 232 bits (591),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEPVT S+KAAVK+KPQ+ I +GCHPYPAV + G  SGGLK  G    +
Sbjct  152  IDHDQVKPFPQPEPVTISEKAAVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSAK  211

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS WV  +WAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  212  CKGSGWGSQVYGRSTWVQGIWAIMYSWYFPKDSPS-------SGLGHRHDWEHVIVWIDN  264

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P++EN  IL V+ SA   Y+ + PP A+ VDG SVK++ Y +H   + +L+ T + G+FQ
Sbjct  265  PDVENPKILAVTPSAHDGYSKQVPPNADCVDGTSVKVK-YESHWPINHALESTSEGGDFQ  323

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+ WDQL++ AR ++N   W +          P  DG F   L KAWPF
Sbjct  324  DLIMWDQLSEDARRAMNGVGWGKA-------NTPFNDGNFKPKLEKAWPF  366

>PHYKE_2376
Length=322

 Score = 230 bits (587),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 147/231 (64%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +PEPVT S+KA VK+KPQ+ I +GCHPYPAV + G  SGGLK  G    
Sbjct  107  TIDHDQVKPFGQPEPVTISEKAGVKFKPQIHITNGCHPYPAVNEAGETSGGLKTKGAPSA  166

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W NDVWAIMY+WYFPK   +          GHRH+WE+ I+WID
Sbjct  167  GCKGSGWGSQVYGRSGWKNDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWID  219

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++EN  IL V+ SA   Y++  PP A+ +DG S K+  Y +H   + +L  T + G+F
Sbjct  220  NPDVENPRILAVTPSAHSGYSTYRPPNADTLDGTSAKVN-YESHWPVNHALDSTSEGGDF  278

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQ+T  AR +LN   W +         +P+ DG F   L+KAWPF
Sbjct  279  QDLIMWDQMTDNARRALNEVSWGDA-------NVPMNDGNFGPKLDKAWPF  322

>PHYSO_507736
Length=236

 Score = 226 bits (577),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 145/230 (63%), Gaps = 15/230 (7%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
             VI H+QV PF +P P + SQ AAVK+KPQL I +GCHPYPAV  DG+ SGGL  +G   
Sbjct  20   SVIDHDQVVPFAQPTPTSTSQTAAVKFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSS  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +VW+
Sbjct  80   AGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVWL  132

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            +NP + +  +L VS SA   Y +  PP ++++DG S K++ YYN L  + + ++T D+GE
Sbjct  133  NNPAVTSPELLAVSTSAHSGYTTYYPPSSSYLDGNSAKID-YYNVLLINHAFRMTSDSGE  191

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             QDL+ WDQLT  AR +L NTD+ +         +P KD  F+  L  AW
Sbjct  192  TQDLIMWDQLTDAARTALENTDFGDA-------NVPFKDANFETKLANAW  234

>PHYSO_249692
Length=248

 Score = 226 bits (577),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 147/231 (64%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QVRPF +PEPVT S++AAVK+KPQL + +GCHPYPAV   G  SGGLK SG    
Sbjct  33   TISHDQVRPFAQPEPVTISERAAVKFKPQLHVTNGCHPYPAVNDAGETSGGLKTSGAPSA  92

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWI+
Sbjct  93   GCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIN  145

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ +  IL V+ SA   Y+  +PP A+ +DG S+K+ Y  N+     +  +T + G+F
Sbjct  146  NPDVPDPIILAVTPSAHSGYSKYSPPNADTLDGTSIKVNYESNYPMNHAT-DVTTEGGDF  204

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQ++ LAR +LN   + +         +P+ DG F   L++AWPF
Sbjct  205  QDLIMWDQMSDLARRALNEVSFGDA-------NVPMNDGNFVGKLDRAWPF  248

>PHYRA_52423
Length=193

 Score = 223 bits (569),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 136/201 (68%), Gaps = 8/201 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR           +  RH WE A+VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRPTK--------YQRRHFWETAVVWIDD  112

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P L NSTILGVS++       ETP     +DG SVKL  Y  + F    LQ T+  GEFQ
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSYRGYGFPKPRLQFTQIDGEFQ  172

Query  203  DLVTWDQLTKLARYSLNNTDW  223
            DL+TW+QLT+ AR +L+  D+
Sbjct  173  DLITWEQLTEEARDALSTADF  193

>PHYSO_527352
Length=245

 Score = 224 bits (572),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 154/231 (67%), Gaps = 9/231 (4%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWS--GP  78
            ++IGH+QV+PF +PEP T S+K+AVKYKPQL I  GCHPYPAVQ DGS++GGLKW+    
Sbjct  22   KMIGHDQVQPFAQPEPTTESEKSAVKYKPQLHISYGCHPYPAVQADGSVNGGLKWTFWSW  81

Query  79   QDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIV  138
             D +C GS LGSQ+Y+RS W    WAI+YAWYFPKGR    +    R  GHRH W YAI+
Sbjct  82   ADSDCKGSGLGSQVYSRSDWHRGKWAIVYAWYFPKGRDFEHS--FKR--GHRHYWLYAIL  137

Query  139  WIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198
            W D+P  + STILGVS+       S  P     +DG+++K + Y +   G   L LTE T
Sbjct  138  WTDSPNPDTSTILGVSVPNGFRDKSAAPDAQFVIDGKTIKFDSYRSFTTGRQDLGLTEKT  197

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            G+ QDL+TW+QLT+ AR +L+N ++D     +    +P+KDG+F E L +A
Sbjct  198  GDTQDLITWEQLTEEARTALSNMNFDGPRQKIV---VPMKDGDFAERLARA  245

>PPTG_15230
Length=252

 Score = 225 bits (573),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 144/231 (62%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             IGH+QV+PF +P+PVT S++AA+K+KPQ+ I DGCHPYPAV   G   GGLK +G    
Sbjct  37   TIGHDQVKPFAQPQPVTISERAAIKFKPQIHIGDGCHPYPAVNDIGETGGGLKTTGSPTA  96

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWI+
Sbjct  97   GCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIN  149

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ +  IL V+ SA   Y+   PP A+ +DG SVK+ Y   +     +  +T D GEF
Sbjct  150  NPDVPDPIILAVTPSAHSGYSKYAPPNADTLDGTSVKVNYESTYPMNHAT-DVTTDPGEF  208

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQ+T  AR +LN   + +         +P+ DG F   L+KAWPF
Sbjct  209  QDLIMWDQMTDAARLALNTVSFGDA-------NVPMNDGNFIPKLDKAWPF  252

>PHYCA_129784
Length=246

 Score = 224 bits (571),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 143/231 (62%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +P+PVT S++AA+K+KPQL + DGCHPYPAV   G   GGLK +G    
Sbjct  31   TIDHDQVKPFPQPQPVTISERAAMKFKPQLHVVDGCHPYPAVNDAGETGGGLKTTGSPTA  90

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWI 
Sbjct  91   GCKGSGWGSQVYGRSTWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIS  143

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ N TIL V+ SA   Y+   PP A+ VDG S+K+ Y   +     +  +T + GEF
Sbjct  144  NPDVPNPTILAVTPSAHSGYSKYAPPSADTVDGTSIKVRYESTYPMNHAT-DVTTEAGEF  202

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQ+T  AR +LN   + +         +P+ DG F   L+KAWPF
Sbjct  203  QDLIMWDQMTDAARNALNTVSFGDA-------NVPMNDGNFVPKLDKAWPF  246

>PPTG_17409
Length=235

 Score = 223 bits (567),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 145/230 (63%), Gaps = 15/230 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEPVT S+KAAVK+KPQL I +GCHPYPAV   G   GGLK +G   G 
Sbjct  21   IDHDQVQPFAQPEPVTISEKAAVKFKPQLHITNGCHPYPAVNAAGDTGGGLKPTGAPSGS  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE  ++WI+N
Sbjct  81   CKGSGYGSQVYGRSTWFNGVWAIMYSWYFPKDSPS-------SSLGHRHDWENVVIWINN  133

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P++ N  IL +  SA   Y+   PP+A+ +DG S K+  Y +H   + +   T + G+FQ
Sbjct  134  PDVPNPVILAICPSAHGGYSRYAPPDADTIDGTSAKVN-YESHWPINHATDTTSEGGDFQ  192

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+ WDQLT  AR +L +TD+ +         +P+K+G F   L KAWPF
Sbjct  193  DLIMWDQLTDAARTALQDTDFGDA-------NVPMKEGSFLSNLEKAWPF  235

>PPTG_06973
Length=165

 Score = 219 bits (557),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 127/166 (77%), Gaps = 3/166 (2%)

Query  87   KLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELE  146
            +L SQ+YAR+ WV D WAIMYAW+FPK R   P   +LR  GHRH WEYAIVW+D P  +
Sbjct  3    RLDSQVYARTTWVKDKWAIMYAWFFPKARAPFP---VLRFLGHRHGWEYAIVWLDKPNAD  59

Query  147  NSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVT  206
            NSTILGVS+SA+  +A E PP   ++DG S+K+ YYYNH++G+T+++ T++TGEFQDL+T
Sbjct  60   NSTILGVSVSAAAGWAKEAPPPEKYLDGNSLKVAYYYNHIYGNTAVKYTDETGEFQDLIT  119

Query  207  WDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            W+QL+ LAR  LNNTDWDET  N A LKMP+KDG F + L  A+PF
Sbjct  120  WNQLSDLARSYLNNTDWDETPLNAALLKMPMKDGVFMKKLKSAYPF  165

>PHYCA_11951
Length=234

 Score = 221 bits (562),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 142/227 (63%), Gaps = 15/227 (7%)

Query  24   GHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGEC  83
            GH+QV PF +P P + SQ  AV +KPQL I +GCHPYPAV  DG+ SGGL  +G     C
Sbjct  21   GHDQVVPFAQPTPTSISQTTAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPAGSSSAGC  80

Query  84   TGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNP  143
             GS  GSQIY RS W N VWAIMY+WYFPK   +         FGHRH+WE+ +VW+DNP
Sbjct  81   KGSGYGSQIYGRSAWYNGVWAIMYSWYFPKDSPS-------SGFGHRHDWEHIVVWLDNP  133

Query  144  ELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQD  203
             + +  IL VS SA   Y    PP +N+++G+S K++ YY+ L  + + ++T D GE Q+
Sbjct  134  AVASPKILAVSTSAHSGYTVYYPPNSNYLNGKSAKID-YYSILLINHAFRMTSDAGETQN  192

Query  204  LVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            L+ WDQ+T  AR +L NTD+ +         +P KDG F+  L  AW
Sbjct  193  LIMWDQMTDAARTALQNTDFGDA-------NVPFKDGNFESKLANAW  232

>PHYRA_71477
Length=238

 Score = 221 bits (563),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 149/230 (65%), Gaps = 15/230 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V PF +PEPVT S+KAAV++KP++ I +GCHPYPAV + G  SGGL+ +G    +
Sbjct  24   IGHDEVVPFPQPEPVTISEKAAVRFKPEIHITNGCHPYPAVSEAGMTSGGLQATGGPSSK  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W + VWAIMY WYFPK   +       RL GHRH+WE+ +VWIDN
Sbjct  84   CKGSGWGSQMYGRSTWYSGVWAIMYTWYFPKDSPST------RL-GHRHDWEHVVVWIDN  136

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P++ N  +L VS SA   Y+   PP A+ VDG SVK+  Y +H   + +L  T  +GEFQ
Sbjct  137  PDVSNPILLAVSPSAHSGYSKYVPPSADSVDGTSVKIN-YESHWPVNHALDTTSKSGEFQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+ W Q++  AR +LN TD+ + +       MP+ DG F   L  AWP+
Sbjct  196  DLIMWHQMSDAARLALNTTDFGKAI-------MPMNDGSFLGKLAGAWPW  238

>PHYCA_9358
Length=252

 Score = 221 bits (563),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 149/240 (62%), Gaps = 29/240 (12%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V PF +PEPVT ++KAA+K+KPQL I +GCH YPAV   G  SGGLK +G     
Sbjct  31   IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHISNGCHAYPAVNIGGQTSGGLKTTGAPSAG  90

Query  83   CTGSKLGSQIYARSKW------VNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYA  136
            C GS  GSQ+Y RS W       N +WAIMY+WYFPK   +          GHRH+WE+ 
Sbjct  91   CKGSGWGSQVYGRSTWHNVPSPHNGIWAIMYSWYFPKDSPST-------GLGHRHDWEHV  143

Query  137  IVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSL  192
            IVWIDNPE+    IL V+ SA   Y+++ PP+A+ V+G SVK+ Y      NH  GST+ 
Sbjct  144  IVWIDNPEIAEPKILAVTPSAHSGYSAQVPPDADKVEGTSVKVNYESKWPINHALGSTT-  202

Query  193  QLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
                  G++QDL+ W+QLT  AR +L NTD+ +         +P+KDG F   LNKAWPF
Sbjct  203  ----KGGDYQDLIMWEQLTDAARLALENTDFGKA-------NVPMKDGNFVGKLNKAWPF  251

>PPTG_08017
Length=616

 Score = 231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 150/234 (64%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V PF +PEPVT ++KAA+K+KPQL I +GCH YPAV   G  SGGLK +G     
Sbjct  400  IGHDEVVPFKQPEPVTIAEKAAIKFKPQLHITNGCHAYPAVNVGGQTSGGLKTTGAPSAG  459

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  460  CKGSGWGSQVYGRSTWHNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWIDN  512

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDT  198
            PE+    IL V+ SA   Y+++ PP+AN VDG SVK++Y      NH     +L+ T + 
Sbjct  513  PEIAEPKILAVTPSAHSGYSAQVPPDANKVDGNSVKVKYLSKWPINH-----ALESTGEA  567

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G++QDL+ W+QLT  AR +L NT + +         +P+KDG F   L+KAWPF
Sbjct  568  GDYQDLIMWEQLTDAARLALQNTGFGKA-------NVPMKDGNFVSKLDKAWPF  614

>PHYRA_71404
Length=245

 Score = 221 bits (562),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 144/231 (62%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +P+PVT S+KA VK+KPQL I +GCH YPAV   G  SGGLK +G    
Sbjct  30   TIDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSA  89

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK     P+  I    GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDE---PSTGI----GHRHDWEHVIVWID  142

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++EN  IL V+ SA   Y    PP A+ +DG + K+  Y +H     +L  + + G+F
Sbjct  143  NPDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDF  201

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQL++ AR +LN+        N     +P+ DG F   L +AWPF
Sbjct  202  QDLIMWDQLSENARRALNSV-------NFGNANVPMNDGNFQAKLGRAWPF  245

>PHYRA_72433
Length=245

 Score = 220 bits (561),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 142/231 (61%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +P+PVT S+KA VK+KPQL I +GCH YPAV   G  SGGLK +G    
Sbjct  30   TIDHDQVKPFPQPDPVTISEKAGVKFKPQLHITNGCHSYPAVDDAGDTSGGLKTTGAPSA  89

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWID
Sbjct  90   GCKGSGWGSQVYGRSGWYQDVWAIMYSWYFPKDEPST-------GIGHRHDWEHVIVWID  142

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++EN  IL V+ SA   Y    PP A+ +DG + K+  Y +H     +L  + + G+F
Sbjct  143  NPDVENPKILAVTPSAHSGYHKYAPPNADSIDGTTTKVA-YESHWPMDHALDSSSEAGDF  201

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQL++ AR +LN+        N     +P+ DG F   L +AWPF
Sbjct  202  QDLIMWDQLSENARRALNSV-------NFGNANVPMNDGNFQAKLGRAWPF  245

>PPTG_15233
Length=235

 Score = 220 bits (560),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 142/229 (62%), Gaps = 15/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P + SQ AA  +KPQL I +GCHPYPAV  DG+ SGGL  +G    
Sbjct  20   VIDHDQVVPFAQPTPTSVSQIAAFNFKPQLHITNGCHPYPAVDTDGNTSGGLNPTGSSSA  79

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +VW++
Sbjct  80   GCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVWLN  132

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP + +  IL VS SA   Y    PP ++++DG S K++ YY+ L  + S ++T D+GE 
Sbjct  133  NPAVTSPEILAVSTSAHSGYTVYYPPSSDYLDGNSAKID-YYSVLLINHSFRMTSDSGET  191

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+ +         +P KD  F+  L  AW
Sbjct  192  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDANFETKLANAW  233

>PPTG_17245
Length=257

 Score = 221 bits (562),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 158/239 (66%), Gaps = 11/239 (5%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I H+QV+PF E EP T S+K+A+KYKPQL I  GC+PYPAVQ +G+ISGGLKWSG  +
Sbjct  22   RTINHDQVQPFEEMEPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWAN  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
             +C     GSQIY+RS W    WAIMYAWYFPK  GA  A    R  GHRH W  AIVW 
Sbjct  82   SDCEKPVQGSQIYSRSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWT  137

Query  141  DNPELENSTILGVSISASISYASETPPEANHVD-GESVKLEYYYNHLFGSTSLQLTEDTG  199
            DN   +NSTILGVS+S S  Y  +  P+  +++ G ++KL+ Y      + +L+LT+ +G
Sbjct  138  DNTNPDNSTILGVSMSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSG  197

Query  200  EFQDLVTWDQLTKLARYSLNNTDWD----ETLFNLAG--LKMPLKDGEFDELLNKAWPF  252
              QDLVTW+QLT  AR +L+  D+D    + +F  +G  + MPL+DG F  +L +++PF
Sbjct  198  GTQDLVTWEQLTDEARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  256

>PHYKE_4438
Length=339

 Score = 223 bits (568),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 145/234 (62%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEP+T S++AAVK+KPQL I +GCH YPAV   G  SGGLK +G   G+
Sbjct  124  ISHSEVQPFPQPEPITISERAAVKFKPQLHISNGCHAYPAVNGAGETSGGLKTTGAPSGK  183

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W  DVWAIMY+WYFPK   +          GHRH+WE+ I+WI+N
Sbjct  184  CKGSGYGSQVYGRSGWHKDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIIWINN  236

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDT  198
            PE+ +  IL V+ SA   Y++  PP A+ +DG + K+ Y      NH  G     +T   
Sbjct  237  PEVADPKILAVTPSAHSGYSTYAPPPADSMDGVAAKVNYESFWPVNHALG-----MTTKG  291

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G+FQDL+ WDQLT  AR +LN  +W           +P+ DG F   L+KAWPF
Sbjct  292  GDFQDLIMWDQLTDNARRALNEVNW-------GAANVPMNDGNFGGKLDKAWPF  338

>PHYRA_72438
Length=236

 Score = 219 bits (559),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 143/229 (62%), Gaps = 15/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF +P P + SQ AAV +KPQL I +GCHPYPAV  DG+ SGGL  +G    
Sbjct  21   VIDHDTVVPFAQPTPTSVSQVAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSSA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +VW++
Sbjct  81   GCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVWLN  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP + +  IL VS SA   Y    PP+++++DG S K++ YY+ L  + + ++T DTGE 
Sbjct  134  NPAVSSPEILAVSTSAHSGYTFYYPPDSDYLDGNSAKID-YYSVLLINHAFRMTSDTGET  192

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+ +         +P KD  F+  L  AW
Sbjct  193  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDTNFETKLANAW  234

>PHYSO_406265
Length=232

 Score = 219 bits (559),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 147/236 (62%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH++V PF +PEPVT S++AAVK+KPQL I +GCH YPAV + G  SGGLK +G   
Sbjct  16   KTIGHDEVVPFKQPEPVTISERAAVKFKPQLHISNGCHAYPAVNELGETSGGLKKTGAPS  75

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
             +C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  76   SKCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPS-------SGLGHRHDWEHVIVWI  128

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            DNP++    IL V+ SA   Y+++ PP+A+ VDG SVK+ Y      NH     +L+ T 
Sbjct  129  DNPDMPEPKILAVTPSAHSGYSAQVPPDADKVDGPSVKVNYESKWPINH-----ALESTT  183

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
              G++QDL+ W Q+T  AR +L+NT       N     +P+  G F   L KAWPF
Sbjct  184  KGGDYQDLIMWTQMTDAARQALDNT-------NFGSANVPMNSGNFLGKLGKAWPF  232

>PHYRA_42876
Length=213

 Score = 218 bits (554),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 143/232 (62%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEP+T S+K+ VK+KPQ+ + +GCHPYPAV   G   GGLK  G     
Sbjct  1    IDHDQVQPFAQPEPITISEKSGVKFKPQIHVTNGCHPYPAVNYKGETGGGLKTKGAPSAG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y R+ W  DVWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  61   CKGSGWGSQVYGRAAWHRDVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDT  198
            P++EN  IL V+ SA   Y+ + PP A+ VDG S K+EY      NH     +L+ T   
Sbjct  114  PDVENPKILAVTPSAHSGYSKQVPPNADSVDGTSAKVEYKSKWPINH-----ALESTSQG  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            G+FQDL+ WDQL++ AR +LN+  W +          P+ DG F   L+KAW
Sbjct  169  GDFQDLIMWDQLSENARRALNSVPWGDA-------NTPMNDGNFLPKLDKAW  213

>PYVX_22467
Length=236

 Score = 218 bits (556),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 140/234 (60%), Gaps = 23/234 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
             VI H+QV PF +P   + S KAAVK+KPQL I DGCHPYPAV   G+ SGGLK SG   
Sbjct  20   SVIDHDQVVPFAQPTATSTSHKAAVKFKPQLHISDGCHPYPAVDSSGNTSGGLKPSGSSS  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQIY RS W N VWAIMY+WYFPK   +          GHRH+WE+ +VWI
Sbjct  80   AGCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVVVWI  132

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
             NP +++ T+  VS SA   Y+   PP ++++DG S K++Y+     NH F     ++T 
Sbjct  133  SNPAVDSPTVYAVSTSAHSGYSIYYPPSSSYMDGNSAKIDYFKIVVINHAF-----RMTS  187

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
              GE QDL+ WDQ+T  AR +L NTD+ +         +P KDG F   L  AW
Sbjct  188  SAGETQDLIMWDQMTDAARIALENTDFGDA-------NVPFKDGNFMTKLASAW  234

>PHYRA_71308
Length=236

 Score = 218 bits (555),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 142/229 (62%), Gaps = 15/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF +P P + SQ AAV +KPQL I +GCHPYPAV  DG+ SGGL  +G    
Sbjct  21   VIDHDTVVPFAQPTPTSVSQIAAVNFKPQLHITNGCHPYPAVDADGNTSGGLNPTGSSSA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY RS W N VWAIMY+WYFPK   A         FGHRH+WE+ +VW++
Sbjct  81   GCKGSGYGSQIYGRSTWYNGVWAIMYSWYFPKDSPA-------SGFGHRHDWEHIVVWLN  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP + +  IL VS SA   Y    PP+ +++DG S K++ YY+ L  + + ++T DTGE 
Sbjct  134  NPAVSSPEILAVSTSAHSGYTFYYPPDLDYLDGNSAKID-YYSVLLINHAFRMTSDTGET  192

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+ +         +P KD  F+  L  AW
Sbjct  193  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDTNFETKLANAW  234

>PHYCA_108039
Length=215

 Score = 216 bits (550),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 146/234 (62%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H+QV+PF +P+PVT S+KAAVK+KPQ+ I +GCHPYPAV   G  SGGLK  G     
Sbjct  1    MDHDQVQPFKQPDPVTVSEKAAVKFKPQIHITNGCHPYPAVTWWGETSGGLKTKGAPSAG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS WV  VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  61   CKGSGWGSQVYGRSTWVKGVWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDT  198
            P++EN  IL V+ SA   Y+ + PP A+ VDG SVK++Y      NH     +L+ T + 
Sbjct  114  PDIENPKILAVTPSAHSGYSKQVPPSADCVDGTSVKVKYESKWPINH-----ALESTTEG  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            GE QDL+ W+QL++ A  ++N+  W +          P  DG F   L+KAWPF
Sbjct  169  GETQDLIMWNQLSENALRAMNSVTWGDA-------NCPFCDGNFQAKLDKAWPF  215

>PPTG_07660
Length=216

 Score = 215 bits (548),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (68%), Gaps = 8/220 (4%)

Query  35   EPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYA  94
            EP T S+K+A+KYKPQL I  GCHPYPAVQ +GSISGGLKWSG  +G+C    LGSQ+Y+
Sbjct  2    EPTTDSEKSAIKYKPQLHISYGCHPYPAVQANGSISGGLKWSGKTNGDCEQPNLGSQVYS  61

Query  95   RSKWVNDVWAIMYAWYFPKGRGAVPAPLILRL-FGHRHNWEYAIVWIDNPELENSTILGV  153
            RS W    WAIMYAWY PK      A  +L+   GHRH W Y++VW D+P  +NSTILGV
Sbjct  62   RSDWYKGKWAIMYAWYLPKA-----AQFMLKFDTGHRHFWLYSMVWTDSPNPDNSTILGV  116

Query  154  SISASISYASETPPEANHVD-GESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTK  212
            S+S S  Y  +  P+  +++ G ++KLE Y     G  +L+LT+ +GE QDLVTW+QLT 
Sbjct  117  SMSGSRGYVKKPSPKTKYIEKGTTIKLESYVGFWMGVQALRLTKKSGETQDLVTWEQLTD  176

Query  213  LARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             AR +L+  D+ E+  +++ + MPLKD  F  +L  ++PF
Sbjct  177  EARDALSEFDF-ESDPSISMVVMPLKDDVFRSILKDSYPF  215

>PHYCA_118356
Length=252

 Score = 216 bits (551),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/232 (47%), Positives = 143/232 (62%), Gaps = 9/232 (4%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            ++ H++V+PF +P P    ++AAVKYKP+L +  GCHPYPAVQ +GS+S GL+ SGP DG
Sbjct  23   LMDHDKVKPFAQPIPTNSFEEAAVKYKPELFVSYGCHPYPAVQANGSVSAGLEGSGPDDG  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            EC GS+LGSQ+Y+RS W ND WAIMY WY PKGR              RH WE A++WID
Sbjct  83   ECKGSRLGSQVYSRSDWYNDKWAIMYTWYLPKGRSGK--------LQDRHFWETAVIWID  134

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESV-KLEYYYNHLFGSTSLQLTEDTGE  200
            +P LE+S +LGVS++      S+   +  H++   V K E Y         L+ TE  G+
Sbjct  135  DPTLEDSKLLGVSLNYEDRRVSKIAIKGRHLNASKVLKFESYEAEKSPKPRLRFTEKAGK  194

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             QDL+TWDQL   AR  L+ T +  + F     +MPLKD  F + L  AWPF
Sbjct  195  TQDLITWDQLPAKARKGLSTTKFYSSPFGSVKREMPLKDEVFLKRLKDAWPF  246

>PHYSO_259736
Length=231

 Score = 216 bits (549),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 139/230 (60%), Gaps = 22/230 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV PF + EPV  S KAA+K+KP+L+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEPVNASDKAAIKFKPKLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W    WAI+                      HRH W Y ++WIDN
Sbjct  84   CKGSGLGSQVYSRSDWYQGKWAII----------------------HRHLWLYLVLWIDN  121

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            PE  N  ILGV +  +       PP+A  +DG S+K+EYY +   G T +QLTE+ GEFQ
Sbjct  122  PEAANPAILGVWLRTAGGNEQRVPPDAKFIDGSSLKVEYYKSSWHGKTGIQLTENPGEFQ  181

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DLVTW+Q+T+ AR +L   ++D        L +P  DGEF   L KAW F
Sbjct  182  DLVTWEQMTEEARIALTEANFDGHWQERKDLDVPFIDGEFTVNLEKAWIF  231

>PITG_22668
Length=519

 Score = 224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 146/236 (62%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V PF + EPVT S+KAAVK+KPQL I  GCHPYPAV   G  SGGLK SG   
Sbjct  302  KIIDHDAVVPFKQTEPVTISEKAAVKFKPQLHITGGCHPYPAVNAIGQTSGGLKTSGAPS  361

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  362  AGCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWI  414

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            DNPEL    IL VS SA   Y+++ PP+AN V+G SVK++Y      NH     +L+ T 
Sbjct  415  DNPELAEPKILAVSPSAHGGYSAQVPPDANKVEGTSVKVKYLSKWPINH-----ALESTG  469

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + G++QDL+ W Q+T  AR  L+ T + +         +P+ DG F+  L +AWPF
Sbjct  470  EGGDYQDLIMWGQMTDAAREGLSRTGFGKA-------NVPMNDGNFESKLGRAWPF  518

>PHYRA_71618
Length=243

 Score = 215 bits (547),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 150/234 (64%), Gaps = 18/234 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+PVT S+KAAV++KP L+I+ GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVWLDN  136

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYY---NHLFGSTSLQLTEDT  198
            P LE  T++GVS S+ + +Y+  TPP A+ ++G +  + Y     NH F S      +  
Sbjct  137  PALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNHGFHSVDTTW-KTG  195

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            GEFQDL+ W+QLT  AR +LN+TD+ E         +P  D  F   L KAWP+
Sbjct  196  GEFQDLIMWEQLTDEARAALNDTDFGEHAL------VPFIDANFKANLEKAWPY  243

>PHYSO_254112
Length=224

 Score = 214 bits (545),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 142/228 (62%), Gaps = 28/228 (12%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEP T S+ AAVK+KP L++  GC PYPAV  +GS+S  LKW+G  DG+
Sbjct  24   INHDQVQPFAQPEPATDSETAAVKFKPFLEVSYGCEPYPAVSANGSVSASLKWTGKNDGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG-RGAVPAPLILRLFGHRHNWEYAIVWID  141
            C GS LGSQ+Y+RS W  D WA+MYAWYFPKG +GA           HRH W +A+VWID
Sbjct  84   CEGSALGSQVYSRSDWYKDKWAMMYAWYFPKGWQGA-------STVSHRHLWLHAVVWID  136

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP L+NSTIL VS          TP          VKL+           L+LT D GE 
Sbjct  137  NPALDNSTILAVS----------TP----------VKLDASRGFWASKMLLKLTTDKGES  176

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            QDL+TWDQ+T+ AR +L+  ++D+ LF     K+P KDG F + L KA
Sbjct  177  QDLITWDQMTEEARTALSEANFDKHLFKRKNTKVPFKDGVFTDKLKKA  224

>PHYKE_5753
Length=238

 Score = 214 bits (546),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 140/230 (61%), Gaps = 14/230 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +    + +   A+K+KPQ+ I +GCHPYPAV  +G  SGGLK SG +  
Sbjct  21   VISHDQVIPFAQSAATSITNTVALKFKPQIFINNGCHPYPAVNGNGDTSGGLKPSGSESA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W N+VWAIMY+WYFPK          +   GHRH+WE+ +VWID
Sbjct  81   GCKGSGYGSQVYGRSTWYNNVWAIMYSWYFPKDNP-------VTGMGHRHDWEHVVVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP +EN TIL V+ SA   Y++  PP+ + VDG S K++Y  + +  +  L  T   GEF
Sbjct  134  NPAMENPTILAVTPSAHSGYSTYAPPDPSTVDGASAKVQYTSSWIVINHHLDTTSTAGEF  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
            QDL+ W  LT  AR +LN  D++          +P+KDG F+  L  A+P
Sbjct  194  QDLIMWGDLTDAARNALNTADFEAA-------NVPMKDGNFESKLGNAYP  236

>PHYRA_71931
Length=239

 Score = 214 bits (544),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 142/231 (61%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             + H+QV+PF +PEP T S+KA VK+KPQ+ I +GCHPYPAV  +G   GGLK +G    
Sbjct  22   AMDHDQVQPFAQPEPATISEKAGVKFKPQIHITNGCHPYPAVNWNGDTGGGLKPTGAPSS  81

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ +VWI 
Sbjct  82   SCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVVVWIT  134

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++EN  IL VS SA   Y+    P A+ +DG +VK+  Y +H   + +L +T + G+ 
Sbjct  135  NPDVENPVILAVSPSAHSGYSYYVSPSADTIDGTAVKVN-YESHWPINHALDITTEGGDT  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQ+T  AR SLN   + +         +P+ DG F   L KAWP+
Sbjct  194  QDLIMWDQMTDAARNSLNTVSFGDA-------NVPMNDGNFQNKLGKAWPW  237

>PHYSO_468315
Length=255

 Score = 214 bits (544),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 139/231 (60%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +PE VT S+KAAVK+KPQL I +GCH YPAV + G  SGGLK  G    
Sbjct  38   TIDHDQVKPFAQPESVTISEKAAVKFKPQLHITNGCHAYPAVDEAGQTSGGLKTKGAPSA  97

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W  DVWAIMY WYFPK     P+  I    GHRH+WE+ +VWID
Sbjct  98   GCKGSGWGSQVYGRSGWYQDVWAIMYCWYFPKDE---PSSGI----GHRHDWEHVVVWID  150

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++EN  IL  + SA   Y    PP A  VDG + K+  + +H     +L  T + G+F
Sbjct  151  NPDVENPKILAGTPSAHSGYHKYAPPNAGTVDGVTTKVA-FESHWPMDHALDSTTEGGDF  209

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ WDQLT  AR +LN+        +      P+ DG F   L +AWPF
Sbjct  210  QDLIMWDQLTDNARRALNS-------VSFGSADTPMNDGNFQAELGRAWPF  253

>PPTG_08005
Length=759

 Score = 227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 148/236 (63%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H+ V PF +PEPVT S+KAA+K+KPQL I +GCH YPAV   G  SGGLK SG   
Sbjct  542  KIIDHDAVVPFKQPEPVTISEKAAIKFKPQLHITNGCHAYPAVNAIGETSGGLKTSGAPS  601

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQ+Y RS W N VWAIMY+WYFPK   +          GHRH+WE+ IVWI
Sbjct  602  AGCKGSGWGSQVYGRSTWYNGVWAIMYSWYFPKDSPSTG-------LGHRHDWEHVIVWI  654

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            DNPE+    IL V+ SA   Y+++ PP+AN VDG SVK++Y      NH     +L+ T 
Sbjct  655  DNPEIAEPKILAVTPSAHSGYSAQVPPDANKVDGTSVKVKYLSKWPINH-----ALESTG  709

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + G++QDL+ W Q+T  AR +L+ T + +         +P+ DG F+  L KAWPF
Sbjct  710  EGGDYQDLIMWGQMTDAAREALSRTSFGDA-------NVPMNDGNFEPKLGKAWPF  758

>PHYRA_71588
Length=242

 Score = 213 bits (542),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 149/233 (64%), Gaps = 16/233 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V+PF +P+PVT S+K AV++KP L+I++GCH YPAV   G  + GLK +G   G+
Sbjct  23   IGHDKVQPFAQPDPVTISEKTAVRFKPILRIDNGCHSYPAVNAAGETNAGLKGTGRPSGD  82

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y RS W  D+WAIMYAWYFPK       P++ +  G RH+W   +VW+DN
Sbjct  83   CKGSSLGSQVYGRSVWHGDLWAIMYAWYFPKDM-----PILGK--GKRHDWANVVVWLDN  135

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYYNHL-FGSTSLQLT-EDTG  199
            P  E  TI+GVS SA + +YA  TPP AN + G +  + Y  + L +G  +L +  E  G
Sbjct  136  PAHERPTIIGVSPSAYVTTYAKYTPPPANRLTGLTSMISYLADDLNYGYHTLDMNWEAGG  195

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            EFQDLV W+QLT  AR +LN+TD+ E         +P  D  F   L KAWP+
Sbjct  196  EFQDLVMWEQLTDEARAALNDTDFGENAL------VPFIDANFKANLEKAWPY  242

>PHYKE_4946
Length=263

 Score = 213 bits (541),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 145/236 (61%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I H  V+PF++PEP+T S+KAAVK+KPQL I  GC  YPAV   G  SGGL+ SG   
Sbjct  47   KTIPHKDVKPFIQPEPITISEKAAVKFKPQLAILSGCVSYPAVNDIGETSGGLQESGSPK  106

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W +DVWAIMY+WYFPK   +          GHRH+WE+ +VWI
Sbjct  107  GGCRGSGHGSQVYGRSVWYSDVWAIMYSWYFPKDSPS-------SRLGHRHDWEHVVVWI  159

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNPE+    IL VS S    +    PP A+ +DG SVK++Y +    NH     +L +T+
Sbjct  160  DNPEVLEPKILAVSPSYHSGHKKYAPPSADVIDGTSVKVKYEHSWPLNH-----ALDVTD  214

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
              G+FQDL+ WDQ+T LAR +LN     ET F  A +  P+ D  F   L +AWPF
Sbjct  215  KAGDFQDLIMWDQMTDLARVALN-----ETKFGKANV--PMNDHNFLRKLEQAWPF  263

>PYU1_G011237
Length=235

 Score = 211 bits (537),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 138/229 (60%), Gaps = 15/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF EP P + S+KAA+K+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q  
Sbjct  20   VIDHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSA  79

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  G+Q+Y RS W N  WAIMY+WYFPK              GHRH+WE+ +VWID
Sbjct  80   GCKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDS-------PFTGLGHRHDWEHVVVWID  132

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP   N TIL VS SA   Y    PP+A  VDG S K++Y    +  + +L  T   GE 
Sbjct  133  NPANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVDYSSTIVI-NHALDSTTTAGEK  191

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            Q L+ W+Q+T+ AR +L NTD+ +         +P+KDG F   L  A+
Sbjct  192  QPLIMWEQMTQAARTALENTDFGDA-------NVPMKDGNFMTKLANAY  233

>PPTG_18464
Length=247

 Score = 211 bits (536),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 153/233 (66%), Gaps = 8/233 (3%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I H+QV+PF +PEP T S+K+AVKYKPQL I  GCHPY AVQ DGS+SGGL  SG  +
Sbjct  22   RTINHDQVQPFSQPEPTTDSEKSAVKYKPQLHISYGCHPYAAVQADGSVSGGLNRSGWAN  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+  GS LGSQ+Y+RS W    WAI+YAWY+PKG    P        G RH W Y +VW 
Sbjct  82   GDRKGSDLGSQVYSRSDWYRGKWAIVYAWYYPKG----PVFTETGPPGQRHFWSYIVVWT  137

Query  141  DNPELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+P+  +STI GV+I   + Y  + PP+ + + +  +VK+E Y N    + ++QLT+++G
Sbjct  138  DSPKPNHSTIQGVTIPTEVGYEMQVPPKEDFIFEQATVKVESYLNS--ENQAVQLTDESG  195

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+TW+QLT  AR +L+  D++   +    + MPLKD  F  +L +A+PF
Sbjct  196  EIQDLITWEQLTDQARATLSEFDFN-IKWAYVDMVMPLKDDVFSTILEEAFPF  247

>PHYKE_7564
Length=473

 Score = 218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/231 (47%), Positives = 139/231 (60%), Gaps = 14/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +    + +  AA+KYKPQ+ I +GCHPYPAV  +G  SGGLK  G    
Sbjct  256  TIDHDQVQPFPQSAATSLTNTAALKYKPQIFINNGCHPYPAVNANGDTSGGLKTHGSGSA  315

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W N VWAIMY+WYFPK          +   GHRH+WE+ IVWID
Sbjct  316  GCRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDS-------PVSGMGHRHDWEHVIVWID  368

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NPE  N TIL ++ SA   Y++  PP A+ VDG SVK+EY   +L  +  L+ T   GE 
Sbjct  369  NPENVNGTILAMTPSAHSGYSTYAPPPADMVDGASVKVEYTSTYLVINHHLEGTSTAGEM  428

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W  +T  ARY+LN TD            +P+KDG F   L KA+P+
Sbjct  429  QDLIMWGDMTDAARYALNTTD-------FGNANVPMKDGNFLPKLEKAYPW  472

 Score = 197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 124/198 (63%), Gaps = 7/198 (4%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +I H+QV+PF +   ++ +  AA+K+KPQ+ I +GCHPYPAV  +G  SGGLK  G    
Sbjct  21   IINHDQVQPFPQSTAISLTNTAALKFKPQIWINNGCHPYPAVNANGDTSGGLKTHGSSSA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W N VWAIMY+WYFPK              GHRH+WE+ +VWID
Sbjct  81   GCRGSGYGSQVYGRSTWYNGVWAIMYSWYFPKDEPQ-------DFTGHRHDWEHVVVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP+  N  IL ++ SA   Y++  PP+A+ +DG SVK+EY  + LF    L+ T   GE 
Sbjct  134  NPQNVNPRILAMTPSAHSGYSTYAPPDADMIDGTSVKVEYTSSWLFIDHHLEGTSTAGEM  193

Query  202  QDLVTWDQLTKLARYSLN  219
            QDL+ W  +T  AR SLN
Sbjct  194  QDLIMWSDMTDAARNSLN  211

>PYU1_G011231
Length=238

 Score = 210 bits (534),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 139/228 (61%), Gaps = 15/228 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV PF EP P + S+KAA+K+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSISEKAAIKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  G+Q+Y RS W N  WAIMY+WYFPK              GHRH+WE+ +VWIDN
Sbjct  84   CKGSGWGTQVYGRSAWYNGKWAIMYSWYFPKDS-------PFTGLGHRHDWEHVVVWIDN  136

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P   N TIL VS SA   Y    PP+A  VDG S K++ Y + +  + +L  T   GE Q
Sbjct  137  PANANPTILAVSPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             L+ W+Q+T+ AR +L NT + +         +P+KDG F + L KA+
Sbjct  196  PLIMWEQMTQAARTALENTGFGDA-------NVPMKDGNFMDKLAKAY  236

>PHYRA_72475
Length=243

 Score = 209 bits (533),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 148/234 (63%), Gaps = 18/234 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+KAAV++KP L+I+ GCHPYPAV   G  SGGLK +G   G+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDTGCHPYPAVNAAGETSGGLKGTGMPSGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDQ-----PTFSK--GKRHDWANVVVWLDN  136

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYY---NHLFGSTSLQLTEDT  198
            P LE  TI+GVS S+ + +Y+  TPP A+ + G +  + Y     NH F S      +  
Sbjct  137  PALERPTIIGVSPSSYVTTYSKYTPPPADGLSGTTSMINYLADANNHGFHSVDTTW-KTG  195

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            GEFQDL+ W+QLT  AR + N+TD+ E         +P  D  F   L KAWP+
Sbjct  196  GEFQDLIMWEQLTDEARGAFNDTDFGEH------APVPFIDPNFKANLEKAWPY  243

>PHALS_06162
Length=488

 Score = 217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 149/236 (63%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + + H++V PF +P+PVT ++ AAVK+KPQ+ I +GCHPYPAV   G ISGGLK SG  D
Sbjct  265  KTMRHDKVVPFKQPKPVTVAEHAAVKFKPQINIVNGCHPYPAVNATGEISGGLKASGSSD  324

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS+ GSQ+Y RS W   +WAIMY+WYFPK   A P      L GHRH+WE+ IVWI
Sbjct  325  AGCKGSEYGSQVYGRSTWHRGLWAIMYSWYFPKDT-AFP------LLGHRHDWEHIIVWI  377

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            DNP L    IL V+ SA   Y  ++PP  + V+G SVK++Y      NH   ST+     
Sbjct  378  DNPSLYKPRILAVASSAHSWYTVQSPPHTDRVNGTSVKVKYAGIWPLNHALTSTT-----  432

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             +GE+QDL+ W+QLT+ AR SL   +     F +A   +P++DG F + L+ AW F
Sbjct  433  KSGEYQDLIMWEQLTEAARQSLQQAN-----FGMA--NVPMRDGNFLDKLDTAWSF  481

>PHYRA_72345
Length=240

 Score = 209 bits (532),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 136/231 (59%), Gaps = 14/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VIGH+QV PF + +P + +  AA+ +KPQ+ I +GCHPYP V  +G   GGLK +G    
Sbjct  21   VIGHDQVVPFPQSQPTSITNTAALLFKPQIWINNGCHPYPVVNANGDTGGGLKTTGSSAA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W N VWAIMY+WYFPK              GHRH+WE+ +VWID
Sbjct  81   GCRGSGYGSQVYGRSAWYNGVWAIMYSWYFPKDEPQ-------DFTGHRHDWEHVVVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP+  N  IL ++ SA   Y++  PP+A+ VDG S K+EY  + LF    L+ T   GE 
Sbjct  134  NPQNTNPKILAMTPSAHSGYSTYAPPDADMVDGTSCKVEYTSSWLFIDHHLEGTSTAGET  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W  +T  ARY+LN T       N      P+ DG F   L KA+P+
Sbjct  194  QDLIMWGDMTDAARYALNTT-------NFGKANTPMNDGNFLPKLGKAYPW  237

>PHYCA_18373
Length=246

 Score = 209 bits (531),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 134/211 (64%), Gaps = 13/211 (6%)

Query  42   KAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVND  101
            KAAVK+KPQL I  GCHPYPAVQ DG +S GLK +GP DGEC GS LGSQIYARS W   
Sbjct  49   KAAVKFKPQLHISYGCHPYPAVQADGVVSAGLKPTGPDDGECQGSSLGSQIYARSDWYKG  108

Query  102  VWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISY  161
            V+AIMY WY PKG  +            RH WE  +VWID+P   NSTILGVS++  +  
Sbjct  109  VYAIMYTWYLPKGSAS------------RHFWESVVVWIDDPAASNSTILGVSLNYGLQL  156

Query  162  ASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNT  221
              ET  +  ++ G S+KL+ +      +  L+LTE  GEFQDLVT+DQLT  A  +L++ 
Sbjct  157  KKETNIDPKYLSGSSLKLDSFPGFAINNPKLRLTELDGEFQDLVTFDQLTDAAGIALSHA  216

Query  222  DWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            ++ + L   A   MPL DG F+E L  AWPF
Sbjct  217  EFSKGLIK-AKTPMPLIDGVFNERLKDAWPF  246

>PPTG_19330
Length=316

 Score = 211 bits (536),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 136/235 (58%), Gaps = 23/235 (10%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +P+PVT S+KAAVK+KPQL I +GCH YPAV + G  SGGLK  G    
Sbjct  101  TIDHDQVKPFPQPQPVTISEKAAVKFKPQLHITNGCHSYPAVDEAGQTSGGLKTKGAPSA  160

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W   VWAIMY WYFPK   +          GHRH+WE+ IVWID
Sbjct  161  GCKGSGWGSQVYGRSSWYQGVWAIMYCWYFPKDEPST-------GIGHRHDWEHVIVWID  213

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTED  197
            NPE+ N  IL V+ SA   Y    PP  + +DG + K+ Y      +H  GSTS     +
Sbjct  214  NPEIANPKILAVTPSAHSGYHKYAPPNPDTIDGATTKVAYESHWPMDHALGSTS-----E  268

Query  198  TGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             G+FQDL+ W QL++ A  +LN   W            P+ DG F   L KAWPF
Sbjct  269  AGDFQDLIMWGQLSENASRALNAVYW-------GNANTPMNDGNFLPKLAKAWPF  316

>PHYSO_397673
Length=224

 Score = 207 bits (526),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 140/230 (61%), Gaps = 15/230 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+KA VK+KPQ++I +GCHPYPAV + G  SGGLK +G  + +
Sbjct  10   IPHDKVQPFAQPEPVTISEKAGVKFKPQIRIINGCHPYPAVNEAGETSGGLKTTGGHNSK  69

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
               S   SQ+Y RS W   VWAIMY+WYFPK   +          GHRH+WE+ IVWIDN
Sbjct  70   SKRSGWNSQVYGRSTWFRGVWAIMYSWYFPKDSPS-------HGLGHRHDWEHVIVWIDN  122

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P+     IL V+ SA   Y    PP AN VDG S K+  Y +H   +  L +T D+GEFQ
Sbjct  123  PDASEPKILAVTPSAHGDYQKYAPPNANTVDGTSAKV-VYESHWPMNHELSVTSDSGEFQ  181

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+ W Q+++ AR + N+        +      P+ D  F++ L KAWPF
Sbjct  182  DLIMWSQMSENARRAFNSV-------SFGKANTPMNDWGFEDRLGKAWPF  224

>PPTG_07089
Length=255

 Score = 208 bits (529),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 146/236 (62%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I H +V+PF EP+PVT S+KA VK+KPQ+ ++ GC PYPAV +DG  SGGL+ SG   
Sbjct  37   KTISHKEVKPFAEPKPVTISEKAGVKFKPQIAVKTGCVPYPAVNEDGETSGGLQTSGSPQ  96

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W N +WAIMY+WYFPK   +          GHRH+WE+ +V+I
Sbjct  97   GGCRGSGHGSQVYGRSTWFNGLWAIMYSWYFPKDAPS-------SRMGHRHDWEHIVVFI  149

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNPE+    ILG S S    Y    P  A+ +DG SVK++Y +    NH     +L +T+
Sbjct  150  DNPEVPEPKILGCSPSWHSGYNKYAPCPADVIDGSSVKVKYEHSWPLNH-----ALDITK  204

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + G+FQDL+ WDQ++ LAR +LN+T + +          P+ D  F   + K+WPF
Sbjct  205  EAGDFQDLIMWDQMSDLARRALNDTKFGKA-------NTPMNDWNFLGKVEKSWPF  253

>PHYCA_119748
Length=261

 Score = 208 bits (529),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 142/236 (60%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            +VIGH+QV+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV + G   GGLK +G   
Sbjct  45   KVIGHDQVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETGGGLKTTGKSR  104

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W   VWAIMY+WYFPK     P+P +    GHRH+WE+AIV+I
Sbjct  105  GNCGGSGYGSQVYGRSTWYQGVWAIMYSWYFPKDS---PSPKM----GHRHDWEHAIVFI  157

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            DNPE+    IL  S+S+   Y    P     +DG S+K+ Y     YNH      L  T 
Sbjct  158  DNPEVSEPKILACSVSSHSGYTKYNPCPPWVIDGTSLKVRYKHAWPYNH-----DLDATG  212

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G+FQDL+ W+QLT+ AR +LN+        +      P  D +F   +  AWPF
Sbjct  213  DGGKFQDLIMWNQLTEDARRALNSV-------SFGKANTPFSDDKFMPKIENAWPF  261

>PHYSO_414520
Length=213

 Score = 206 bits (523),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 139/232 (60%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V+PF +PEPVT S+KAA+K+KPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    INHDAVKPFPQPEPVTISEKAAIKFKPQIRIATGCVPYPAVNDVGETSGGLQTSGSPKGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y R+ W NDVWAIMY+WYFPK   +          GHRH+WE+ +VWI+N
Sbjct  61   CRGSGHGSQVYGRAGWFNDVWAIMYSWYFPKDSPS-------SRMGHRHDWEHVVVWINN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    ILG+S SA   Y   + P   ++DG SVK+ Y +    NH     +L  T+  
Sbjct  114  PDVPEPKILGISASAHSGYKKYSSPPPENLDGNSVKVNYEHAWPINH-----ALDTTDKA  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            G FQDL+ W+Q+T+ AR +LN         +      P+ DG F   L +AW
Sbjct  169  GTFQDLIMWEQMTEDARRALN-------AVHFGKANTPMNDGNFRHKLERAW  213

>PITG_22916
Length=248

 Score = 207 bits (526),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 140/232 (60%), Gaps = 5/232 (2%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I H+QVRPF +P   T  +KAAVKYKPQL IEDGCHPYPAV++DG+IS GL+WSG  +
Sbjct  21   ETIDHDQVRPFAQPNAATTKEKAAVKYKPQLYIEDGCHPYPAVEEDGTISAGLEWSGDHN  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C  S  GSQ+Y+R     D +AIMYAWYFPKG+G            HRH+WE+ I+W 
Sbjct  81   GHCKKSPRGSQVYSRGGSYKDKYAIMYAWYFPKGKGHSRK----HHDEHRHDWEFGIIWF  136

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D     +S+I GV+ +       E P +  HV G  +KLE Y         L+LT+  G+
Sbjct  137  DRDSDTDSSIAGVTTNIGRDLHDEVPLQPVHVVGSHIKLESYSTFWSAKQGLRLTKKKGD  196

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             QDL+ W+QL K A+ +LN+ D+D T      + +P  D  F E +  ++PF
Sbjct  197  IQDLIQWEQLPKAAQTALNDADFD-TDKAKTPVVVPFNDNYFQEKVAASYPF  247

>PYIR_13251
Length=236

 Score = 206 bits (524),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 135/228 (59%), Gaps = 15/228 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V PF +P PVT  QK A+K+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q   
Sbjct  22   IAHDAVVPFAQPTPVTLEQKVALKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  G+Q+Y R+    DV+A+MY+WYFPK              GHRH+WE+ +VWIDN
Sbjct  82   CKGSGWGTQVYGRAAAYKDVYALMYSWYFPKDS-------PFTGLGHRHDWEHVVVWIDN  134

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P + N TIL V+ SA   Y    PP+A  VDG S K++ Y + +  + +L  T D GE Q
Sbjct  135  PAVANPTILAVTPSAHSGYEKYAPPKAGTVDGTSAKVD-YTSKVVINHALDSTTDAGEKQ  193

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             L+ WDQLT  AR +L NT       N     +P+KDG F   L  A+
Sbjct  194  PLIMWDQLTAAARSALENT-------NFGDANVPMKDGNFMTKLGNAY  234

>PHYRA_74617
Length=337

 Score = 209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 141/234 (60%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V+PF +PEPVT S KA VK+KPQ++I  GC+PYPAV + G + GGLK SG   G 
Sbjct  123  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKTSGKSRGN  182

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W N VWAIMY+WYFPK     P+P +    GHRH+WE+A+V+IDN
Sbjct  183  CAGSGHGSQVYGRSTWHNQVWAIMYSWYFPKDS---PSPGM----GHRHDWEHAVVFIDN  235

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    ILG S+S+   Y    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  236  PDVPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPINH-----DLDTTGDG  290

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G FQDL+ W Q+T  AR +LN         N      P+ DG F   + K+WPF
Sbjct  291  GIFQDLIMWGQMTDNARRALNEA-------NFGSANTPMNDGNFYSKVEKSWPF  337

>PPTG_07661
Length=223

 Score = 205 bits (521),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 148/225 (66%), Gaps = 11/225 (5%)

Query  35   EPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYA  94
            EP T S+K+A+KYKPQL I  GC+PYPAVQ +G+ISGGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  95   RSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVS  154
            RS W    WAIMYAWYFPK  GA  A    R  GHRH W  AIVW DN   +NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  155  ISASISYASETPPEANHVD-GESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKL  213
            +S S  Y  +  P+  +++ G ++KL+ Y      + +L+LT+ +G  QDLVTW+QLT  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  214  ARYSLNNTDWD----ETLFNLAG--LKMPLKDGEFDELLNKAWPF  252
            AR +L+  D+D    + +F  +G  + MPL+DG F  +L +++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVMPLEDGVFTSILEESYPF  222

>PHYRA_72165
Length=240

 Score = 206 bits (523),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 145/234 (62%), Gaps = 22/234 (9%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+KAAV++KP L+I+ GCHPYPAV   G  + GLK +GP  G+
Sbjct  23   IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGPSSGD  82

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +            G RH+W   +VW+DN
Sbjct  83   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDKPTFGE-------GGRHDWANVVVWLDN  135

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT---  198
            P +E  TI+GVS S+ + +Y   TPP A+ + G +  + Y  + +  +      + T   
Sbjct  136  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLADDM--NNGFHTVDTTWLP  193

Query  199  -GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
             GEFQDL+ W+QLT  AR +L++TD+        G  +P  D  F   L KAWP
Sbjct  194  GGEFQDLIMWEQLTDEARAALSDTDF--------GALVPFIDANFKANLEKAWP  239

>PHYCA_108409
Length=282

 Score = 206 bits (525),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 138/236 (58%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH++V+PF EP+PVT S+KA VK+KPQ++I  GC PYPAV + G  SGGLK +G   
Sbjct  66   KTIGHDEVKPFPEPKPVTVSEKAGVKFKPQIQIRTGCVPYPAVDETGQTSGGLKPTGNSK  125

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y R  W+  VW IMY+WYFPK   +          GHRH+WE+AIV+I
Sbjct  126  GGCRGSGHGSQVYGRGTWIQGVWGIMYSWYFPKDSPST-------GMGHRHDWEHAIVFI  178

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNP++    IL  S+S+   Y    P     +DG S+K+ Y +    NH      L  T 
Sbjct  179  DNPDVPEPKILACSVSSHAGYKKYNPCPPWVIDGTSLKVRYKHGWPLNH-----DLDTTG  233

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G FQDL+ WDQ+T+ AR +LN+        +      P  DG F   L KAWPF
Sbjct  234  DAGTFQDLIMWDQMTEDARRALNS-------VHFGSANTPFNDGNFKPKLEKAWPF  282

>PHYSO_334487
Length=258

 Score = 206 bits (523),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 135/231 (58%), Gaps = 14/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +IGH+QV PF + +P T S KAA+K+KPQL I +GCHPYP V   G   GGLK  G    
Sbjct  21   IIGHDQVVPFPQSQPTTISNKAALKFKPQLWINNGCHPYPVVNAAGDTGGGLKTHGSSAA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C  S  GSQ+Y RS W N VWAIMY WYFPK              GHRH+WE+ IVWID
Sbjct  81   GCRCSGYGSQVYGRSTWYNGVWAIMYCWYFPKDEPQ-------DGTGHRHDWEHVIVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++EN  I+ ++ SA   Y++   P A+ VDG S K+EY  + LF    L+ T   GEF
Sbjct  134  NPDVENPKIMAMTPSAHSGYSTYALPPADMVDGTSCKVEYTSSWLFIDHHLEGTSTAGEF  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W  LT  AR +LN T + +          P+ DG F   + KA+P+
Sbjct  194  QDLIMWSDLTDGARLALNTTSFGKA-------NTPMNDGNFLPKIQKAYPW  237

>PPTG_12852
Length=331

 Score = 208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 142/236 (60%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH+ V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGLK SG   
Sbjct  115  KTIGHDDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEYGETSGGLKTSGKSR  174

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P+P +    GHRH+WEY +V+I
Sbjct  175  GNCGGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDS---PSPGM----GHRHDWEYVVVFI  227

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            +NPE++   IL  S+++   Y    P     +DG S+K+ Y +    NH      L  T 
Sbjct  228  NNPEVQEPKILACSVASHGGYKKFNPCPPWVIDGTSLKVRYKHAWPMNH-----DLDTTG  282

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G FQDL+ WDQ+T  AR +LN+  + +          P  DG F + L  AWPF
Sbjct  283  DGGSFQDLIMWDQMTNDARRALNSVSFGKA-------NTPFIDGRFRKKLEDAWPF  331

>PPTG_12847
Length=331

 Score = 208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 140/236 (59%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH++V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGL+ SG   
Sbjct  113  KTIGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPR  172

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+I
Sbjct  173  GGCRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFI  225

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNPE+    IL  S+S+   Y   +P     +DG S+K+ Y +    NH      L  T 
Sbjct  226  DNPEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPLNH-----DLDTTG  280

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G FQDL+ WDQ++  AR +LN+        +      P  DG F   L KAWPF
Sbjct  281  DAGTFQDLIMWDQMSNDARRALNS-------VHFGKANTPFNDGNFRPKLEKAWPF  329

>PHYSO_510888
Length=255

 Score = 205 bits (522),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 141/232 (61%), Gaps = 15/232 (6%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH++V+PF +P+PVT S+KAAVK+KPQ+ I  GC PYPAV   G  SGGL+ SG   
Sbjct  38   KTIGHDEVKPFPQPDPVTISEKAAVKFKPQIDIVTGCVPYPAVNDAGETSGGLQTSGSPR  97

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W+N VWAIMY+WYFPK   +          GHRH+WE+ +V+I
Sbjct  98   GGCRGSGHGSQVYGRSTWINGVWAIMYSWYFPKDAPS-------SKMGHRHDWEHVVVFI  150

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP++    ILG S S    Y    P  AN +DG SVK++Y ++    + +L+ T   G 
Sbjct  151  DNPDVPEPKILGCSPSWHNGYNKYAPCPANVIDGTSVKVKYEHSWPL-NHALETTTKPGA  209

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ W+Q+T  AR +LN+T              P+ D  F   + KAWPF
Sbjct  210  FQDLIMWNQMTDFARRALNDT-------KFGKANTPMNDWNFLPKVEKAWPF  254

>PPTG_12853
Length=342

 Score = 208 bits (530),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 140/236 (59%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH++V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGL+ SG   
Sbjct  124  KTIGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPR  183

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+I
Sbjct  184  GGCRGSGHGSQVYGRSTWIEGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFI  236

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNPE+    IL  S+S+   Y   +P     +DG S+K+ Y +    NH      L  T 
Sbjct  237  DNPEVAEPKILACSVSSHDGYKKYSPCPPWVIDGTSLKVRYKHAWPLNH-----DLDTTG  291

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G FQDL+ WDQ++  AR +LN+        +      P  DG F   L KAWPF
Sbjct  292  DAGTFQDLIMWDQMSNDARRALNS-------VHFGKANTPFNDGNFRPKLEKAWPF  340

>PHYSO_334498
Length=229

 Score = 204 bits (519),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 131/218 (60%), Gaps = 15/218 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +PEPVT S+KAAVK+KPQL I +GCHPYPAV + G   GGL  +G   G
Sbjct  24   VISHDQVAPFAQPEPVTISEKAAVKFKPQLHISNGCHPYPAVNEAGDTDGGLSNTGAPSG  83

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS LGSQ+Y RS W  DVW IMYAWYFPK   +          GHRH+WE+A++WID
Sbjct  84   KCKGSGLGSQVYGRSGWHKDVWTIMYAWYFPKDMASFD-------LGHRHDWEHAVIWID  136

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++    ILGVS S+   Y   T   A  ++G SV L Y          L+ T   GE+
Sbjct  137  NPDVAEPKILGVSASSHAGYEKVTTIPAGSLNGTSVLLNYESTWPV-DHELRFTTKGGEY  195

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKD  239
            Q L+ W QLT  AR SL+ TD+   L       MP+ D
Sbjct  196  QPLIMWTQLTDAARVSLSTTDFGSAL-------MPMTD  226

>PYU1_G011233
Length=239

 Score = 204 bits (520),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 136/229 (59%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV+PF EP P T ++K A+K+KPQ+ I +GCHPYPAV   G++ GGLK  G Q  
Sbjct  23   VIDHDQVKPFAEPAPTTLAEKLAIKFKPQIFINNGCHPYPAVDAAGNVGGGLKPDGSQSA  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  G+Q+Y R+   NDV+AIMY+WY PK     P P I    GHRH+WE  +VWID
Sbjct  83   GCKGSGWGTQVYGRAAPYNDVYAIMYSWYMPKD---TPIPGI----GHRHDWENVVVWID  135

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP   N  IL VS SA   Y    PP+A  VDG S K+ Y   +L    SL  T   GE 
Sbjct  136  NPNAANPKILAVSPSAHSGYEKYAPPKAGTVDGTSAKVIYSTTNLVMDHSLDSTTHAGEQ  195

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            Q L+ W+QLT  AR +L +       ++     +P+KDG F + L K++
Sbjct  196  QPLIMWEQLTDAARSTLQD-------YDFGNANVPMKDGNFMDKLGKSY  237

>PHYRA_49009
Length=216

 Score = 203 bits (516),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 145/231 (63%), Gaps = 18/231 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+KAAV++KP L+I+ GCHPYPAV   G  + GLK +G   G+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKAAVRFKPSLRIDHGCHPYPAVNAAGETNAGLKGTGMPSGD  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +            G RH+W   +VW+DN
Sbjct  61   CKGSGLGSQVYARAVWHSDLWAIMYAWYFPKDKAIFGK-------GERHDWANVVVWLDN  113

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYYNHL-FGSTSLQLTEDT-G  199
            P +E  TI+GVS S+ + +Y   TPP A+ + G +  + Y  N +  G  ++  T  T G
Sbjct  114  PAVERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTPMINYLANDMNNGFHTVDTTWKTGG  173

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            EFQDL+ W+QLT  AR +L+NTD+        G  +P  D  F   L KAW
Sbjct  174  EFQDLIMWEQLTDEARAALSNTDF--------GALVPFIDANFKANLEKAW  216

>PPTG_19506
Length=223

 Score = 203 bits (517),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 148/225 (66%), Gaps = 11/225 (5%)

Query  35   EPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYA  94
            EP T S+K+A+KYKPQL I  GC+PYPAVQ +G+ISGGLKWSG  + +C     GSQIY+
Sbjct  2    EPTTDSEKSAIKYKPQLHISKGCYPYPAVQANGAISGGLKWSGWANSDCEKPVQGSQIYS  61

Query  95   RSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVS  154
            RS W    WAIMYAWYFPK  GA  A    R  GHRH W  AIVW DN   +NSTILGVS
Sbjct  62   RSDWYKGKWAIMYAWYFPK--GAFRASKYNR--GHRHFWSSAIVWTDNTNPDNSTILGVS  117

Query  155  ISASISYASETPPEANHVD-GESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKL  213
            +S S  Y  +  P+  +++ G ++KL+ Y      + +L+LT+ +G  QDLVTW+QLT  
Sbjct  118  MSGSKGYVKKPSPKTKYIEKGTTLKLDSYIGFWLSNQALRLTKKSGGTQDLVTWEQLTDE  177

Query  214  ARYSLNNTDWD----ETLFNLAG--LKMPLKDGEFDELLNKAWPF  252
            AR +L+  D+D    + +F  +G  + +PL+DG F  +L +++PF
Sbjct  178  ARDALSKFDFDADTSDAIFFSSGATVVIPLEDGVFTSILEESYPF  222

>PHYCA_69480
Length=213

 Score = 202 bits (515),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 137/232 (59%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    IGHDEVKPFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+IDN
Sbjct  61   CRGSGHGSQVYGRSTWIQGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    IL  S+S+   Y    P     +DG S+KL Y +    NH      L  T D+
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKLRYKHSWPINH-----DLDTTGDS  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            G FQDL+ WDQ+T+ AR +LN+        +      P  DG F   L KAW
Sbjct  169  GTFQDLIMWDQMTEDARRALNSV-------SFGKANTPFNDGSFKPKLEKAW  213

>PHYCA_69477
Length=213

 Score = 202 bits (514),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 138/232 (59%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV   G  SGGL+ SG   G 
Sbjct  1    IGHDEVKPFAQPEPVTISEKAGVKFKPQIQIRTGCVPYPAVNDVGETSGGLQTSGNPKGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK   +          GHRH+WE+AIV+IDN
Sbjct  61   CRGSGHGSQVYGRSTWMQGVWAIMYSWYFPKDSPS-------SRMGHRHDWEHAIVFIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    IL  S+S+   Y    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPINH-----DLDTTGDA  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            G FQDL+ WDQ+T+ AR +LN+  + + +        P  DG F   L KAW
Sbjct  169  GTFQDLIMWDQMTEDARRALNSVSFGKAM-------TPFNDGSFKPKLEKAW  213

>PHYKE_7566
Length=260

 Score = 203 bits (517),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/229 (45%), Positives = 136/229 (59%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P   T  Q A +K+KPQ+ I +GCHPYPAV KDG+ SGGLK +G    
Sbjct  44   VISHDQVVPFAQPTATTTLQAAGIKFKPQIHISNGCHPYPAVNKDGNTSGGLKPTGSASA  103

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY R      V+AIMY+WYFPK          +   GHRH+WE+ IVW+D
Sbjct  104  GCKGSGYGSQIYGRITTYQGVYAIMYSWYFPKDSP-------ITGLGHRHDWEHVIVWVD  156

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L N +I+ VS SA   Y    PP++  +DG S K++Y  ++L  + +L  T D GE 
Sbjct  157  DITLTNPSIVAVSPSAHSGYNIYYPPKSGTIDGYSAKVDYSSSYLVVNHALDSTSDAGET  216

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L NTD+ +         +P+KD  F   L  A+
Sbjct  217  QDLIMWDQLTDAARTALENTDFGDA-------NVPMKDANFQAKLGNAY  258

>PPTG_13769
Length=349

 Score = 206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 137/234 (59%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H  V+PF +PEPVT S+KA VK+KPQ++I  GC PYPAV + G  SGGL  SG   G+
Sbjct  134  IAHKDVKPFPQPEPVTISEKAGVKFKPQIQIRTGCEPYPAVNEFGETSGGLHTSGKSRGK  193

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+  VW IMY+WYFPK   +          GHRH+WE AIV+IDN
Sbjct  194  CGGSGHGSQVYGRSAWLKGVWVIMYSWYFPKDSPS-------HGLGHRHDWEEAIVFIDN  246

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    ILG S+S+   YA   P     +DG S+K+ Y +    NH      L +T D 
Sbjct  247  PDVSEPKILGCSVSSHGGYARHAPCPPWVIDGTSLKVRYKHSWPKNH-----DLAITGDG  301

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G+FQDL+ W Q+T  AR +LN         +      P KDG F + + KAWPF
Sbjct  302  GKFQDLIMWGQMTNDARRALN-------AVSFGSANTPFKDGTFQDKIEKAWPF  348

>PHYRA_74630
Length=343

 Score = 206 bits (523),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 139/234 (59%), Gaps = 23/234 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH++V+PF +PEPVT S KA VK+KPQ++I  GC+PYPAV + G + GGLK +G   G+
Sbjct  129  IGHDEVKPFPQPEPVTISDKAGVKFKPQIQIRTGCNPYPAVNEFGEVGGGLKPTGKSRGK  188

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W N VW IMY+WYFPK     P+P +    GHRH+WE+A+V+IDN
Sbjct  189  CAGSGHGSQVYGRSTWHNSVWVIMYSWYFPKDS---PSPGL----GHRHDWEHAVVFIDN  241

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    IL  S+S+   Y    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  242  PDVPEPKILACSVSSHDGYKKYNPCPPWVIDGTSLKVRYKHSWPINH-----DLDTTGDG  296

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G FQDL+ W Q+T  AR +LN         N      P+ DG F   +  AWPF
Sbjct  297  GTFQDLIMWGQMTDNARRALNEA-------NFGSANTPMNDGNFPNKVQAAWPF  343

>PPTG_13736
Length=236

 Score = 201 bits (512),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 135/231 (58%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             + H+QVRPF +P PV+ S+KAAVK+KPQL I +GCHPYPAV   G  SGGL  SG    
Sbjct  21   ALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYPAVNAAGETSGGLAKSGAPSA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS W    WAIMY+WYFPK   +          GHRH+WE+ IVWID
Sbjct  81   GCKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPST-------GLGHRHDWEHVIVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP++ N  IL V+ SA   Y+   PP+A  V G + K+  Y +H   + +L  T+  GE 
Sbjct  134  NPDVANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKIN-YESHWPVNHALDSTDKGGET  192

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            Q L+ WDQ+T  AR SLN   + +         +P+ DG F   +  A P+
Sbjct  193  QPLIMWDQMTDAARRSLNTVSFGDA-------NVPMNDGNFLRKIGNASPW  236

>PPTG_15231
Length=258

 Score = 202 bits (513),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 139/229 (61%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF +P   T  QKA VK+KPQ+ I +GCHPYPAV  +G+ SGGLK +G    
Sbjct  42   VISHDAVVPFAQPTATTTEQKAGVKFKPQIHISNGCHPYPAVDANGNTSGGLKPTGSSSA  101

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y R    N V+AIMY+WYFPK          +   GHRH+WE+ +VW+D
Sbjct  102  GCKGSGYGSQVYGRVATYNGVYAIMYSWYFPKDSP-------VTGLGHRHDWEHVVVWVD  154

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            + +L++ +I+ VS SA   Y    PPE+N +DG S K++Y  + +  + +L  T D GE 
Sbjct  155  DIKLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVINHALDSTTDAGET  214

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L NTD+ +         +P+KDG F   +  A+
Sbjct  215  QDLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKVGNAY  256

>PYU1_G011235
Length=238

 Score = 201 bits (511),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 136/229 (59%), Gaps = 15/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV PF EP P + S+K AVK+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q  
Sbjct  23   TINHDQVVPFAEPTPSSASEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSA  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  G+Q+Y R     D WAIMY+WYFPK          +   GHRH+WE+ +VWID
Sbjct  83   GCKGSGWGTQVYGRVASYKDKWAIMYSWYFPKDS-------PITGLGHRHDWEHVVVWID  135

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP+  N  IL +S SA   Y    PP+A  VDG S K++ Y + +  + +L  T   GE 
Sbjct  136  NPKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEK  194

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            Q L+ W+Q+T  AR +L NTD+ +         +P+KDG F   L KA+
Sbjct  195  QPLIMWEQMTDAARSALENTDFGKA-------NVPMKDGNFMNKLAKAY  236

>PHYKE_5655
Length=243

 Score = 201 bits (511),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 150/234 (64%), Gaps = 14/234 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +IGH++V+PF +P+PVT S+K AVK+KP L+I+ GCH YPAV     ISGGLK +G  DG
Sbjct  21   IIGHDKVQPFPQPDPVTVSEKTAVKFKPSLRIDSGCHSYPAVNAACEISGGLKGTGSDDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +CTGS LGSQ+Y R+ W ND+WAIMY+WYFPK       P+ +   G RH+W   +VW++
Sbjct  81   DCTGSSLGSQVYGRAVWYNDLWAIMYSWYFPKD-----MPVAIFKKGRRHDWVNVVVWLN  135

Query  142  NPELENSTILGVSISASISYASE-TPPEANHVDGESVKLEYYYN-HLFGSTSLQLTEDT-  198
            +P  E   +LGVS S+ +S  S+ TPP  + ++G S  + Y  N +  G  ++  T +  
Sbjct  136  DPAAEKPIMLGVSPSSYVSSYSKYTPPPVDGLNGMSCMINYLSNPYDHGYHTVDTTRNRG  195

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            GEFQDLV W+QLT  AR SLN T + ET       ++P  D  F   L KAWP+
Sbjct  196  GEFQDLVMWEQLTDAARISLNETAFGET------AQVPFIDENFVANLEKAWPY  243

>PYIR_13252
Length=236

 Score = 200 bits (509),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 132/228 (58%), Gaps = 15/228 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V+PF EP P T + + A+K+KPQ+ I +GC PYPAV   G+ SGGLK SG Q   
Sbjct  22   IAHDAVKPFAEPNPTTTTHRVALKFKPQINISNGCSPYPAVDSAGNTSGGLKPSGSQSAG  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  G+Q+Y R+    D + IMY+WYFPK          L   GHRH+WE+ +VWIDN
Sbjct  82   CKGSGWGTQVYGRAAQYKDAYGIMYSWYFPKDS-------PLTGLGHRHDWEHVVVWIDN  134

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P   N  IL VS SA   Y+   PP+A  VDG S K++ Y + +  + +L  T D GE Q
Sbjct  135  PNAANPKILAVSPSAHSGYSKYAPPKAGTVDGTSAKVD-YTSKVVINHALDSTTDAGEQQ  193

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             L+ WDQLT  AR +L NT       N     +P+KDG F   L  A+
Sbjct  194  PLIMWDQLTAAARSALENT-------NFGDANVPMKDGNFMNKLANAY  234

>HYAP_09243
Length=266

 Score = 201 bits (511),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/229 (45%), Positives = 142/229 (62%), Gaps = 15/229 (7%)

Query  24   GHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGEC  83
            GH+ + PF EP+PVT S+KA VK+KP L +  GC PY AV  +G  SGGL+ SG  +  C
Sbjct  46   GHDAIVPFSEPKPVTISEKAGVKFKPLLDVNTGCAPYAAVNAEGETSGGLQTSGDPESGC  105

Query  84   TGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNP  143
             GSK GSQ+Y RS W NDVWAIMYAWYFPK      +P++  L GHRH+WE  +V+I++P
Sbjct  106  RGSKYGSQVYGRSTWYNDVWAIMYAWYFPKD-----SPML--LMGHRHDWENVVVFINDP  158

Query  144  ELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQD  203
            +    TILG S S    Y    P   + ++G SV ++Y ++    + +L +T+D G +QD
Sbjct  159  DEVEPTILGCSTSWHSGYIKYAPCPTDSINGSSVMIKYEHSFPL-NHALNITKDAGAYQD  217

Query  204  LVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            L+ W Q+  LAR +LN+TD+ + +        P+ D  F E +  AWPF
Sbjct  218  LIMWHQMPDLARRALNDTDFGKAI-------TPMNDLNFMEKIEAAWPF  259

>PPTG_22174
Length=771

 Score = 213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 153/231 (66%), Gaps = 6/231 (3%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF E EP T S+K+A+KYKPQL I DGCHPYP VQ DGS+S GLKWSG     
Sbjct  545  IDHDEVQPFEEMEPTTDSEKSAIKYKPQLHISDGCHPYPVVQADGSVSAGLKWSGRYRSG  604

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W    WAIMYAWYFPKG      P+ +   GHRH W +AIVW D+
Sbjct  605  CKGSDLGSQVYSRSAWYKGKWAIMYAWYFPKGAN----PVSVFGSGHRHYWLHAIVWTDS  660

Query  143  PELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            P  +NSTILG S++ + +    +  ++ ++ +G S+KL+ +     G  +L+LT+ +GE 
Sbjct  661  PNPDNSTILGASMAGTTNNEKTSTVKSKYLANGTSLKLDSFVGLWTGIQALRLTKKSGET  720

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+TW+QLT  AR +L++  ++ +      + MPL+D  F  LL  ++PF
Sbjct  721  QDLITWEQLTDEARDALSDFSFESSESR-EWVVMPLRDSAFKVLLKNSYPF  770

>PHYKE_4541
Length=147

 Score = 197 bits (500),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 111/147 (76%), Gaps = 0/147 (0%)

Query  106  MYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASET  165
            MYAWYFPKGR AV      R FGHRHNWEYAIVWIDNP L++  ILGVS+SA+ SY+   
Sbjct  1    MYAWYFPKGREAVSMHPYARFFGHRHNWEYAIVWIDNPALDDPAILGVSMSAATSYSKRA  60

Query  166  PPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDE  225
            PP A ++DG+S+K+EYY N +  ST+L+LT+  GEFQDLVTWDQL   AR +L +TDWD 
Sbjct  61   PPMAKYLDGDSLKVEYYSNAVVASTALRLTKTKGEFQDLVTWDQLPDAARNALIDTDWDT  120

Query  226  TLFNLAGLKMPLKDGEFDELLNKAWPF  252
            TLFN AG K PLKDG F+E L KA+P 
Sbjct  121  TLFNTAGAKFPLKDGVFNETLAKAYPL  147

>PHYRA_83592
Length=237

 Score = 198 bits (504),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 138/230 (60%), Gaps = 14/230 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+PVT S+KA VK+KP+L I++GC  YPAV   G  SGGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C    LGSQ+Y R++W NDVWAIMYAWYFPKG          +    RH+W   +VWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDKCPYWRHDWSNVVVWIDN  133

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P++E S +LG+S+S S +        A  +   +  + Y Y   FGS  L    D G+FQ
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            DL+ WDQLT  AR +LN+ D      N    ++P+ D  F E L KAWPF
Sbjct  194  DLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPEHLEKAWPF  237

>PITG_08522
Length=382

 Score = 202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 136/236 (58%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH+ V+ F +PEPVT S+KA VK+KPQ++I  GC PYP V + G  SGGL+ SG   
Sbjct  124  KTIGHDDVKLFPQPEPVTISEKAGVKFKPQIQIRTGCVPYPVVNELGETSGGLQTSGNSR  183

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W+  VWAIMY+WYFPK              GHRH+WE+AIV+I
Sbjct  184  GGCRGSGHGSQVYGRSTWMEGVWAIMYSWYFPKD-------FPSSRMGHRHDWEHAIVFI  236

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNPE+    IL  S+S+   Y    P  +  +DG S+K+ Y +    NH      L  T 
Sbjct  237  DNPEVAEPKILACSVSSHDGYKKYNPCPSYVIDGTSLKVRYKHAWPLNH-----DLDTTG  291

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G FQDL+ WDQ++  AR +LN+        +      P  DG F   L KAWPF
Sbjct  292  DAGTFQDLIMWDQMSNDARRALNSV-------HFGKANTPFNDGNFRPKLEKAWPF  340

>PHYRA_52960
Length=223

 Score = 197 bits (500),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 137/228 (60%), Gaps = 14/228 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH+ V PF +P P T  QK AVK KPQ+ I +GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS+LGSQIY R      V+A MY+WY PK +        L   G+RH+WE  +VWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ-------TLPGLGYRHDWEACVVWISN  121

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
              LE   I+ +S+S   +Y +  P + ++++G+S K+EY  + +    SL  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            DL+ WDQLT  AR +L +TD+        G ++P KD  F E L KA+
Sbjct  182  DLIMWDQLTAAARTALEDTDF-------GGARVPFKDANFKEKLAKAY  222

>PHYRA_52955
Length=223

 Score = 197 bits (500),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 137/228 (60%), Gaps = 14/228 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            IGH+ V PF +P P T  QK AVK KPQ+ I +GCHPYPAV +DG+ SGGLK +G Q   
Sbjct  9    IGHDAVAPFKQPTPTTTLQKLAVKLKPQIYIANGCHPYPAVDEDGNTSGGLKPTGDQSSG  68

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS+LGSQIY R      V+A MY+WY PK +        L   G+RH+WE  +VWI N
Sbjct  69   CIGSRLGSQIYGRVAKYRGVYAFMYSWYMPKDQ-------TLPGLGYRHDWEACVVWISN  121

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
              LE   I+ +S+S   +Y +  P + ++++G+S K+EY  + +    SL  T   GE Q
Sbjct  122  ITLEEPNIVALSVSYHSTYQTYYPLDKDYLEGDSAKIEYSTSWVVLDHSLSATSTPGETQ  181

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            DL+ WDQLT  AR +L +TD+        G ++P KD  F E L KA+
Sbjct  182  DLIMWDQLTAAARTALEDTDF-------GGARVPFKDANFKEKLAKAY  222

>PYU1_G011236
Length=237

 Score = 197 bits (501),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 132/232 (57%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V PF+EP P T +QK  +K+KPQL I +GCHPYPAV   G+ SGGLK +G  D  
Sbjct  23   IAHDAVVPFVEPTPTTTAQKLGIKFKPQLHISNGCHPYPAVDAAGNTSGGLKPTGSSDAG  82

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  G+Q+Y R+   N V+A+MY+WYFPK   +        L GHRH+WE+ +VWIDN
Sbjct  83   CKGSGYGTQVYGRAAAYNGVYALMYSWYFPKDSPST-------LLGHRHDWEHVVVWIDN  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEY----YYNHLFGSTSLQLTEDT  198
            P+  +  IL VS SA   Y    PP    + G S K++Y      NH F      +T   
Sbjct  136  PDAASPKILAVSASAHSGYNKYHPPATTTLAGNSAKIDYKSIVVLNHAF-----DMTTAA  190

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            GE Q L+ WDQ+T  AR +L  TD+ +         +P+KDG F   L  A+
Sbjct  191  GETQPLIMWDQMTVAARTALETTDFGDA-------NVPMKDGNFMTKLANAY  235

>PHYSO_249751
Length=238

 Score = 197 bits (501),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 138/230 (60%), Gaps = 14/230 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VIGH+QV PF +    + +  AA+K+K Q+ I +GCHPYPAV   G  SGGLK SG  + 
Sbjct  21   VIGHDQVVPFPQSAATSAANIAALKFKLQIFINNGCHPYPAVNAAGDTSGGLKPSGSVNA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQ+Y RS   N+  AIMY+WYFPK          +   GHRH+WE+ IVWID
Sbjct  81   GCKGSGYGSQVYGRSTLYNNKHAIMYSWYFPKDN-------PVTGLGHRHDWEHVIVWID  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP   N+TIL ++ SA   Y++  PP A  VDG SVK+EY  + +  +  L+ T   GE 
Sbjct  134  NPASSNATILAMTPSAHSGYSTYAPPPATMVDGTSVKVEYTSSKVVINHHLEGTSTAGET  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
            Q+L+ W+ +T  ARY+LN TD+           +P+KDG F   L KA+P
Sbjct  194  QNLIMWEDMTDAARYALNTTDFGSA-------NVPMKDGNFISKLGKAYP  236

>PHYRA_46230
Length=212

 Score = 196 bits (498),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 134/231 (58%), Gaps = 23/231 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H +V+PF +P P T S+KA VK+KPQ++I  GC PYPAV   G  SGGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+NDVWAIMY+WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWAIMYSWYFPKDSPS-------SGMGHRHDWEHVVVFIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    I+G S S+   Y    P     +DG SVK+ Y +    NH      L +T D 
Sbjct  114  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPINH-----DLDVTGDA  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            G FQDL+ WDQ+T+ AR +LN   + +          P+ DG F   L KA
Sbjct  169  GTFQDLIMWDQMTEDARRALNGVHFGDA-------NTPMNDGNFIPKLEKA  212

>PYU1_G011230
Length=238

 Score = 196 bits (499),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 136/228 (60%), Gaps = 15/228 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV PF EP P +  +K AVK+KPQ+ I +GCHPYPAV   G+ SGGLK SG Q   
Sbjct  24   ISHDQVVPFAEPTPSSAYEKLAVKFKPQIHISNGCHPYPAVDAAGNTSGGLKPSGSQSAG  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  G+Q+Y R    N V+ +MY+WYFPK          +   GHRH+WE+ +VWIDN
Sbjct  84   CKGSGWGTQVYGRGAAYNGVYGLMYSWYFPKDS-------PITGLGHRHDWEHVVVWIDN  136

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P+  N  IL +S SA   Y    PP+A  VDG S K++ Y + +  + +L  T   GE Q
Sbjct  137  PKAANPKILAISPSAHSGYQKYAPPKAGTVDGTSAKVD-YTSKIVINHALDSTTAAGEKQ  195

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             L+ W+Q+T+ AR +L NT + +         +P+KDG F + L KA+
Sbjct  196  PLIMWEQMTQAARTALENTGFGDA-------NVPMKDGNFMDKLAKAY  236

>PPTG_07277
Length=298

 Score = 198 bits (504),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 139/236 (59%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + IGH++++PF +P+PVT S+KA VK+KPQ++I  GC PYP V + G  SGGL+ SG   
Sbjct  82   KTIGHDEIKPFPQPDPVTISEKAGVKFKPQIQIRTGCVPYPVVNEFGETSGGLQTSGSPR  141

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W+N  WAIMY+WYFPK   +          GHRH+WE+A+V+I
Sbjct  142  GGCRGSVHGSQVYGRSAWINGFWAIMYSWYFPKDSPS-------SRMGHRHDWEFAVVFI  194

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTE  196
            DNP +    I+G S+S+        P  +  +DG S+K+ Y +    NH      L +T 
Sbjct  195  DNPGIPEPKIIGCSVSSHDGRKKYNPCPSWVIDGNSLKVRYKHAWPMNH-----DLDVTG  249

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D G FQDL+ WDQ+T  AR +LN+  + +          P  DG+F   L  AW F
Sbjct  250  DAGTFQDLIMWDQMTDDARRALNSVSFGKA-------NTPFNDGKFLPTLESAWAF  298

>PHYRA_54327
Length=219

 Score = 196 bits (497),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 136/230 (59%), Gaps = 15/230 (7%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I H  V+PF +PEP+T S+KA VK+KPQ++I  GC PYPAV + G  SGGL+ SG   
Sbjct  5    KTISHKDVKPFPQPEPITISEKAGVKFKPQIQIRTGCVPYPAVNELGETSGGLQTSGSPR  64

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C GS  GSQ+Y RS W N VWAIMY+WYFPK   A          GHRH+WE+ +V+I
Sbjct  65   GGCRGSGHGSQVYGRSTWYNQVWAIMYSWYFPKDSPA-------SGMGHRHDWEHVVVFI  117

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP+L    ILG S+S+   Y    P     +DG SVK+ Y ++    +  L  T D G 
Sbjct  118  DNPDLPEPKILGCSVSSHDGYKKYNPCPPWVIDGTSVKVRYKHSWPL-NHDLDTTGDGGT  176

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            FQDL+ W+Q+T  AR +LN     ET F  A    P+ D  F   + K+W
Sbjct  177  FQDLIMWNQMTDNARRALN-----ETKFGKA--NTPMNDWNFHSKVEKSW  219

>PHYCA_69479
Length=213

 Score = 194 bits (494),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 136/232 (59%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ ++PF +P PVT S+KA VK+KPQ++I  GC PYPAV + G  SGGLK +G   G 
Sbjct  1    ISHHDIKPFPQPVPVTISEKAGVKFKPQIQIRTGCVPYPAVNEFGETSGGLKPTGNPRGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P+P +    GHRH+WE+AIV+IDN
Sbjct  61   CRGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDS---PSPGL----GHRHDWEHAIVFIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    IL  S+S+   Y    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHAWPMNH-----DLDTTGDG  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            G FQDL+ W+Q+T+ AR +LN+        N      P  DG F   L  AW
Sbjct  169  GSFQDLIMWNQMTEDARRALNSV-------NFGSANTPFNDGRFMPKLENAW  213

>PHYRA_43347
Length=220

 Score = 194 bits (493),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 136/205 (66%), Gaps = 15/205 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+PVT S+KAAV++KP L+I+ GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPDPVTVSEKAAVRFKPSLRIDSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  83   CTGSKLGSQI---YARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVW  139
            C GS LGSQ+   YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW
Sbjct  84   CKGSGLGSQVVLRYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWANVVVW  136

Query  140  IDNPELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYY---NHLFGSTSLQLT  195
            +DNP LE  T++GVS S+ + +Y+  TPP A+ ++G +  + Y     NH F S      
Sbjct  137  LDNPALERPTMIGVSPSSYVTTYSKYTPPPADGLNGTTSMINYLADANNHGFHSVDTTW-  195

Query  196  EDTGEFQDLVTWDQLTKLARYSLNN  220
            +  GEFQDL+ W+QLT  AR +LN+
Sbjct  196  KTGGEFQDLIMWEQLTDEARAALND  220

>PYIR_13275
Length=237

 Score = 194 bits (494),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 132/233 (57%), Gaps = 23/233 (10%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF++P  VT  QK  VK+KPQ+ I +GCHPYPAV   G+ SGGL  +G  D 
Sbjct  22   VIAHDAVVPFVQPTAVTTEQKLGVKFKPQIHISNGCHPYPAVDAAGNTSGGLNPTGSSDA  81

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  G+Q+Y R    N V+A+MY+WYFPK              GHRH+WE+ +VWID
Sbjct  82   GCKGSGYGTQVYGRGVAYNGVYALMYSWYFPKDSP-------FTGLGHRHDWEHVVVWID  134

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEY----YYNHLFGSTSLQLTED  197
            NP+  +  IL +S SA   Y    PP+ + VDG S K++Y      NH   ST+      
Sbjct  135  NPDAASPVILAISPSAHSGYEKYAPPKTDTVDGNSAKVDYKSIVVINHALDSTTT-----  189

Query  198  TGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             GE Q L+ WDQLT  AR +L NTD+ +         +P+KDG F   +  A+
Sbjct  190  AGEQQPLIMWDQLTAAARTALENTDFGDA-------NVPMKDGNFMTKIANAY  235

>PYIW_25259
Length=246

 Score = 195 bits (495),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/241 (44%), Positives = 130/241 (54%), Gaps = 32/241 (13%)

Query  23   IGHNQVRPFLEPEPVTFSQK---------AAVKYKPQLKIEDGCHPYPAVQKDGSISGGL  73
            I H+ V PF +P PVT  Q          AA+K+KPQ+ I +GCHPYPAV   G+  GGL
Sbjct  23   IAHDAVVPFAQPAPVTLEQTPAPTSLSHTAALKFKPQIHISNGCHPYPAVDAAGNTGGGL  82

Query  74   KWSGPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNW  133
            K SG Q   C GS  G+Q+Y RS W N  WAIMY+WYFPK              GHRH+W
Sbjct  83   KPSGSQSAGCKGSGWGTQVYGRSTWFNGKWAIMYSWYFPKDS-------PFTGLGHRHDW  135

Query  134  EYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEY----YYNHLFGS  189
            E+ +VWIDNP   N  IL V+ SA   Y    PP++  VDG S K+EY      NH   S
Sbjct  136  EHVVVWIDNPANANPAILAVTPSAHSGYKKYAPPKSGTVDGNSAKVEYKAIIVINHALDS  195

Query  190  TSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            T+       GE Q L+ WDQLT  AR  L NTD+           +P+KDG F   +  A
Sbjct  196  TTTG-----GEQQPLIMWDQLTDAARSGLENTDFGSA-------NVPMKDGNFMTKVANA  243

Query  250  W  250
            +
Sbjct  244  Y  244

>PHYRA_72390
Length=237

 Score = 194 bits (492),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 136/230 (59%), Gaps = 14/230 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+PVT S+KA VK+KP+L I++GC  YPAV   G  SGGLK +G  D  
Sbjct  22   IDHDKVQPFPQPQPVTISEKAGVKFKPKLFIQEGCVSYPAVNAAGEPSGGLKGTG-DDSG  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C    LGSQ+Y R++W NDVWAIMYAWYFPKG          +    RH+W   +VWIDN
Sbjct  81   CKLPSLGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDKCPYWRHDWSNVVVWIDN  133

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P++E S +LG+S+S S +        A  +   +  + Y Y   FGS  L    D G+FQ
Sbjct  134  PDVETSKVLGLSLSTSENKYGHKYAPAESIRNGTTPMLYRYLPSFGSAGLNTYVDLGQFQ  193

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             L+ WDQL   AR +LN+ D      N    ++P+ D  F E L KAWPF
Sbjct  194  GLIMWDQLADAARAALNDQD------NFGRTEVPISDDHFPEHLEKAWPF  237

>PITG_22734
Length=168

 Score = 191 bits (484),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 110/153 (72%), Gaps = 8/153 (5%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H++V+PF +P P+T SQK+AVKYKPQL I  GCHPYPAV+ +GS SGGL+WSGP DG+
Sbjct  24   VNHDEVQPFTQPLPITDSQKSAVKYKPQLHISYGCHPYPAVEPNGSASGGLEWSGPADGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS LGSQ+Y+RS W  + WAIMYAWYFPKGR          L GHRH WEY +VW D+
Sbjct  84   CTGSPLGSQVYSRSDWYKNKWAIMYAWYFPKGR--------YGLTGHRHYWEYVVVWADS  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGE  175
                NS+I GVS+SA + +A  TPP   ++ G 
Sbjct  136  STSTNSSIQGVSMSAGVGHAKATPPMLKYIHGS  168

>PHYRA_72477
Length=238

 Score = 192 bits (489),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 136/233 (58%), Gaps = 17/233 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             + H++V+PF +P PVT S+KA VK+KP L I  GC  YPAV   G  SGGLK SG    
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTS  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWI  140
             C    LGSQ+Y R+ W NDVWAIMYAWYFPKG   A P          RH+W  A+VWI
Sbjct  81   GCALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF--------WRHDWSNAVVWI  132

Query  141  DNPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            DNP LEN   LG+SIS S + Y S    E    +G++  L  Y   +  +T L    D+G
Sbjct  133  DNPALENPKALGLSISRSENKYGSTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSG  191

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            EFQDL+ WDQLT  AR +LN+ D      N    ++P+ D  F + L +AWPF
Sbjct  192  EFQDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKRLEEAWPF  238

>PITG_16866
Length=238

 Score = 192 bits (487),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 138/230 (60%), Gaps = 15/230 (7%)

Query  22   VIGHNQVRPFLEPEPVTFS-QKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            VI H+ V PF +P   T + QKA +K+KPQ+ I +GCHPYPAV  DG+ SGGL  +G   
Sbjct  21   VISHDAVIPFAQPTTTTTTEQKAGIKFKPQIHISNGCHPYPAVDADGNTSGGLNPTGSSS  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQIY R    N V+AIMY+WYFPK          L   GHRH+WE+ +VW+
Sbjct  81   AGCKGSGYGSQIYGRVATYNGVFAIMYSWYFPKDSP-------LTGLGHRHDWEHVVVWV  133

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D+ +L + +++ VS SA   Y    PPE+N +DG S K++Y  + L  + +L  T D GE
Sbjct  134  DDIKLNSPSVIAVSPSAHSGYNIYHPPESNTIDGYSTKVDYSSSWLVINHALDSTTDAGE  193

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             Q+L+ WDQLT  AR +L NTD+ +         +P+KDG F   +  A+
Sbjct  194  TQNLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKVGNAY  236

>PHYRA_45457
Length=199

 Score = 190 bits (483),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 121/201 (60%), Gaps = 16/201 (8%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF EP PVT S+KA VK+KPQL I +GCH YPAV + G   GGLK SG    
Sbjct  11   VISHDQVIPFAEPAPVTISEKAGVKFKPQLHISNGCHSYPAVNEAGDTGGGLKTSGAPSS  70

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS  GSQIY RS W +DVWAIMYAWYFPK   +          GHRH+WE+A++WID
Sbjct  71   KCKGSGYGSQIYGRSGWHSDVWAIMYAWYFPKDMAST-------TLGHRHDWEHAVIWID  123

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTED  197
            NP++    ILGVS+S+   YA  T      + G +V + Y      +H      L LT  
Sbjct  124  NPDVAEPKILGVSVSSHSGYAKTTTIPVGSLVGTTVLINYESFWPLDH-----ELSLTTK  178

Query  198  TGEFQDLVTWDQLTKLARYSL  218
             G+ Q L+ W QLT  AR SL
Sbjct  179  GGDLQPLIMWSQLTDAARNSL  199

>PHYRA_86968
Length=239

 Score = 191 bits (486),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 137/233 (59%), Gaps = 18/233 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H++V+PF +P PVT S+KA VK+KPQL I+ GC PYPAV   G  SGGLK +G  + +
Sbjct  22   VDHDKVQPFPQPAPVTISEKAGVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWID  141
            C  S LGSQ+Y R+ W N VWAIMYAWYFPKG    VP          RH+W  A+VWID
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY--------WRHDWSNAVVWID  132

Query  142  NPELENSTILGVSISASISYASET--PPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            NP LEN  ILG+S+S S +    T  P  A  ++  +    Y Y     +  L+L+   G
Sbjct  133  NPALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRG  192

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
              QDL+ W QLT  AR +LN+ D      N     +P+ D  F +LL +AWPF
Sbjct  193  PVQDLIMWGQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAWPF  239

>PHYSO_330015
Length=241

 Score = 191 bits (485),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 132/233 (57%), Gaps = 19/233 (8%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H++V+PF +P PVT S+KAAVKYKP L I D CHPYPAV   G  SGGLK +G +DG
Sbjct  23   TIDHDKVQPFPQPGPVTVSEKAAVKYKPNLLILDACHPYPAVNAAGETSGGLKGTGKRDG  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG---RGAVPAPLILRLFGHRHNWEYAIV  138
             C GS LGSQ+Y R+ W +D+WAIMYAWYFPK    RG           G RHNW  A+V
Sbjct  83   ACKGSGLGSQVYGRAGWHDDMWAIMYAWYFPKDVYYRGTFSDK------GFRHNWVNAVV  136

Query  139  WIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198
            W+DNP LE        +     Y   +PP   + +G S  L Y  N    S   Q T   
Sbjct  137  WLDNPALETPRYSPCRLRG---YQECSPPFTGYFNGTSAMLVYEANGEEPSALSQNTLGG  193

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
            GE QDL+ W+QLT  AR +L+ TD+ ET       K+P  D  F+  L  A P
Sbjct  194  GELQDLIMWEQLTVEARDALSTTDFGET-------KVPFIDANFNANLKAARP  239

>HYAP_06628
Length=245

 Score = 190 bits (483),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 136/231 (59%), Gaps = 15/231 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+ F +PEPVT S+KAAV+  P L +  GC PYPAV + G  SGGLK +G  +G 
Sbjct  29   IPHHEVKAFAQPEPVTISEKAAVRLNPTLLVTYGCQPYPAVNEFGQTSGGLKPTGDHNGH  88

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+YARS W  D WAIM+A+YFPK +         R    RH+WE+A+VWI N
Sbjct  89   CKGSGHGSQVYARSAWFGDKWAIMFAYYFPKSQPR-------RSVSVRHSWEFAVVWIAN  141

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTE-DTGEF  201
            PE    T+   + S +  Y   T  +A+ +DGE VKL  Y+ H      L+LT  D G  
Sbjct  142  PEAPEKTLALTTRSFAYGYFKYTSFDASEMDGERVKLR-YWQHADSDLYLELTSLDGGVT  200

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + L+ W+QL + AR +LN   W+       G K PL D  F+ LLN +WPF
Sbjct  201  RPLIMWEQLPEKARCALNEATWN------GGFKCPLSDEAFEPLLNASWPF  245

>PHYCA_6835
Length=210

 Score = 189 bits (479),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 126/216 (58%), Gaps = 23/216 (11%)

Query  41   QKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLGSQIYARSKWVN  100
            +++AVK+KPQL I +GCH YPAV + G   GGLK  G     C GS  GSQ+Y RS W  
Sbjct  13   RRSAVKFKPQLHITNGCHSYPAVDEAGETGGGLKTKGAPSAGCKGSGWGSQVYGRSGWYQ  72

Query  101  DVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASIS  160
            DVWAIMY WYFPK     P+  I    GHRH+WE+ IVWIDNP +EN  IL V+ SA   
Sbjct  73   DVWAIMYCWYFPKDE---PSSGI----GHRHDWEHVIVWIDNPAVENPKILAVTPSAHSG  125

Query  161  YASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARY  216
            Y    PP A+ +DG + K+ Y      +H   STS     + G+FQDL+ WDQL++ AR 
Sbjct  126  YHKYAPPNADTIDGVTTKVAYDSKWPMDHALDSTS-----EAGDFQDLIMWDQLSENARR  180

Query  217  SLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            +LN+        N      P+ DG F   L KAWPF
Sbjct  181  ALNSV-------NFGKANTPMNDGNFQPKLAKAWPF  209

>PHYSO_526541
Length=239

 Score = 189 bits (481),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 133/233 (57%), Gaps = 17/233 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H++V+PF +P P T S+KAAVK+KP L+I DGCHPYPAV   G  SGGLK +GP DG
Sbjct  21   TIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L   G RH W  A+VW+D
Sbjct  81   KCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH-------LGYKGQRHKWVDAVVWLD  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEY---YYNHLFGSTSLQLTEDT  198
            NP  E   +L  ++     + S     A  ++  +  + Y   Y    F +  +  T  T
Sbjct  134  NPAFETPKVLA-NVPQRCEHGSCGKAFAEFMNNTTPMISYRPFYMETSFHTLEMTSTRGT  192

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
            GE QDL+ W+QL+  AR +L+ TD+ E        K+P  D  F+  L  A P
Sbjct  193  GELQDLIMWEQLSPEARTALSETDFGE------AAKVPFIDANFETNLELARP  239

>PHYCA_12462
Length=177

 Score = 187 bits (475),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 118/163 (72%), Gaps = 11/163 (7%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H++V+PF +PEP T S+K+AVKYKPQL+I        AVQ DGS+S GLKW+G  D
Sbjct  22   EMINHDKVQPFTQPEPTTNSEKSAVKYKPQLRIS------TAVQADGSVSAGLKWTGWSD  75

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS+LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  76   GDCKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHYWSYAIVWM  131

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYY  182
            D+   +NSTILGVS+SA + Y+ ET P++ + VDG +VK E Y
Sbjct  132  DSDVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYRA_44405
Length=232

 Score = 189 bits (480),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 139/231 (60%), Gaps = 18/231 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+KAAV++KP+L+I  GCHPYPAV   G  S GLK +G  DG+
Sbjct  16   IDHDKVQPFAQPEPVTISEKAAVQFKPRLQIFGGCHPYPAVNAAGETSAGLKGTGTHDGD  75

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C  S+LGSQ+Y RS W  D+W IMYAWYFPK +     P   +  GHRH W   +VW+DN
Sbjct  76   CMRSRLGSQVYGRSVWYGDLWGIMYAWYFPKDK-----PKYRK--GHRHEWANVVVWLDN  128

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEY---YYNHLFGSTSLQLTEDT  198
            P  E  T++G+S S  + +YA       N  DG++  + Y     N  F S  + + E  
Sbjct  129  PAHERPTMIGMSTSWFVTTYAKYKFVPTNGFDGKTYTINYKDDVLNDGFHSVDV-IWEIG  187

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            GEFQDL+ W+QLT  AR +L++TD+ E         +P  D  F   L KA
Sbjct  188  GEFQDLIMWEQLTDEARAALSDTDFGED------APVPFIDANFKANLEKA  232

>PHYCA_132529
Length=232

 Score = 189 bits (480),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 141/236 (60%), Gaps = 27/236 (11%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            ++ + +++PF +PEP+T S K AV++KPQL+I+DGCHPYPAV + G IS G   SG  D 
Sbjct  11   IVDYQEIKPFAQPEPITVSDKVAVRFKPQLRIKDGCHPYPAVNEAGDISSGAD-SGWGDS  69

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C+GS +GSQ+Y RS W   VW +MYAWYFPK                 H WE  +VWID
Sbjct  70   SCSGSDVGSQVYGRSAWCGGVWGMMYAWYFPKDETT-------------HRWENVVVWID  116

Query  142  NPELENSTILGVSISASISYASETPPEANH--VDGESVKLEYYYNHLFGSTSLQLTEDT-  198
            +P +EN TILGVS S+   Y    P + N    DG++V+++Y  + +  +T +    DT 
Sbjct  117  DPAVENPTILGVSTSSDGGYIRYAPLDDNDWARDGDNVQIQYRLDDVMATTRVFHHLDTS  176

Query  199  ---GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
               G+ Q LVTW+QLT+ AR +L N D+ E+       K+PLK+  F   L+ A P
Sbjct  177  WRGGDIQGLVTWEQLTEEARNTLENGDFGES-------KVPLKNSTFTANLDFAIP  225

>PHYRA_72385
Length=237

 Score = 189 bits (479),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 141/230 (61%), Gaps = 14/230 (6%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
             VI H+QV PF +P P T  Q A +K+KPQ+ I +GCHPYPAV + G+ SGGLK +G   
Sbjct  20   DVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGSSS  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQIY R      V+A+MY+WYFPK      +P  +   GHRH+WE+ +VW+
Sbjct  80   AGCKGSGYGSQIYGRITTYEGVYALMYSWYFPK-----DSP--VTGLGHRHDWEHVVVWV  132

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D+  L++ +I+ VS SA   Y    PPE+N +DG S K++Y  + +  + +L  T D+GE
Sbjct  133  DDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVVNHALDSTSDSGE  192

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             QDL+ WDQLT  AR +L NTD+ +         +P+KDG F   L  A+
Sbjct  193  SQDLIMWDQLTDAARTALENTDFGDA-------NVPMKDGNFLTKLGNAY  235

>PHYSO_336498
Length=238

 Score = 188 bits (477),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 137/232 (59%), Gaps = 17/232 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V PF +P+PVT S+KAAVK+KPQL IEDGC  +PAV   G  SGGLK     +  
Sbjct  22   IDHDKVEPFPQPDPVTISEKAAVKFKPQLLIEDGCVSFPAVNAAGETSGGLK-GNSGNSA  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG         + +   R +W  A+VWIDN
Sbjct  81   CDSAPLGSQVYGRAMWYKDVWAIMYAWYFPKG-------FFVGVASRRFDWSSAVVWIDN  133

Query  143  PELENSTILGVSISAS-ISYASETP-PEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            P+     ILG+S S S   Y ++TP P+   +DG +  L    +   G   L  +  TG+
Sbjct  134  PDFAAPKILGISTSTSDDDYETKTPAPDYAILDGTTTLLFRSTSREAGQPKLYYSSRTGD  193

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             Q L+ W+QL + AR +LN TD     F LA   +P+ D  F++ L KAWPF
Sbjct  194  SQPLIMWEQLPEAARLALNTTD-----FGLA--YVPINDDTFEKKLKKAWPF  238

>PHYSO_490000
Length=241

 Score = 188 bits (477),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 148/254 (58%), Gaps = 16/254 (6%)

Query  1    MSFRavliaataslaagvlgQVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPY  60
            MSFRA+ +     L   +   +I H+QV PF + +P T + KAA+K KP+L I +GCH +
Sbjct  1    MSFRALSVTIIIVLLKPIEAGIIDHDQVVPFPQSQPTTITNKAALKLKPRLFINNGCHLH  60

Query  61   PAVQKDGSISGGLKWSGPQDGECTGSKLGSQIY--ARSKWVNDVWAIMYAWYFPKGRGAV  118
            PAV  +G  SGGLK  G  +G C GS  GSQ+Y   RS W N VWAIMYAWYFPK     
Sbjct  61   PAVNANGDTSGGLKPKGSPEGGCRGSGSGSQVYRYGRSTWYNGVWAIMYAWYFPKDEPT-  119

Query  119  PAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASETPPEANHVDGESVK  178
                     GHRH+WE+ IV I+NP LEN TIL ++ SA   Y++  PP A+ V G S K
Sbjct  120  ------DFDGHRHDWEHVIVRINNPVLENPTILAMTPSAHSGYSTYAPPPADMVSGTSCK  173

Query  179  LEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLK  238
            +EY  + +F    L+ T   GE QDL+ W  LT  ARY+L+ T       N      P+ 
Sbjct  174  VEYTSSWIFIDHHLEGTSTAGETQDLIMWSDLTDAARYALSTT-------NFGKADTPMN  226

Query  239  DGEFDELLNKAWPF  252
            +G F+  L+KAWP+
Sbjct  227  NGTFNWKLSKAWPW  240

>PHYSO_496064
Length=254

 Score = 188 bits (478),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 134/244 (55%), Gaps = 26/244 (11%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEP T S+KAAVK+KP ++I  GCHPYPAV   G  SGGLK SG  DG+
Sbjct  22   IDHDKVQPFAQPEPTTVSEKAAVKFKPSIRIRSGCHPYPAVNAAGETSGGLKPSGEPDGD  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C  S LGSQ+Y R+ W  D+WAIMY WYFPK              G RH W   IVW+DN
Sbjct  82   CKNSSLGSQVYGRAVWYKDLWAIMYTWYFPKDSYGT-----FFRSGQRHKWASFIVWLDN  136

Query  143  PELENSTILGVSIS-------------ASISYASETPPEANHVDGESVKLEYYYNHLFGS  189
            P LE   IL VS S              +    S +PP  ++++G S  L  Y +  +GS
Sbjct  137  PSLEKPKILAVSTSFQTGEYQILKNGPPACGRRSCSPPFTDYINGTSAMLA-YLDTFYGS  195

Query  190  TSLQLTEDT-GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNK  248
                 T  T GE QDL+ W+QLT+ A+ +LN TD+ E        ++P  D   +  L +
Sbjct  196  ILEMTTARTGGELQDLIMWEQLTEEAQIALNETDFGEK------ARVPFIDANLNANLEQ  249

Query  249  AWPF  252
               F
Sbjct  250  TRSF  253

>PHYCA_123205
Length=177

 Score = 185 bits (470),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 117/163 (72%), Gaps = 11/163 (7%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            ++I H++V+PF +PEP T S+ +AVKYKPQL+I        AVQ DGS+S GLKW+G  D
Sbjct  22   EMINHDKVQPFTQPEPTTNSENSAVKYKPQLRIS------TAVQADGSVSAGLKWAGWSD  75

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G+C GS+LGSQ+Y+RS W  D WAIMYAWYFPKGR  +        FGHRH W YAIVW+
Sbjct  76   GDCKGSELGSQVYSRSDWYKDKWAIMYAWYFPKGRQYISK----YRFGHRHYWSYAIVWM  131

Query  141  DNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYY  182
            D+   +NSTILGVS+SA + Y+ ET P++ + VDG +VK E Y
Sbjct  132  DSDVPDNSTILGVSMSAGVGYSKETLPKSKYVVDGTTVKFESY  174

>PHYKE_7568
Length=372

 Score = 191 bits (485),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 133/229 (58%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P T  Q+ A+K+KPQ+ I +GCHPYPAV +DG+ SGGL  +G +  
Sbjct  156  VISHDQVVPFSQPTPTTTIQEVAIKFKPQIYINNGCHPYPAVDEDGNTSGGLAPTGSESA  215

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  216  GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWEACVVWLD  268

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L+   I+ +S SA   Y    PP ++++DG+S K+EY  +++    SL  T   GE 
Sbjct  269  DITLDEPNIVALSASAHSGYNVYYPPSSSYLDGDSAKIEYSSSYIVIDHSLSATSTAGET  328

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+           +P K+  F   L  A+
Sbjct  329  QDLIMWDQLTDAARAALEDTDF-------GSANVPFKEANFQTKLGNAY  370

 Score = 110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 85/144 (59%), Gaps = 15/144 (10%)

Query  106  MYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASET  165
            MY+WYFPK          L  FGHRH+WE+ +VW++NP + +  IL VS SA   Y    
Sbjct  1    MYSWYFPKDSP-------LTGFGHRHDWEHIVVWLNNPAITSPEILAVSTSAHSGYTVYY  53

Query  166  PPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDE  225
            PP+++++DG S K++ YY+ L  + + ++T D GE QDL+ WDQLT  A+ +L +TD+ +
Sbjct  54   PPDSDYLDGNSAKID-YYSVLLINHAFRMTSDAGETQDLIMWDQLTDAAQTALEDTDFGD  112

Query  226  TLFNLAGLKMPLKDGEFDELLNKA  249
                     +P KD  F+  L  A
Sbjct  113  A-------NVPFKDANFETKLANA  129

>PHYRA_39489
Length=237

 Score = 186 bits (473),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 135/231 (58%), Gaps = 18/231 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H++V+PF +P PVT S+KA VK+KPQL I+ GC PYPAV   G  SGGLK +G  + +
Sbjct  22   VDHDKVQPFPQPAPVTISEKAXVKFKPQLTIKAGCFPYPAVNAAGETSGGLKGNG-DELD  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWID  141
            C  S LGSQ+Y R+ W N VWAIMYAWYFPKG    VP          RH+W  A+VWID
Sbjct  81   CILSLLGSQVYGRAGWYNGVWAIMYAWYFPKGFWDTVPY--------WRHDWSNAVVWID  132

Query  142  NPELENSTILGVSISASISYASET--PPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            NP LEN  ILG+S+S S +    T  P  A  ++  +    Y Y     +  L+L+   G
Sbjct  133  NPALENPKILGLSLSTSENKYGNTYVPVPARTIENGTTPTLYRYVPALRAAELRLSTSRG  192

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
              QDL+ W QLT  AR +LN+ D      N     +P+ D  F +LL +AW
Sbjct  193  PVQDLIMWGQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAW  237

>PPTG_15234
Length=235

 Score = 186 bits (472),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 137/229 (60%), Gaps = 16/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P T  Q  AV++KPQ+ I +GCHPYPAV +DG+ SGGLK +G +  
Sbjct  21   VIDHDQVVPFAQPTPNTTVQSVAVQFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSESA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY R+   + V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  81   GCKGSGYGSQIYGRAVEYDGVYAFMYSWYMPKDE-------TLDGLGHRHDWENCVVWLD  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L+N +I+ +S S   +Y    PP+++++DG+S K+EY  + +    SL  T   GE 
Sbjct  134  S--LDNPSIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVILDHSLSATSTVGET  191

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+ +         +P K+  F   +  A+
Sbjct  192  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKETNFATKVANAY  233

>PHYRA_71307
Length=237

 Score = 186 bits (472),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 132/229 (58%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P T  Q  AV +KPQ+ I +GCHPYPAV +DG+ SGGLK +G Q  
Sbjct  21   VIDHDQVVPFAQPTPNTTVQSVAVNFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  81   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWENCVVWLD  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L+   I+ +S S   +Y    PP+++++DG S K+EY  + +    SL  T  +GE 
Sbjct  134  DITLDEPNIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTSGET  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ W QLT  AR +L +TD+           +P K+G F   +  A+
Sbjct  194  QDLIMWGQLTDAARTALEDTDF-------GSANVPFKEGNFATKVANAY  235

>PHYSO_254099
Length=235

 Score = 186 bits (472),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 129/233 (55%), Gaps = 28/233 (12%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV PF + E    S+KAA+K+KPQL+I  GCHPYPAVQ DG++S GLKW G  DG+
Sbjct  24   INHDQVHPFAQVEAANASEKAAIKFKPQLQISYGCHPYPAVQADGAVSDGLKWGGKPDGK  83

Query  83   CTGSKLGSQIYA-----RSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAI  137
              GS LGSQ+Y+     R +    V AI                           W Y +
Sbjct  84   YQGSGLGSQVYSARPGTRYERREQVSAIATC-----------------------GWLYMV  120

Query  138  VWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTED  197
            +WIDNPE  N  ILGV +          PP+A  +DG S+KL+YY       T LQLT+D
Sbjct  121  IWIDNPEAINPAILGVCVRTEGGNEQRVPPDAKFLDGSSLKLDYYKRTWHRKTGLQLTKD  180

Query  198  TGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             GEFQDLVTW+Q+T+ AR +L   D+D+       L +P  DGEF   L KAW
Sbjct  181  KGEFQDLVTWEQMTEEARITLTEADFDDHWQERNDLDVPFIDGEFTVNLEKAW  233

>PHYRA_71310
Length=237

 Score = 186 bits (472),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 140/230 (61%), Gaps = 14/230 (6%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
             VI H+QV PF +P P T  Q A +K+KPQ+ I +GCHPYPAV + G+ SGGLK +G   
Sbjct  20   DVISHDQVVPFTQPTPTTTEQTAGIKFKPQIHISNGCHPYPAVDEAGNTSGGLKPTGSSS  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C GS  GSQIY R      V+A+MY+WYFPK      +P  +   GHRH+WE+ +VW+
Sbjct  80   AGCKGSGYGSQIYGRITTYEGVYALMYSWYFPK-----DSP--VTGLGHRHDWEHVVVWV  132

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            D+  L++ +I+ VS SA   Y    PPE+N +DG S K++Y  + +  + +L  T D+GE
Sbjct  133  DDITLDSPSIIAVSPSAHSGYNIYYPPESNTIDGYSAKVDYSSSWVVVNHALDSTSDSGE  192

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
             QDL+ W QLT  AR +L NTD+ +         +P+KDG F   L  A+
Sbjct  193  SQDLIMWGQLTDAARTALGNTDFGDA-------HVPMKDGNFLTKLGNAY  235

>PPTG_00460
Length=259

 Score = 186 bits (473),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 138/227 (61%), Gaps = 12/227 (5%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H++V+PF +PEP+T ++KAAVK+KP L ++ GCHPYPAV   G  S GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAVKFKPSLAVKAGCHPYPAVNAAGDTSAGLKGTGAPDGECE  81

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
            GS LGSQ+Y+RSKW  D WAIMYAWYFPK    +   LI +  G RH+W   +VW+DNP 
Sbjct  82   GSPLGSQVYSRSKWYEDKWAIMYAWYFPKDMQNI--GLIKK--GVRHDWVNLVVWLDNPA  137

Query  145  LENSTILGVSISA-SISYASETPPE-ANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            L   TIL  S S     Y    PP+ ++ ++G + K+ Y  ++  G  ++    + GE+Q
Sbjct  138  LAEPTILATSASTYGTGYEISKPPKRSDIINGTTPKVRYDEDNREGWHTIFQFHEEGEYQ  197

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            DL+ W+QLT   R +L NTD+ +         +P  D  F+  L  A
Sbjct  198  DLIQWNQLTNATRKALENTDFGDF------ANVPFNDAYFETNLKAA  238

>PHYCA_69457
Length=213

 Score = 185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 139/232 (60%), Gaps = 23/232 (10%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+PF +PEPVT S+KA VK+KPQ+++  GC PYPAV + G  SGGLK +G   G 
Sbjct  1    INHDQVKPFPQPEPVTISEKAGVKFKPQIQVRTGCEPYPAVNEFGETSGGLKPTGNPRGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+  VWAIMY+WYFPK     P+P +    GHRH+WE+AIV+IDN
Sbjct  61   CGGSGYGSQVYGRSTWIRGVWAIMYSWYFPKDS---PSPGL----GHRHDWEHAIVFIDN  113

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    IL  S+S+   Y    P     +DG S+K+ Y +    NH      L  T D 
Sbjct  114  PDVPEPKILACSVSSHSGYKKYNPCPPWVIDGTSLKVRYKHSWPTNH-----DLDTTGDG  168

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            G FQDL+ W+Q+T+ AR +LN+        N      P  DG+F   L  AW
Sbjct  169  GSFQDLIMWNQMTEDARRALNSV-------NFGSANTPFNDGKFMPKLENAW  213

>PHYRA_84273
Length=237

 Score = 184 bits (466),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 136/232 (59%), Gaps = 16/232 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             + H++V+PF +P PVT S+KA VK+KPQL I  GC  YPAV   G  SGGLK SG   G
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPQLHITTGCTSYPAVNAAGETSGGLKGSGGTSG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C    LGSQ+Y R+ W NDV+AIMYAWYFPKG     +P        RH+W  A+VWID
Sbjct  81   -CMLPPLGSQVYGRAGWHNDVYAIMYAWYFPKGFWDA-SPFW------RHDWSNAVVWID  132

Query  142  NPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            NP  +   ILG+S+S S + Y      E    +G++  L  Y   +  +T L    D+GE
Sbjct  133  NPAHKTPKILGLSLSTSENKYGKTYTEEDGFENGKTPNLSRYVPPMEAAT-LSTGYDSGE  191

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDL+ WDQLT  AR +LN+ D      N    ++P+ D  F + L +AWPF
Sbjct  192  FQDLIMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKRLEEAWPF  237

>HYAP_08306
Length=286

 Score = 185 bits (470),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 130/232 (56%), Gaps = 17/232 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            +GH+ ++PF +P+PVT     A+K KP+L I  GCHPYPAV   G  S GLK SG  DG 
Sbjct  58   VGHDTLQPFPQPKPVTRLDVVAIKLKPELFIVHGCHPYPAVNATGHTSNGLKTSGDADGH  117

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y R+ W    WAIMYAWYFPK      AP      G RH+WE+AIVWI+N
Sbjct  118  CKGSGHGSQVYGRATWFRGKWAIMYAWYFPKD-----AP--DEESGQRHDWEHAIVWINN  170

Query  143  PELENSTILGVSISAS--ISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            P+++   IL VS+S      Y  +  P     DG  +KL Y  +H      L LT + GE
Sbjct  171  PKVKQPKILAVSVSCGKFFGYLKKVAPGPAVFDGTRLKLSYGADHKH-EHRLDLTAEKGE  229

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             QDL+ W+QLT  AR + +   W   +       MPL D  +   L +AWPF
Sbjct  230  DQDLIMWEQLTDEARCAFDTILWTNDM-------MPLNDAWYKHELTRAWPF  274

>PHYSO_255972
Length=215

 Score = 182 bits (463),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 127/231 (55%), Gaps = 37/231 (16%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H++V+PF +P P T S+KAAVK+KP L+I DGCHPYPAV   G  SGGLK +GP DG
Sbjct  21   TIDHDKVQPFAQPAPATVSEKAAVKFKPSLQIIDGCHPYPAVNAAGETSGGLKHTGPVDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS LGSQ+Y RS W  D+WAIMY+WYFPK +        L   G RH W  A+VW+D
Sbjct  81   KCKGSGLGSQVYGRSGWYKDLWAIMYSWYFPKDKH-------LGYKGQRHKWVDAVVWLD  133

Query  142  NPELENSTILGVSI-SASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            NP  E   +L VS  S    Y S                       F +  +  T  TGE
Sbjct  134  NPAFETPKVLAVSTWSWGGGYTS-----------------------FHTLEMTSTRGTGE  170

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
             QDL+ W+QL+  AR +L+ TD+ E        K+P  D  F+  L  A P
Sbjct  171  LQDLIMWEQLSPEARTALSETDFGE------AAKVPFIDANFETNLELARP  215

>PHALS_06084
Length=260

 Score = 184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 136/236 (58%), Gaps = 23/236 (10%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            + I ++QVR F +P+P T SQ+ A+ +KPQL I  GC PYPAV + G  SGGL      +
Sbjct  43   KTIPYDQVRGFRQPKPTTISQQVALTFKPQLDIVTGCLPYPAVNRLGETSGGLPKDADTE  102

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
             +C GS+  SQ+Y RS W NDVW +M++WYFPK     P PL+    GHRH+WE  +++I
Sbjct  103  TKCHGSQFNSQVYGRSTWFNDVWVMMFSWYFPKDS---PFPLL----GHRHDWENVVIFI  155

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYY----YNHLFGSTSLQLTE  196
            D+P++    ILG S+S    Y    P      +G SVK++Y      NH     +L +TE
Sbjct  156  DSPKVPLPKILGCSMSYHSEYIKFAPCPTFATNGTSVKVKYEDSFPLNH-----ALNVTE  210

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
              G FQDL+ W+QL  + R SLN+TD            +P+ D  F + + +AWPF
Sbjct  211  KEGTFQDLIMWNQLPPIVRKSLNDTD-------FGSANVPMNDWNFLKKVEEAWPF  259

>PHYRA_75425
Length=237

 Score = 183 bits (465),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 137/229 (60%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF +P P T  Q  AVK+KPQ+ I +GCHPYPAV +DG+ SGGLK +G Q  
Sbjct  21   VIDHDAVVPFAQPTPTTTLQTLAVKFKPQIYINNGCHPYPAVDEDGNTSGGLKPTGSQSS  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             CTGS LGSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  81   GCTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLDGVGHRHDWENCVVWLD  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L+   I+ +S S   +Y    PP+++++DG+S K+EY  + +    SL  T  +GE 
Sbjct  134  DITLDEPNIVALSASYHSTYLYYYPPDSDYLDGDSAKIEYSTSWVLLDHSLSATSTSGET  193

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+ +         +P K+  F+  L  A+
Sbjct  194  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKEANFETKLANAY  235

>PHYRA_41766
Length=209

 Score = 182 bits (462),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 130/231 (56%), Gaps = 26/231 (11%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H +V+PF +P P T S+KA VK+KPQ++I  GC PYPAV   G  SGGLK SG   G 
Sbjct  1    ISHQEVKPFAQPMPATISEKAGVKFKPQIQIRTGCVPYPAVNYLGETSGGLKTSGAXKGG  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W+NDVW    +WYFPK   +          GHRH+WE+ +V+IDN
Sbjct  61   CRGSGHGSQVYGRSAWLNDVWX---SWYFPKDSPS-------SGMGHRHDWEHVVVFIDN  110

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYY----NHLFGSTSLQLTEDT  198
            P++    I+G S S+   Y    P     +DG SVK+ Y +    NH      L +T D 
Sbjct  111  PDVAEPKIMGCSASSHNGYKKYAPCPPWVIDGTSVKVRYKHSWPINH-----DLDVTGDA  165

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            G FQDL+ WDQ+T+ AR +LN   + +          P+ DG F   L KA
Sbjct  166  GTFQDLIMWDQMTEDARRALNGVHFGDA-------NTPMNDGNFIPKLEKA  209

>PPTG_13026
Length=238

 Score = 183 bits (464),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 132/231 (57%), Gaps = 15/231 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            +  N+V P  +P P T +QKAA+K+KP+L I +GC  +PAV   G  S GL+        
Sbjct  22   VDFNKVVPIAQPSPSTSAQKAAIKFKPRLSITNGCVSFPAVNSAGETSSGLQEGYRGSSG  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CT + LGSQ+Y R+ W N  +AI+Y WYFPKG               RH+W  A+VWIDN
Sbjct  82   CTNAPLGSQVYGRTTWYNGTFAILYTWYFPKG-------FWNEYATRRHDWASAVVWIDN  134

Query  143  PELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            PEL + +ILG+S+S A   + +  P  +   DG + +L +  N   G   L  T+  G+F
Sbjct  135  PELASPSILGLSVSTADWKFKTFAPASSGITDGTTPRLAHVLNVEKGYPYLTTTDTVGDF  194

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            Q+L+ WDQLT  AR +LN TD     F +A  K+P+ D  FD  L KAWPF
Sbjct  195  QELIMWDQLTTAARTALNTTD-----FGVA--KVPVSDAAFDTKLKKAWPF  238

>PHYRA_52426
Length=152

 Score = 180 bits (456),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 107/160 (67%), Gaps = 8/160 (5%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I + +++PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDNEKIQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMY WY PKG            +  RH WE A+VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKG--------CPTKYQRRHFWETAVVWIDD  112

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY  182
            P L NSTILGVS++       ETP     +DG SVKL  Y
Sbjct  113  PALANSTILGVSLNYGWRSKEETPVAPRFLDGSSVKLNSY  152

>PHYSO_560790
Length=237

 Score = 183 bits (464),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 135/231 (58%), Gaps = 18/231 (8%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P T  Q+AAVKYKPQ+ I +GCHPYPAV  +G+ SGGL  +G +  
Sbjct  21   VINHDQVVPFTQPTPTTALQQAAVKYKPQIHISNGCHPYPAVDNNGNTSGGLNPTGSESA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEY--AIVW  139
             C GS  G+QIY R+     V+A MY+WY PK          L   GHRH+WE    +VW
Sbjct  81   GCKGSGYGTQIYGRAVKYQGVYAFMYSWYMPKDE-------TLTGLGHRHDWEACNCVVW  133

Query  140  IDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            +D+  L+N +I+ +S S   +Y    PP+++++DG S K+EY  + +    SL  T   G
Sbjct  134  LDS--LDNPSIVALSASYHSTYLYYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTAG  191

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            E QDL+ WDQLT  AR +L +TD+ +         +P K+  F+     A+
Sbjct  192  ETQDLIMWDQLTDAARTALEDTDFGDA-------NVPFKEANFETKRANAY  235

>PHYSO_329114
Length=236

 Score = 182 bits (463),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 121/202 (60%), Gaps = 9/202 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QVRPF +P+P T S+KAAVK+ PQ+ I +GCHPYPAV   G  SGGL+ +G     
Sbjct  23   INHDQVRPFAQPKPATVSEKAAVKFNPQIHITNGCHPYPAVNAAGETSGGLQTNGAPSAG  82

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W    WAIMY+WYFPK   +          GHRH+WE+ +VWIDN
Sbjct  83   CKGSGWGSQVYGRSTWYKGRWAIMYSWYFPKDSPST-------TLGHRHDWEHVVVWIDN  135

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            P + N  IL V+ SA   Y+   PP+A  V G + K+  Y +H   + +L  T+  G+ Q
Sbjct  136  PAVANPKILAVTPSAHSGYSKYAPPKAGTVTGNTAKVN-YESHWPVNHALDSTDVGGDAQ  194

Query  203  DLVTWDQL-TKLARYSLNNTDW  223
            DL+ W+Q   KL R    +  W
Sbjct  195  DLIMWEQQHGKLRRRQCTHERW  216

>PHYCA_129892
Length=234

 Score = 182 bits (461),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 136/229 (59%), Gaps = 16/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P T  Q  AV+YKPQ+ I +GCHPYPAV +DG+ SGGLK +G Q  
Sbjct  20   VIDHDQVVPFAQPTPTTTLQTLAVQYKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSQSA  79

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWEACVVWLD  132

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  LEN  ++ +S S   +Y +  PP++ ++DG S K+EY  + +    SL  T  +GE 
Sbjct  133  S--LENPNVVALSASYHSTYLTYYPPDSGYLDGNSAKIEYSTSWVILDHSLSATSTSGET  190

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+ +         +P KD  F+  L  A+
Sbjct  191  QDLIMWDQLTDAARTALEDTDFGDA-------NVPFKDANFETKLANAY  232

>PPTG_17295
Length=238

 Score = 181 bits (460),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 135/232 (58%), Gaps = 17/232 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + H+++ P  +P+PVT S+KAA+K+KPQL I DGC  +PAV   G  SGGLK S   +  
Sbjct  22   VDHDKLGPIPQPDPVTISEKAAIKFKPQLNIADGCVSFPAVNDGGDFSGGLKGSN-GNSA  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C  + +GSQ+Y R+ W ND WAIMYAW+FPKG         + +   R++W  A+VWIDN
Sbjct  81   CDDAPMGSQVYGRAAWYNDKWAIMYAWFFPKG-------FFMGVASRRYDWSSAVVWIDN  133

Query  143  PELENSTILGVSISASIS-YASETP-PEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            P+     +LG+S S S   Y  ++P P+   ++G +  L    + + G   L  +  TG+
Sbjct  134  PDFATPAVLGLSTSTSDDEYQRKSPAPDFGILNGVTPLLYRSISEVAGQPMLDYSSRTGD  193

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQ L+ W+QLT  AR +LN        F+    ++P  D  F+E L KA+PF
Sbjct  194  FQPLIMWEQLTDAARETLNT-------FDFGNAQVPFNDANFEEKLKKAYPF  238

>PHYCA_576423
Length=234

 Score = 181 bits (459),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 132/229 (58%), Gaps = 16/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+QV PF +P P T  Q  A+++KPQ+ I +GCHPYPAV  DG+ SGGLK +G Q  
Sbjct  20   VIDHDQVIPFAQPMPNTTLQSVAIQFKPQIYINNGCHPYPAVDADGNTSGGLKPTGSQSA  79

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C GS  GSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  80   GCKGSGYGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLDGQGHRHDWENCVVWLD  132

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L+  +I+ +S S   +Y    PP ++++DG S K++Y  + +    SL  T   GE 
Sbjct  133  S--LDRPSIVALSASYHSTYNYYYPPSSSYLDGNSAKIQYSTSWIVLDHSLSATSTAGEI  190

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+           +P K+  F   L KA+
Sbjct  191  QDLIMWDQLTDAARTALEDTDF-------GSANVPFKEDNFIAKLAKAY  232

>PPTG_14652
Length=257

 Score = 181 bits (460),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 136/232 (59%), Gaps = 18/232 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V+PF +PEP+T ++KAAVK+KP L ++ GCHPYP V   G  S GL+ +GP DG 
Sbjct  20   INHDMVKPFAQPEPITIAEKAAVKFKPSLAVKSGCHPYPIVNAAGDTSTGLEGTGPPDGG  79

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPAPLILRLFGHRHNWEYAIVW  139
            C G +LGSQ+Y+RS W  D WAIMYAWYFPK    RG V         G RH+W   +VW
Sbjct  80   CEGPELGSQVYSRSTWCEDKWAIMYAWYFPKDIQNRGLVKT-------GVRHDWVNLVVW  132

Query  140  IDNPELENSTILGVSIS--ASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTED  197
            +DNP L    +L  S S   ++   S+ P  ++ ++G + KL Y  +      ++    +
Sbjct  133  LDNPALVKPAMLATSASTYGNLYVISKPPKTSDVINGTTPKLRYDEDGYEAWHTVFQFHE  192

Query  198  TGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
             GE+QDL+ W+QLT  AR +L NTD     F + G  +P  D  F+  L +A
Sbjct  193  EGEYQDLIQWNQLTDAAREALTNTD-----FGVFG-HVPFIDAFFETNLKEA  238

>PHYRA_76657
Length=239

 Score = 181 bits (458),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 138/233 (59%), Gaps = 18/233 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWSGPQD  80
            I H++V+PF +P+PVT ++K+ VK+KP+LKI  E GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELKIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG          R    RH+W  A+VWI
Sbjct  82   A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWNRRAYWRHDWSNAVVWI  133

Query  141  DNPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+P LEN  +LG+S+S S + Y  +  P     +G +  L Y     +   +L L   +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAALALYYASG  192

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + QDL+ W QLT  AR +LN+ D      N    ++P+ D  F + L KAWPF
Sbjct  193  DVQDLIMWGQLTDAARAALNDQD------NFGRTEVPINDDHFLKHLEKAWPF  239

>PHYRA_84277
Length=240

 Score = 180 bits (456),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 131/234 (56%), Gaps = 17/234 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             + H++V+PF +P PVT S+KA VK+KP L I  GC  YPAV   G  SGGLK SG    
Sbjct  21   TVDHDKVQPFPQPAPVTISEKAGVKFKPHLHIITGCASYPAVNAAGETSGGLKGSGGTTS  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWI  140
             C    LGSQ+Y R+ W NDVWAIMYAWYFPKG   A P          RH+W  A+VWI
Sbjct  81   GCALPPLGSQVYGRAGWYNDVWAIMYAWYFPKGFWDASPF--------WRHDWSNAVVWI  132

Query  141  DNPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHL-FGSTSLQLTEDT  198
            DNP LEN   LG+SIS S + Y S    ++    G +  L  Y   +   + S     + 
Sbjct  133  DNPALENPKALGLSISRSENKYGSTYTDDSVFEYGTTPSLSRYLPPMQTAALSTSSFPND  192

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             E QDL+ WDQLT  AR +LN+ D      N     +P+ D  F +LL +AWPF
Sbjct  193  FELQDLIMWDQLTDAARAALNDQD------NFGRTDVPISDDHFPKLLEEAWPF  240

>PPTG_07991
Length=276

 Score = 181 bits (458),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 136/234 (58%), Gaps = 30/234 (13%)

Query  22   VIGHNQVRPF--LEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  79
             I ++QV PF   +P   T ++KAA+K++P+L + +GCHPYPAV   G +S GL+ +   
Sbjct  69   TIAYDQVEPFEMAQPSDATVTEKAAIKFRPKLHVVNGCHPYPAVNAAGQVSKGLQKADAT  128

Query  80   DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVW  139
            D EC+GSKLG+Q+Y RS W   VWAIMYAWYFP                   +WE+ IVW
Sbjct  129  DAECSGSKLGTQVYGRSAWFGRVWAIMYAWYFPD---------------VSPDWEHVIVW  173

Query  140  IDNPELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198
             +NP + N  IL V+ S S   Y+S+ PP+A+ + G+SVK+ Y  N      +L+ T   
Sbjct  174  TNNPNVTNQVILAVTTSDSTGKYSSQVPPDASMISGKSVKIAYNNN------ALESTTKE  227

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G  Q+LV W QLT  A+ +LN+        +  G+++P+ D  F   L KAWPF
Sbjct  228  GGAQNLVLWHQLTPEAQEALNDDQ------SFGGVQVPVNDDYFLLNLGKAWPF  275

>PHYSO_423056
Length=233

 Score = 179 bits (454),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 127/219 (58%), Gaps = 20/219 (9%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+K AVK+KP L+I+ GCHPYPAV   G  S GLK SGP DG+
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIDGGCHPYPAVNAAGETSAGLKGSGPDDGK  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +G     ++ +  G RH W  A+VW+DN
Sbjct  61   CKGSGLGSQVYGRAIWYKDLWAIVYGWYFPKDKGF--GGILAK--GQRHKWVSAVVWLDN  116

Query  143  PELENSTILGVS---ISASISYASETPPE----------ANHVDGESVKLE---YYYNHL  186
            P +E   IL +S   +          PPE          A +++  +  L    Y+    
Sbjct  117  PAVETPKILAISTWNLEGGYVILKNEPPECSRHGCDPKFAEYINMTTPMLSYEPYFQRDS  176

Query  187  FGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDE  225
            F +        TGE QDLV W+QL++ AR +L   D+ E
Sbjct  177  FHTLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGE  215

>PHYKE_8391
Length=778

 Score = 191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 110/141 (78%), Gaps = 4/141 (3%)

Query  106  MYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENSTILGVSISASISYASET  165
            MYAWYFPKGR       +    GHRHNWEYAIVWIDNP L+NSTILGVS+SAS  Y+  +
Sbjct  1    MYAWYFPKGRKITGGAGL----GHRHNWEYAIVWIDNPALDNSTILGVSMSASFGYSKSS  56

Query  166  PPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDE  225
            PP+A HVDG SVKL+YYY+ + G+T+L+ TED GE QDL+TWDQL  +A+ +LNNTDWD 
Sbjct  57   PPKAKHVDGSSVKLDYYYSVIRGNTALRYTEDVGETQDLITWDQLPVVAQDALNNTDWDT  116

Query  226  TLFNLAGLKMPLKDGEFDELL  246
            TL+N+  +KMPLKDGEF + L
Sbjct  117  TLWNMCDVKMPLKDGEFTKNL  137

>HYAP_07436
Length=267

 Score = 179 bits (455),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 131/228 (57%), Gaps = 14/228 (6%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H++++PF E EP T ++KA V++KPQ+K  DGCH Y AV   G  SGGLK  G  +G+C 
Sbjct  50   HDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGKCK  109

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
            GS  GSQIY RS    + WAIMYA YFPK        + +   G+RH +E+ IVWID+  
Sbjct  110  GSGFGSQIYGRSAPFGNKWAIMYALYFPKD-------MKVLNRGYRHAFEHVIVWIDDIA  162

Query  145  LENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDL  204
            L++  IL V+   +  Y     P+   +DG+SVKL Y    L G   L  +   GEFQ L
Sbjct  163  LKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQPL  222

Query  205  VTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + W+QLT  AR +L   +W          KMPL D  F+E L +AWPF
Sbjct  223  IMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>PPTG_04799
Length=245

 Score = 179 bits (453),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 141/239 (59%), Gaps = 22/239 (9%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQL--KIEDGCHPYPAVQKDGSISGGLKWSGPQ  79
             I H+++ PF +P+PVT S+KAA+K+KPQL   I+  C P+PAV   G ++GGLK +   
Sbjct  21   TIDHDKIEPFPQPKPVTMSEKAAIKFKPQLFTSIKTVCAPFPAVNAAGDVTGGLKGTNGN  80

Query  80   DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVW  139
            D  C  ++ GSQ+Y R+ W  D+WAIMYAWYFPKG         +     RH+W+  +VW
Sbjct  81   DA-CRFARKGSQVYGRAGWHKDMWAIMYAWYFPKG-------FWMDFPTRRHDWKNVVVW  132

Query  140  IDNPELENSTILGVSISAS-ISYASETPP----EANHVDG-ESVKLEYYYNHLFGSTSLQ  193
            IDNP+LE+  I+ VS+S S  SY +E         +  +G +   L ++Y    GS  L 
Sbjct  133  IDNPDLESPKIVAVSMSKSGRSYHTEDQSGGLISRSFFNGFDRTSLRFHYQTDLGSPYLN  192

Query  194  LTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
                 GE+QDL+ W+QLT  AR +LN+      ++N    ++P  D  F++ L+KAWPF
Sbjct  193  FAWWGGEYQDLIMWEQLTDPARVALND------IYNFGDAEVPFSDNNFEDYLDKAWPF  245

>PHYRA_72531
Length=236

 Score = 178 bits (451),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 132/232 (57%), Gaps = 17/232 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             IGH++V+PF +PE VT ++K+ VK+KPQL IE GC PYPAV   G  S GL+ +G  D 
Sbjct  21   AIGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEYGCSPYPAVNAAGETSEGLETNGVFD-  79

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWI  140
             C    L SQ+Y R++W NDVWAIMYAWYFPKG     P          RH+W  A+VWI
Sbjct  80   -CIIPSLSSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP--------WWRHDWSNAVVWI  130

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP  E   +LG+S+S S +    T   A  ++  +            S +L    + GE
Sbjct  131  DNPAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSRNVLPMRSAALGPAVNPGE  190

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            FQDLV WDQLT  AR +LN+ D      N    ++P+ D  F + L KAWPF
Sbjct  191  FQDLVMWDQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLKKAWPF  236

>HYAP_07925
Length=267

 Score = 179 bits (454),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 131/228 (57%), Gaps = 14/228 (6%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H++++PF E EP T ++KA V++KPQ+K  DGCH Y AV   G  SGGLK  G  +G+C 
Sbjct  50   HDKIQPFSELEPKTPAEKAGVRFKPQIKFVDGCHSYAAVDAAGHNSGGLKPKGQPEGKCK  109

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
            GS  GSQIY RS    + WAIMYA YFPK        + +   G+RH +E+ IVWID+  
Sbjct  110  GSGFGSQIYGRSAPFGNKWAIMYALYFPKD-------MKVLNRGYRHAFEHVIVWIDDIA  162

Query  145  LENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDL  204
            L++  IL V+   +  Y     P+   +DG+SVKL Y    L G   L  +   GEFQ L
Sbjct  163  LKDPKILAVTSRRNKEYQKIVSPDPRCMDGDSVKLFYESEVLDGYHQLSCSTFPGEFQPL  222

Query  205  VTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + W+QLT  AR +L   +W          KMPL D  F+E L +AWPF
Sbjct  223  IMWEQLTNEARTALETVNWGRD-------KMPLGDVAFNESLEQAWPF  263

>PHYSO_365942
Length=233

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 126/223 (57%), Gaps = 28/223 (13%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+K AVK+KP L+I  GCHPYPAV   G  S GLK  GP+DGE
Sbjct  1    IDHDKVQPFAQPEPVTVSEKTAVKFKPSLQIVGGCHPYPAVNAAGETSAGLKGRGPKDGE  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +G     ++ +  G RH W  A+VW+DN
Sbjct  61   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDKGY--GSILAK--GQRHKWVSAVVWLDN  116

Query  143  PELENSTILGVS---ISASISYASETPPEANHVDGESVKLEYY-----------------  182
            P LE   IL +S   +          PP+      ++   EY                  
Sbjct  117  PALETPKILAISTWNVEGGYDILKNEPPQCYRYSCDAKFAEYINMTTPMLSYERCRPEPS  176

Query  183  YNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDE  225
            Y+ L  +T+      TGE QDLV W+QL++ AR +L   D+ E
Sbjct  177  YHTLRPTTA----RGTGELQDLVMWEQLSEEARIALGEADFGE  215

>PHALS_13513
Length=240

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 137/237 (58%), Gaps = 24/237 (10%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I  N V+PF E +P T S+++A+KYKP L + +GCHPYPAVQ++GS+S G +W      
Sbjct  22   AIDANSVQPFPEQKPQTDSERSALKYKPHLHVSEGCHPYPAVQQNGSVSAGFEWDEDYSQ  81

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK-----GRGAVPAPLILRLFGHRHNWEYA  136
             C  S  GSQIY+RS W    WAIMYAWYFPK     GRG         + G RH W +A
Sbjct  82   PCGRSPQGSQIYSRSSWYKGKWAIMYAWYFPKAAVHIGRG---------VSGRRHYWLHA  132

Query  137  IVWIDNPELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLT  195
            IVW D     NS+ILGV++SA I     T  ++++ + G ++KL  Y +      +L+ T
Sbjct  133  IVWTDEENPNNSSILGVTMSAGIGLLKRTKIKSHYIIGGTTLKLMSYVSFWGRRLALKFT  192

Query  196  EDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
               GE QDL+TW+QL+  AR +L      +T         PL+D  FD L+ +A+PF
Sbjct  193  VKLGETQDLITWEQLSHEARKALALDYKSDT---------PLQDYRFDGLIKEAYPF  240

>PITG_23211
Length=245

 Score = 177 bits (448),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 132/229 (58%), Gaps = 12/229 (5%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+ V+PF +PEP T ++K AVK+KP L ++ GCHPYP V   G    GLK +G  DGE
Sbjct  6    IDHDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGE  65

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            CTGS LGSQ+Y+RS    + WAIMYAWYFPK    +   LI +  G RH+W   +VW+DN
Sbjct  66   CTGSPLGSQVYSRSTLYENKWAIMYAWYFPKNMQNI--GLIKK--GVRHDWVNLVVWLDN  121

Query  143  PELENSTILGVSISA-SISYASETPPE-ANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            P L   TIL  S S     Y    PP+ ++ ++G + K+ Y  +   G  ++    + GE
Sbjct  122  PTLAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFHEEGE  181

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            +QDL+ W QLT  AR +L NTD+ +         +P  D  F+  +  A
Sbjct  182  YQDLIQWTQLTDAAREALENTDFGDF------ANVPFNDAYFETNVKAA  224

>PHYRA_52260
Length=234

 Score = 176 bits (446),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 135/229 (59%), Gaps = 17/229 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            + +++V+PF +P+PVT ++K+ VK+KPQL IE GC  YPAV   G I+GGL  SG  D  
Sbjct  22   VDYDKVQPFPQPDPVTTTEKSGVKFKPQLDIEYGCSSYPAVNAAGDINGGLPTSGIAD--  79

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWID  141
            C  +  GSQ+Y R++W NDVWAIMYAWYFPKG   A P          RH+W  A+VWID
Sbjct  80   CQFALGGSQVYGRAEWYNDVWAIMYAWYFPKGFWDAAPY--------WRHDWSNAVVWID  131

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            NP LEN  ILG+S+S S +    T   A  ++  +         +F +  L+ + + GEF
Sbjct  132  NPALENPKILGLSLSTSENKYGNTYVPAEAIENGTTPTLNRNLPVFRAAELRPSTNRGEF  191

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ W QLT  AR +LN+ D           ++P+ D  F + L +AW
Sbjct  192  QDLIMWGQLTDAARAALNDQD------TFGRTEVPISDDHFPKRLEEAW  234

>PITG_23228
Length=254

 Score = 176 bits (447),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 140/247 (57%), Gaps = 31/247 (13%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI-EDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            I H++V+PF +P PVT S+KAA+ +KPQL   +  C P+PA    G I+GGLK S   D 
Sbjct  22   IDHDKVQPFSQPTPVTISEKAAITFKPQLYTPKSVCVPFPAANAYGEITGGLKGSNGNDA  81

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C    LGSQ+Y R  W  DVWAIMYAWYFPKG         +     RH+W+  +VWID
Sbjct  82   -CVFPPLGSQVYGRVGWFRDVWAIMYAWYFPKG-------FWMGFVSRRHDWKNVVVWID  133

Query  142  NPELENSTILGVSISASIS----------------YASETPPEANHVDGESVKLEYYYNH  185
            NP LE   ILGVS+S S +                Y      + +++ G +  L +YY+ 
Sbjct  134  NPGLEEPKILGVSMSKSETKYTKERRLWPSNFAGFYRMGRRYDRSYIYGFNTFLRFYYHF  193

Query  186  LFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDEL  245
              G+ +L L+E  GE+QDL+ W+QLT +AR +LN ++      N   +++P+ D  F+  
Sbjct  194  DVGTPNLYLSEWEGEYQDLIMWEQLTDVARAALNGSN------NFEEVEVPISDEHFETR  247

Query  246  LNKAWPF  252
            L++AW F
Sbjct  248  LDEAWLF  254

>PHYCA_123797
Length=241

 Score = 176 bits (446),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 133/234 (57%), Gaps = 30/234 (13%)

Query  22   VIGHNQVRPF--LEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQ  79
             I +++V PF   +P   T ++KAA+K++P+LK+ +GCHPYPAV   G +S GL+ + P 
Sbjct  34   TIAYDKVVPFPMAQPSESTVTEKAAIKFRPKLKVVNGCHPYPAVNAAGQVSNGLEVADPT  93

Query  80   DGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVW  139
               C GSKLG+Q+Y RS W   VWAIMYAWYFP                   +WE+ IVW
Sbjct  94   GAACKGSKLGTQVYGRSAWFGRVWAIMYAWYFPDVTA---------------DWEHVIVW  138

Query  140  IDNPELENSTILGVSISASI-SYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198
             +NP + N  +L V+ S S   Y S+ PP+A  + G+SVK+ Y  N       L+ T + 
Sbjct  139  TNNPNVTNQVVLAVTTSNSKGGYTSQVPPDATMMSGKSVKVSYNNN------GLESTTEE  192

Query  199  GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            G  Q+L+ W QLT  A+ +LN+        N  G+++P+ D  F   L KAWPF
Sbjct  193  GGAQNLILWHQLTAAAQEALNDDQ------NFDGVQVPVNDDYFLLNLGKAWPF  240

>PHYRA_52427
Length=124

 Score = 172 bits (435),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 95/132 (72%), Gaps = 8/132 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF EPEP T S+KAAVK+KPQL +  GC+PYPAVQ DGS+S GL+ SGP DGE
Sbjct  1    IDHDKVQPFAEPEPTTDSEKAAVKFKPQLLVTYGCYPYPAVQADGSVSAGLRGSGPADGE  60

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  D WAIMY WY PKGR              RH WE A+VWID+
Sbjct  61   CRGSSLGSQVYSRSDWYEDKWAIMYTWYLPKGRST--------RHQRRHFWETAVVWIDD  112

Query  143  PELENSTILGVS  154
            P L NSTILGVS
Sbjct  113  PALANSTILGVS  124

>PPTG_00471
Length=239

 Score = 176 bits (445),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 132/227 (58%), Gaps = 13/227 (6%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H++V+PF +PEP+T ++KAA+KYKP L ++ GCHPYPAV   G  S GLK +G  DGEC 
Sbjct  22   HDKVQPFAQPEPITDAEKAAIKYKPSLAVKAGCHPYPAVNAAGETSAGLKGTGAPDGECE  81

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
            GS LGSQ+Y+RS W    WAIMYAWYFPK    V   LI +  G RH+W   +VW+DNP 
Sbjct  82   GSPLGSQVYSRSTWYEGKWAIMYAWYFPKDIKDV--GLIKK--GLRHDWVNLVVWLDNPA  137

Query  145  LENSTILGVSISASISYASETPP--EANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQ  202
            L    IL  + S   +Y   + P   +  ++G + K+ Y  +   G  ++    + GE+Q
Sbjct  138  LAKPKILATATSTFGAYYKISKPFKRSEVINGITPKVCYDNDDYKGWHTIFPFHEEGEYQ  197

Query  203  DLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            DL+ W+QLT  AR +  N D+ E         +P  D  F+  L  A
Sbjct  198  DLIQWNQLTDAAREAFENGDFGEA-------NVPFNDAYFETNLKSA  237

>PYVX_22469
Length=474

 Score = 182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 136/231 (59%), Gaps = 15/231 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V  F +P P T S++ A+ YKPQL I +GCHPYPAV  DG+ SGGLK +G QD 
Sbjct  21   VINHDAVAAFAQPSPTTTSEEIAITYKPQLYIANGCHPYPAVDADGNTSGGLKPTGAQDS  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +C GS LG+QIY R+   N V+AIMY+WY PK          L   GHRH WE  +VW+D
Sbjct  81   DCKGSALGTQIYGRATEYNGVYAIMYSWYMPKDSP-------LSGLGHRHEWENVVVWLD  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +    + +I+ VS SA  +Y    PP +++V+G S K++ Y + +  + SL +T  +GE 
Sbjct  134  SATASSPSIVAVSPSAHGNYHIYNPPSSSNVNGTSAKVK-YESQVVINHSLDITTVSGET  192

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            Q L+ ++QL++ AR +L  TD+           +P K+  F   L  A P 
Sbjct  193  QPLILYEQLSEAARQALETTDF-------GSATVPFKNTTFTANLALASPI  236

 Score = 174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 133/229 (58%), Gaps = 14/229 (6%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF +P P T  Q AAVK+KP L I++GCHPYPAV +DG+ SGGLK +G   G
Sbjct  258  VIDHDAVVPFAQPTPNTTEQSAAVKFKPTLYIDNGCHPYPAVDEDGNTSGGLKPTGSTTG  317

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             CTGS LGSQIY R    + VWAIMY+WY PK     P+P I    GHRH+WE A++W+D
Sbjct  318  GCTGSSLGSQIYGRVMEYDGVWAIMYSWYMPKDE---PSPYI----GHRHDWENAVIWVD  370

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +    + +I+ +S S    Y    PP A++  G + K++Y          L  T   GE 
Sbjct  371  DITSASPSIVAISASEHSGYKVYYPPSADYYSGYTAKIKYESVFFLVDHCLYATSTAGET  430

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  A+ +L +TD+           +P K+  F   + KA+
Sbjct  431  QDLIMWDQLTAAAQTALEDTDF-------GSANVPFKEANFATKVAKAY  472

>PPTG_17453
Length=254

 Score = 176 bits (446),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/248 (40%), Positives = 136/248 (55%), Gaps = 31/248 (13%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQD  80
             + H+++ PF +PEP T S+KAAVK+KPQL   +  C PYPAV   G ++GGLK +   D
Sbjct  21   TVDHDKIEPFPQPEPATISEKAAVKFKPQLYTPNSVCVPYPAVNVAGEVAGGLKGTNGND  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C  +  GSQIY R+ W ND+WAIMYAWYFPKG         +     RH+W+  +VWI
Sbjct  81   A-CKYAPKGSQIYGRAGWYNDLWAIMYAWYFPKG-------FWMDSPSRRHDWKSVVVWI  132

Query  141  DNPELENSTILGVSISAS-ISYASETPP---------------EANHVDGESVKLEYYYN  184
            DNPE +   I+GVS+S S   Y  ET                    ++ G +  L + Y 
Sbjct  133  DNPESQTPKIVGVSMSKSDTRYNKETKTWPSNFAGYRMEGRRYHRTYIYGSNTSLRFQYQ  192

Query  185  HLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDE  244
               GS  L   +  GE+QDL+ W+QLT  AR +LN+ +      N    ++P  D  +++
Sbjct  193  SDLGSPYLNFGDWEGEYQDLIMWEQLTDAARAALNDGN------NFGDAEVPFSDEHYEK  246

Query  245  LLNKAWPF  252
             L+KAWPF
Sbjct  247  HLDKAWPF  254

>PITG_22981
Length=259

 Score = 176 bits (446),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 132/228 (58%), Gaps = 14/228 (6%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H+ V+PF +PEP T ++K AVK+KP L ++ GCHPYP V   G    GLK +G  DGECT
Sbjct  22   HDTVQPFAQPEPTTDAEKTAVKFKPSLAVKAGCHPYPVVNAAGDTGAGLKGTGRSDGECT  81

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
            GS LGSQ+Y+RS    + WAIMYAWYFPK    +   LI +  G RH+W   +VW+DNP 
Sbjct  82   GSPLGSQVYSRSTLYENKWAIMYAWYFPKDMQDI--GLIKK--GVRHDWVNLVVWLDNPT  137

Query  145  LENSTILGVSISA-SISYASETPPE-ANHVDGESVKLEYYYNHLFG-STSLQLTEDTGEF  201
            L   TIL  S S     Y    PP+ ++ ++G + K+ Y  +   G  T  Q  E+ GE+
Sbjct  138  LAKPTILATSASTYGTQYVISKPPKRSDIINGTTAKVRYDEDDRDGWHTIFQFLEE-GEY  196

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
            QDL+ W QLT  AR +L NTD+ +         +P  D  F+  L  A
Sbjct  197  QDLIQWTQLTDAAREALENTDFGDF------ANVPFNDAYFETNLKAA  238

>PITG_00957
Length=298

 Score = 177 bits (448),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 134/234 (57%), Gaps = 22/234 (9%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+P+T  +KAAVK+KP L +  GCHPYPAV   G  S GLK +G  DG 
Sbjct  58   IDHDKVQPFAQPQPITDVEKAAVKFKPSLAVMSGCHPYPAVNAAGETSAGLKGTGEPDGG  117

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKG--RGAVPAPLILRLFGHRHNWEYAIVWI  140
            C GS+LGSQ+Y+RS W    WAIMYAWYFPK    G       L   G RH+W   +VW+
Sbjct  118  CEGSELGSQVYSRSTWYEGRWAIMYAWYFPKDIQNGG------LAKKGIRHDWVNVVVWL  171

Query  141  DNPELENSTILGVSISA-SISYASETPPEANH-VDGESVKLEYYYNHLFGS---TSLQLT  195
            +NP +   TIL  S S     Y    PP+++  +DG + KL   Y+   G    T  Q  
Sbjct  172  NNPAVAAPTILATSASTYGTRYVISKPPKSSDIIDGITAKLR--YDEEGGEEWHTIFQFY  229

Query  196  EDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
             + GEFQDL+ WDQLT  AR +L NTD+ +       + +P  D  F+  L  A
Sbjct  230  GE-GEFQDLIQWDQLTDAAREALQNTDFGDY------VNVPFNDAYFETNLKAA  276

>PHYSO_365377
Length=220

 Score = 174 bits (441),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 130/227 (57%), Gaps = 17/227 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I ++QV PF E  P T S+KAA+K+KP L I+DGCHPY AV   G  SGGL      D E
Sbjct  1    IDYDQVEPFPELGPKTISEKAAIKFKPTLFIKDGCHPYAAVNAAGDTSGGLD-PKASDDE  59

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W  + WA MYAWYFPK          L L G RH+W  AIVW+DN
Sbjct  60   CKGSTLGSQVYSRSTWYRNTWATMYAWYFPKDTN-------LYLRGVRHDWVSAIVWLDN  112

Query  143  PELENSTILGVSISA-SISYASETPPEAN----HVDGESVKLEY-YYNHLFGSTSLQLTE  196
            P L N T++GVS S+   SY       +     +VDG   K+EY   +   G  ++  +E
Sbjct  113  PALANQTLIGVSFSSGGASYGGFHLDRSRMWDGYVDGTHPKMEYSAADTRSGYHTIDASE  172

Query  197  DTGEFQDLVTWDQLTKLARYSLNNTDWDETL---FNLAGLKMPLKDG  240
            D G+FQDL+ W QLT+ AR +L   D+       FN A  K  L+ G
Sbjct  173  DVGDFQDLIHWSQLTEEARNALETGDFGSDTPVPFNNANFKKNLERG  219

>PHYCA_553546
Length=280

 Score = 176 bits (446),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 139/272 (51%), Gaps = 57/272 (21%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +PEPVT S+KAAVKYKPQL+I DGC  +PAV   G I+GGLK  G +D 
Sbjct  25   TIDHDQVKPFPQPEPVTISEKAAVKYKPQLEIGDGCVSFPAVNAAGEITGGLK--GTKDT  82

Query  82   E-CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            E CT + LGSQ+Y RS W  D WA+MY+WYFPK   A  A         RH+W   ++WI
Sbjct  83   EACTEAPLGSQVYGRSTWFQDKWAMMYSWYFPKNFCAYKA-------AGRHDWANVVIWI  135

Query  141  DNPELENSTILGVSISAS-----------ISYASETP-------PEANHVDGESV-----  177
            DNP  EN T LG S+S             +   +E P       P       E +     
Sbjct  136  DNPAAENVTFLGASLSQQTLEPIKLAILPMGTRNEEPYQNQKAIPMMAFAGAERITTGRV  195

Query  178  -KLEYYYNHLFGSTS----------------LQLTEDTGEFQDLVTWDQLTKLARYSLNN  220
             +  Y Y ++ GS +                +   +  GE QDL+ W+QLT  AR +L +
Sbjct  196  GRWSYTYKYVAGSNTTMRFSHSYPGTWGWIDMTFADSDGESQDLIMWNQLTDKARAALES  255

Query  221  TDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             D+ +T       ++P  D  FD  L  AWPF
Sbjct  256  ADFGDT-------QVPFTDKNFDTNLQAAWPF  280

>PHYSO_527850
Length=195

 Score = 173 bits (439),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 110/176 (63%), Gaps = 9/176 (5%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF E EPV  S+KAAVK+KPQL+I  G H YPAV++DG++S GLKW G  DGE
Sbjct  20   INHDEVQPFPELEPVGASEKAAVKFKPQLQISYGFHTYPAVRRDGAVSNGLKWGGKPDGE  79

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W    WAIMYAWYFPK      A     L  HRH W Y +VWIDN
Sbjct  80   CKGSAWGSQVYTRSDWYQGKWAIMYAWYFPK------AWQENDLISHRHLWLYIVVWIDN  133

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDT  198
            PE  N  +LGV +  +       PP+A   +G S+K EYY +   G T LQ T+  
Sbjct  134  PEAVNPAVLGVYVRTAGGSERRAPPDAKFFEGSSLKSEYYKS---GKTGLQRTDKA  186

>PPTG_11469
Length=253

 Score = 175 bits (444),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 138/248 (56%), Gaps = 31/248 (13%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQD  80
             + H++++PF +PEPVT S+KAA+K+KPQL I +G C  YPAV   G  +GGLK S   D
Sbjct  20   TVDHDKIQPFPQPEPVTISEKAAIKFKPQLYIPEGVCVSYPAVNDAGETTGGLKGSNGND  79

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C  + LGSQ+Y R+ W  DVWAIMYAWYFPKG         +     RH+W+  +VWI
Sbjct  80   A-CKSAPLGSQVYGRAGWYKDVWAIMYAWYFPKG-------FWVGFPTRRHDWKSVVVWI  131

Query  141  DNPELENSTILGVSISASIS--------YASETP--------PEANHVDGESVKLEYYYN  184
            DNP+LE   I+GVS+S S +        +AS+              +  G +  L + Y 
Sbjct  132  DNPDLEVPKIVGVSMSKSDTKYDKRLELFASDFAGFQMMGQGRFRTYTYGSNTSLRFGYQ  191

Query  185  HLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDE  244
               GS  L      GE+QDL+ W+QLT  AR +LN+ +      N    ++P  D  +++
Sbjct  192  MELGSPYLNFGVRDGEYQDLIMWEQLTDAARAALNDDN------NFEKAEVPFSDEHYED  245

Query  245  LLNKAWPF  252
             L+KAWP 
Sbjct  246  HLDKAWPL  253

>PHYRA_72403
Length=239

 Score = 174 bits (441),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 135/233 (58%), Gaps = 18/233 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWSGPQD  80
            I H++V+PF +P+PVT ++K+ VK+KP+L I  E GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG     A         RH+W  A+VWI
Sbjct  82   A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDSRAYW-------RHDWSNAVVWI  133

Query  141  DNPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+P LEN  +LG+S+S S + Y  +  P     +G +  L Y     +    L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYECAELVPYYASG  192

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+ WDQLT  AR +LN+ D      N    ++P+ D  F + L KAWP 
Sbjct  193  EVQDLIMWDQLTDAARAALNDQD------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYSO_334500
Length=235

 Score = 174 bits (441),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 136/229 (59%), Gaps = 16/229 (7%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI H+ V PF +P P T  Q  AVK+KPQ+ I +GCHPYPAV +DG+ SGGLK +G +  
Sbjct  21   VIDHDTVVPFAQPTPTTTLQTLAVKFKPQIYIANGCHPYPAVDEDGNTSGGLKPTGSESS  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
              TGS LGSQIY R+     V+A MY+WY PK          L   GHRH+WE  +VW+D
Sbjct  81   GYTGSSLGSQIYGRAVEYEGVYAFMYSWYMPKDE-------TLPGLGHRHDWEACVVWLD  133

Query  142  NPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            +  L++ +I+ +S S   +Y +  PP+++++DG S K+EY  + +    SL  T   GE 
Sbjct  134  S--LDDPSIVALSASYHSTYLTYYPPDSDYLDGNSAKIEYSTSWVILDHSLSATSTAGET  191

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            QDL+ WDQLT  AR +L +TD+           +P K+  F   + KA+
Sbjct  192  QDLIMWDQLTDAARTALEDTDF-------GSANVPFKEANFATKVAKAY  233

>PHYRA_47241
Length=176

 Score = 172 bits (435),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 110/160 (69%), Gaps = 8/160 (5%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+KAAV++KP L+I  GCHPYPAV   G  S GLK +GP  G+
Sbjct  24   IDHDKVQPFAQPEPVTDSEKAAVRFKPSLQIFSGCHPYPAVNAAGETSAGLKGTGPSSGD  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+YAR+ W +D+WAIMYAWYFPK +     P   +  G RH+W   +VW+DN
Sbjct  84   CKGSGLGSQVYARAVWYSDLWAIMYAWYFPKDK-----PTFRK--GERHDWVNVVVWLDN  136

Query  143  PELENSTILGVSISASI-SYASETPPEANHVDGESVKLEY  181
            P LE  TI+GVS S+ + +Y   TPP A+ + G +  + Y
Sbjct  137  PALERPTIIGVSPSSYVTTYFKYTPPPADMLSGTTSMINY  176

>PHYKE_208
Length=187

 Score = 172 bits (436),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 104/160 (65%), Gaps = 13/160 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV PF +PE  T S+KAAVK+KPQ+ + +GCHPYPAV   G  SGGLK +G   G 
Sbjct  22   ISHDQVVPFAQPEATTISEKAAVKFKPQIHVTNGCHPYPAVNSAGDTSGGLKPTGAPSGS  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQ+Y RS W +  WAIMY+WYFPK   +          GHRH+WE+ +VWIDN
Sbjct  82   CKGSGYGSQVYGRSTWYSGRWAIMYSWYFPKDSPST-------GLGHRHDWEHVVVWIDN  134

Query  143  PELENSTILGVSISASISYASETPPEANHVDGESVKLEYY  182
            P++EN TILGVS SA   Y+   PP ++ VD      EYY
Sbjct  135  PDVENPTILGVSPSAHSGYSKYVPPSSDTVD------EYY  168

>PHYSO_504553
Length=257

 Score = 174 bits (441),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 131/245 (53%), Gaps = 27/245 (11%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +PEPVT S+K AVK+KP L I DGCHPYPAV   G  S GLK SG  DG+
Sbjct  24   IDHDKVQPFAQPEPVTVSEKTAVKFKPSLHIVDGCHPYPAVNAAGETSAGLKGSGRIDGK  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y R+ W  D+WAI+Y WYFPK +      +     G RH W  A+VW+DN
Sbjct  84   CKGSALGSQVYGRAIWYKDLWAIVYGWYFPKDK------VDFLNKGQRHKWVSAVVWLDN  137

Query  143  PELENSTILGVS---ISASISYASETPPEA----------NHVDGESVKLEYYYNHLFGS  189
            P +E   IL +S   +          PPE            +++  +  L Y  +     
Sbjct  138  PAVETPKILAISTWNVKGGYDILKNEPPECYRYGCDPKFVEYINMTTPMLSYVRSLEEPV  197

Query  190  TSLQLT--EDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLN  247
             +L+ T    TGE QDLV W+QL++ AR +L   D+ E         +P  D   +  L 
Sbjct  198  HTLRPTTARGTGELQDLVMWEQLSEEARIALGEADFGEK------SPVPFIDTNLNANLE  251

Query  248  KAWPF  252
             A PF
Sbjct  252  AARPF  256

>PHYCA_109174
Length=277

 Score = 174 bits (442),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 140/274 (51%), Gaps = 60/274 (22%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             IGH++V+PF +P+PVT S+KAAVKYKPQL+I D C  +PAV   G I+GGLK +   DG
Sbjct  21   TIGHDKVQPFAQPDPVTVSEKAAVKYKPQLQISDSCVSFPAVNAAGEITGGLKGTKGTDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPAPLILRLFGHRHNWEYAIV  138
             CT + LGSQ+Y RS W  D WA+M+AWYFPK   G GA            RH W   ++
Sbjct  81   -CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNFWGGGA----------KSRHLWANMVL  129

Query  139  WIDNPELENSTILGVSISA-----------SISYASETP-------PEANHVDGESV---  177
            WIDNP LE   ILG S+S            S+    + P       P    V  +++   
Sbjct  130  WIDNPALETPKILGASLSRQTLEVPKAVFLSMGEQQKDPYSKVTAIPPMGFVGMQAIQTS  189

Query  178  ---KLEYYYNHLFGS----------------TSLQLTEDTGEFQDLVTWDQLTKLARYSL  218
               +  Y YN+  GS                 SL      GE+QDL+ W+QLT  AR +L
Sbjct  190  RISRFRYTYNYTGGSDISTRVSQGYPDNSAWISLTFAGTDGEYQDLIMWNQLTDQARAAL  249

Query  219  NNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             + D+ E        K+P  D  F+  L +AWPF
Sbjct  250  ESADFGED------TKVPFNDKNFEAALAQAWPF  277

>PHYCA_124462
Length=280

 Score = 175 bits (443),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/272 (38%), Positives = 138/272 (51%), Gaps = 57/272 (21%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             IGH+QV+PF +PEPVT S+KAAVKYKP L I +GC  +PAV   G I+GGLK  G +D 
Sbjct  25   TIGHDQVKPFPQPEPVTISEKAAVKYKPLLSIGNGCVSFPAVNAAGEITGGLK--GTKDT  82

Query  82   E-CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            E CT + LG+Q+Y RS W  D WA+MY+WYFPK      A         RH+W   ++WI
Sbjct  83   EDCTEAPLGTQVYGRSTWFQDKWAMMYSWYFPKNFCGHKA-------ADRHDWANVVIWI  135

Query  141  DNPELENSTILGVSISA-----------SISYASETPPEANH-------------VDGES  176
            DNP LEN+T LG S+S            +++   E P +                V G  
Sbjct  136  DNPALENATFLGASLSQQTLEPKKFVFLTVAKRKEEPYQKQKAIPMMAFAGTEQIVTGRV  195

Query  177  VKLEYYYNHLFGSTS----------------LQLTEDTGEFQDLVTWDQLTKLARYSLNN  220
             +  Y Y ++ GS +                +      GE QDL+ W+QLT  AR +L +
Sbjct  196  SRHSYTYKYVGGSNTTMRFIHKYPEKSAWIGMSFANSDGESQDLIMWNQLTDKARAALES  255

Query  221  TDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             D+  T       ++P  D  F+  L  AWPF
Sbjct  256  ADFGNT-------QVPFTDKNFETNLQAAWPF  280

>PHYRA_83851
Length=239

 Score = 173 bits (438),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 136/235 (58%), Gaps = 22/235 (9%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P+PVT S+KA VK+KPQL  E GC  YPAV   G  SGGLK +G   G 
Sbjct  22   IAHDEVQPFPQPDPVTISEKAGVKFKPQLHFEGGCAAYPAVNAAGETSGGLKGNGDISG-  80

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGH-RHNWEYAIVWI  140
            C  S LGSQ+Y RS+W NDVWAIMYAWYFPKG   A P         H RH+W  A++WI
Sbjct  81   CEISLLGSQVYGRSEWYNDVWAIMYAWYFPKGFWDADP---------HWRHDWSNAVLWI  131

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG-  199
            DNP LEN  ILG+S+S S +        +  ++  +  L      +  S +L  ++  G 
Sbjct  132  DNPALENPKILGLSLSTSENKYHTKNTYSPTINSTAPALCRDLPSV-ASAALVSSDVCGR  190

Query  200  --EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
              E QDL+ W QLT  AR +LN+ D      N    ++P+ D  F + L +AWP 
Sbjct  191  PLETQDLIMWGQLTDAARAALNDQD------NFGRTEVPISDDHFPKHLEEAWPL  239

>PHYSO_521124
Length=254

 Score = 173 bits (438),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 134/242 (55%), Gaps = 25/242 (10%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI +++V+PF E EP T S+KAA+KYKP L I DGCH Y AV   G  SGG+    P  G
Sbjct  10   VIDYDKVQPFPELEPKTISEKAAIKYKPSLAIWDGCHSYAAVNAAGDTSGGMDPKAPDGG  69

Query  82   E---------CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRG--AVPAPLILRLFGHR  130
                      C GS LGSQ+Y+RS W  DVWAIMYAWYFP+        +P +      R
Sbjct  70   TQVQNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEESSPPV------R  123

Query  131  HNWEYAIVWIDNPELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYNHLFGS  189
            H+W   IVW+DNP LEN ++LGVS S     Y +  P    +++G   K+EYY   + G 
Sbjct  124  HDWINTIVWLDNPALENPSLLGVSASREGAVYVTYPPTVKGYMNGTHPKMEYYLGFIVGG  183

Query  190  -TSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNK  248
              ++ ++ + G+FQDLV W QLT  AR +L   D+           +P  D  F++ L +
Sbjct  184  YHTIDVSLEAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNFEKNLER  237

Query  249  AW  250
             W
Sbjct  238  GW  239

>PPTG_18463
Length=254

 Score = 172 bits (437),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 137/250 (55%), Gaps = 35/250 (14%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I  + V+PF +P PVT S+KAA+K+KPQL I DGC  +PAV   G  +GGL  +G Q G
Sbjct  21   TINRDLVQPFAQPGPVTISEKAAIKFKPQLFILDGCVSFPAVNAAGDTTGGL--NGTQGG  78

Query  82   E-CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            E C+ + LGSQ+Y RS W  D WA+M+AWY PK   A        +   RH+W   +VWI
Sbjct  79   EGCSKAPLGSQVYGRSTWYQDKWAMMFAWYIPKSYMAA-------ITSRRHDWASMVVWI  131

Query  141  DNPELENSTILGVSISASIS----------------YASETPPEANHVDGE--SVKLEYY  182
            +NP LE   ILGVS+S S +                Y + +      + G   S+++E+ 
Sbjct  132  ENPSLEIPEILGVSLSNSANGYLRYTGNIYDWNFSGYVARSRRRDRDIPGSSTSLRVEHT  191

Query  183  YNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEF  242
                F S  L L +  G++QDL+ W QLT+ AR +LN TD+  +       K+P  DG F
Sbjct  192  VRKDFRSAFLNLAQTDGDYQDLIMWGQLTEEARMALNTTDFGRS-------KVPFNDGNF  244

Query  243  DELLNKAWPF  252
               L +A+PF
Sbjct  245  LIKLRQAYPF  254

>PHALS_14425
Length=302

 Score = 174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 136/230 (59%), Gaps = 10/230 (4%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            +G + V PF   +  T SQK+A+ ++PQL IEDGCHPYPAVQ +GS++ GL++   +D  
Sbjct  81   LGADSVHPFPRTKARTSSQKSALMFQPQLYIEDGCHPYPAVQSNGSLNAGLEYELFRDPT  140

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS LGSQ+Y+RS W    WA +Y WYFP       +P      GHRH W +AIVW  +
Sbjct  141  CEGSPLGSQVYSRSSWYQMKWATIYTWYFPVAYDHA-SPFST---GHRHYWLWAIVWTTD  196

Query  143  PELENSTILGVSISASISYASETPPEANH-VDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            P       L VS+S +   +S T P   H V+G +V L+ + + +    +L LTE +GE 
Sbjct  197  PNPAEGHFLAVSMSGNFGISSYTLPHIKHLVNGTTVLLKSHKSLMSARLALDLTEKSGEK  256

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWP  251
            +DL+TW++LT  AR +L++    E   N      PL+D +F  LL KA+P
Sbjct  257  EDLITWEELTPEARAALSSVKRTEATAN-----SPLQDNKFFSLLEKAYP  301

>PPTG_08703
Length=254

 Score = 172 bits (437),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 135/248 (54%), Gaps = 31/248 (13%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI-EDGCHPYPAVQKDGSISGGLKWSGPQD  80
             + H+++ P  +PEPVT SQKAA+K+KPQL   E  C  +PAV   G ++GGLK +   D
Sbjct  21   TVDHDKIEPIPQPEPVTISQKAAIKFKPQLYTSEIACVSFPAVNAAGEVTGGLKGTNGND  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C  +  GSQ+Y R+ W  D+WAIMYAWYFPKG         +     RH+W+  +VWI
Sbjct  81   A-CKYAPKGSQVYGRAGWYKDLWAIMYAWYFPKG-------FWMDFPTRRHDWKNVVVWI  132

Query  141  DNPELENSTILGVSISAS-ISYASETPPEAN---------------HVDGESVKLEYYYN  184
            DNP+LE   I+GVS+S S   Y  ET   A+               ++ G +  L + Y 
Sbjct  133  DNPDLETPKIVGVSMSKSDKKYFKETKIWASNFAGYRMEGRRYHRTYIYGSNTSLRFQYQ  192

Query  185  HLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDE  244
               GS  +      GE+QDL+ W+QLT + R +LN++       N    ++P  D  F++
Sbjct  193  TTLGSPYMNFARWDGEYQDLIMWEQLTDVVRVALNDSK------NFGKAEVPFSDEHFED  246

Query  245  LLNKAWPF  252
             L+KAWP 
Sbjct  247  HLDKAWPL  254

>PHYCA_109095
Length=277

 Score = 172 bits (437),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 139/271 (51%), Gaps = 54/271 (20%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +IGH++V+PF +P+PVT S+KAAVKYKPQL I D C  +PAV   G I+GGLK +   D 
Sbjct  21   IIGHDKVQPFAQPDPVTISEKAAVKYKPQLVIFDSCVSFPAVNAAGDITGGLKGTSGTDA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             CT + LGSQ+Y RS W    WA+M+AWYFPK    + +         RH W   ++W+D
Sbjct  81   -CTKAPLGSQVYGRSTWYQGKWAMMFAWYFPKNFWNLES-------RSRHLWANMVLWLD  132

Query  142  NPELENSTILGVSISASI-----------------SYASETP-PEANHVDGESV------  177
            NP LE  TILG S+S                    SY+  TP P    V  + +      
Sbjct  133  NPALETPTILGASLSRQTLEVPKWLFIPSGVQQKNSYSKATPIPPMGFVGTQQIRTARIG  192

Query  178  KLEYYYNHLFGST----------------SLQLTEDTGEFQDLVTWDQLTKLARYSLNNT  221
            + +Y YN+  GST                 L  T   G++QDL+ W+QLT  AR +L + 
Sbjct  193  RFQYTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESA  252

Query  222  DWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D+          K+P  D  F+  L +AWPF
Sbjct  253  DFGR------DTKVPFNDKNFEAALAQAWPF  277

>PHYSO_482931
Length=254

 Score = 172 bits (435),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 125/247 (51%), Gaps = 36/247 (15%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P PVT S+K AVK+KP L I + CHPYPAV   G  S GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS+LGSQ+Y R+ W   +WAIMYAWYFPK          +  FG RH W  A+VW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPKDS--------VSKFGQRHKWNAAVVWLDN  135

Query  143  PELENSTILGVS-ISASISYASET---PPEA--------------NHVDGESVKLEYYYN  184
            P +    IL VS I  +  Y   T   PP                + ++G +  L Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  185  HLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDE  244
             +            GEFQDL+ W+QLT+ AR +L   D+            P  DG F  
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAADFGA----------PFVDGAFKS  245

Query  245  LLNKAWP  251
             L+ A P
Sbjct  246  NLDSARP  252

>PHYCA_109089
Length=277

 Score = 172 bits (436),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 131/270 (49%), Gaps = 54/270 (20%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +PEPVT S+KAAVK+KPQ+ I DGC P+PAV   G +SGGL  +   DG
Sbjct  23   TINHDQVQPFAQPEPVTISEKAAVKFKPQIHITDGCVPFPAVNAAGEVSGGLNPTKYTDG  82

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             CT S +GSQ+Y R+ W  D WAIMYAWYFPK   A  A         RH W   ++W+D
Sbjct  83   -CTESPMGSQVYGRASWYRDHWAIMYAWYFPKNFRAFFA-------RGRHGWANMVLWLD  134

Query  142  NPELENSTILGVSISASISYASE-------------------TPP-------EANHVDGE  175
            NP LEN  +LG S+S     A +                    PP       E  H    
Sbjct  135  NPALENQKLLGASLSQQTLKAEKILFIPLDEREKEPYQKFNGIPPMGFVGMQEIRHTQLS  194

Query  176  SVKLEYYYN----------HL---FGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTD  222
                 Y Y           H+   F    L      GE+QDL+ W+QLT  AR  LN+ D
Sbjct  195  RWSWNYTYEGGSNVSTRVIHMMDKFDWIHLSFLGRDGEYQDLIMWEQLTDEARAGLNSAD  254

Query  223  WDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + +T         P  D  F   L KAWPF
Sbjct  255  FGDTF-------APFTDDNFKTALEKAWPF  277

>PHYRA_72430
Length=238

 Score = 171 bits (432),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 125/231 (54%), Gaps = 15/231 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I   +V P  +P P T ++K  VK+KPQL I DGC  +PAV   G  + GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C+ + LGSQ+Y RS W N  +AI+YAWYFPKG  A        +   RH+W  A+VWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWA-------NVATRRHDWASAVVWIDR  134

Query  143  PELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            P+  + +ILG+SIS A   Y ++ P  +    G + +L +      G   L  T+ TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W+QL+  AR +L+ TD+          K+P+ D  F   L KAWPF
Sbjct  195  QDLIMWEQLSSAARTALSTTDFGNA-------KVPMSDANFQTKLKKAWPF  238

>PHYRA_72306
Length=238

 Score = 171 bits (432),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 125/231 (54%), Gaps = 15/231 (6%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I   +V P  +P P T ++K  VK+KPQL I DGC  +PAV   G  + GLK        
Sbjct  22   IDCTKVAPITQPSPSTTAEKVGVKFKPQLTIRDGCVSFPAVNAAGETNAGLKEGDSGGIG  81

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C+ + LGSQ+Y RS W N  +AI+YAWYFPKG  A        +   RH+W  A+VWID 
Sbjct  82   CSSAPLGSQVYGRSAWYNGKYAILYAWYFPKGFWA-------NVATRRHDWASAVVWIDR  134

Query  143  PELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            P+  + +ILG+SIS A   Y ++ P  +    G + +L +      G   L  T+ TG  
Sbjct  135  PDAASPSILGLSISTADWVYKTQAPASSGITGGTTARLSHGLQAEKGPAYLTTTDSTGSP  194

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            QDL+ W+QL+  AR +L+ TD+          K+P+ D  F   L KAWPF
Sbjct  195  QDLIMWEQLSSAARTALSTTDFGNA-------KVPMSDANFQTKLKKAWPF  238

>PHYRA_76603
Length=239

 Score = 171 bits (432),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 133/233 (57%), Gaps = 18/233 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWSGPQD  80
            I H++V+PF +P+PVT ++K+ VK+KP+L I  E GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCVSYPAVNSAGETSGGLKGTKGTS  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG          R    RH+W  A+VWI
Sbjct  82   A-CTGPILGSQVYGRAEWYNDVWAIMYAWYFPKG-------FWDRRAYWRHDWSNAVVWI  133

Query  141  DNPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+P LEN  +LG+S+S S + Y  +  P     +G +  L Y     +    L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPYYASG  192

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+ W QLT  AR +LN+        N    ++P+ D  F + L KAWP 
Sbjct  193  EVQDLIMWGQLTDAARAALNDQG------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYSO_254223
Length=227

 Score = 170 bits (431),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 133/234 (57%), Gaps = 41/234 (18%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H+QV+ F +PEPVT  +K AVKYKPQL I +GCHPYPAVQ D                
Sbjct  24   IDHDQVQSFPQPEPVTDFEKFAVKYKPQLHISNGCHPYPAVQAD----------------  67

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
                     +Y+RS W    W IMYAWYFPKGR            GHRH WE  +VW+DN
Sbjct  68   ---------VYSRSDWYRGKWTIMYAWYFPKGRACKDDFKT----GHRHFWEDVVVWVDN  114

Query  143  PELENSTILGVSISASISYASETPPEANHV-DGESVKLEYYYNHLFGSTSLQLTEDTGEF  201
            P  +NST+LGV + A   +    P +  ++ DG++VK   Y +   G+  + LTED GE 
Sbjct  115  PNPDNSTLLGVPMYAGHRHIKVVPVDEKYLKDGKTVKFGSYKS--LGAQVVGLTEDYGEI  172

Query  202  QDLVTWDQLTKLARYSLNNTDWDETLFNLAG----LKMPLKDGEFDELLNKAWP  251
            QDL+TW+QLT  AR +L+     E  F++ G    + +P+KDG+F++ L  A+P
Sbjct  173  QDLITWEQLTVEARTALS-----EANFHVDGGVREVVVPIKDGQFEKTLESAYP  221

>PHALS_14423
Length=379

 Score = 174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 139/235 (59%), Gaps = 17/235 (7%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            +  N+V+PF + +P T SQK+A+KY+P+L +   C+PYPAVQ DGS+S GL W       
Sbjct  157  VNVNEVQPFKQRKPTTDSQKSAIKYQPRLYVLGACYPYPAVQADGSLSEGLPWKIFFQSR  216

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS  GSQIY+RS W    WAIMYAWY P+         I  + GH H W + +VW D+
Sbjct  217  CNGSPRGSQIYSRSDWYRGKWAIMYAWYLPRALDQN----IWDVDGHSHFWTFVVVWTDS  272

Query  143  PELENSTILGVSISASISYASETPPEANH--VDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            P+ + STIL  S S   +   +  P  +   ++ +S+K++ + NH +  T L+LTE  GE
Sbjct  273  PDPDVSTILAASTSGVGNRIKKYSPLKSKYLLNHKSLKVKLHENHFWDKTGLKLTEKVGE  332

Query  201  FQDLVTWDQLTKLARYSLNN---TDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             Q L+TW+QLT  AR +L++   +DW         ++ P++D  F  +L+ A+PF
Sbjct  333  LQTLITWEQLTDEARAALSSVHYSDWR--------MESPIQDKWFRPMLSSAYPF  379

>PHYCA_544885
Length=256

 Score = 171 bits (432),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 140/249 (56%), Gaps = 31/249 (12%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI-EDGCHPYPAVQKDGSISGGLKWSGPQD  80
             + H+Q+ PF +PEPVT S+KAA+K+KPQL   +  C P+PAV   G ++GGLK +   D
Sbjct  21   TVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKIVCVPFPAVNAAGEVTGGLKGTNGND  80

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C  +  G+QIY R+ W  D+WAIMY+WYFPKG G   +P        RH+W+  +VWI
Sbjct  81   G-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT------RRHDWKNVVVWI  133

Query  141  DNPELENSTILGVSISAS-ISYASETPPEANHVDGESV--KLEYYYNHLFGSTSLQLTED  197
            DNP+LE   I+GV++S S   Y+ E     ++  G     +      +L  +TSL+   D
Sbjct  134  DNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFEYD  193

Query  198  T--------------GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFD  243
            T              GE+QDL+ W+QLT  AR +LN+        +    ++P  D  ++
Sbjct  194  TSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALNDGK------SFGKAEVPFNDEHYE  247

Query  244  ELLNKAWPF  252
            + L KAWPF
Sbjct  248  DHLGKAWPF  256

>PHYCA_124383
Length=280

 Score = 171 bits (433),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 132/271 (49%), Gaps = 55/271 (20%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +PEPVT S+KAAVKYKP L I DGC  +PAV   G I+GGLK       
Sbjct  25   TIDHDQVKPFRQPEPVTISEKAAVKYKPLLSIGDGCVSFPAVNTAGEITGGLK-GTKNTK  83

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
            +CT + LGSQ+Y RS W  D WA+MY WYFPK   A  A         RH+W   +VWID
Sbjct  84   DCTEAPLGSQVYGRSAWYQDKWAMMYTWYFPKNFCAYKA-------AGRHDWANVVVWID  136

Query  142  NPELENSTILGVSISA-----------SISYASETPPEAN--------------------  170
            NP LEN+T LG S+S            +++   E P E                      
Sbjct  137  NPALENATFLGASLSQQTLEPIKLVFLALAQRKEEPYENQKEIPMMAFAGTEQIATAMVG  196

Query  171  -------HVDGESVKLEYY--YNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNT  221
                   +V G +  + +   Y   F    +      GE QDL+ W+QLT  AR +L + 
Sbjct  197  RWSYIYKYVGGSNTTMRFIHKYPQKFAWIGMSFAYSDGESQDLIMWNQLTDKARAALESA  256

Query  222  DWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D+  T       ++P  D  F+  L  AWPF
Sbjct  257  DFGNT-------QVPFTDKNFETNLQAAWPF  280

>PITG_23076
Length=276

 Score = 171 bits (432),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/271 (40%), Positives = 141/271 (52%), Gaps = 55/271 (20%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H++V+PF +P+PVT S+KAAVK+KPQL I+ GC  +P V   G ISGGLK +   DG
Sbjct  21   AIDHDKVQPFAQPDPVTISEKAAVKFKPQLHIDRGCVSFPVVNAAGEISGGLKGTKGTDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C  S LGSQ Y+RS W  D WAI++AWYFPKG  A   P I      RH W   ++WID
Sbjct  81   -CRESPLGSQTYSRSAWYQDRWAIVFAWYFPKGFAA-GQPRI------RHYWSSMVLWID  132

Query  142  NPELENSTILGVSISASI-----------------SYASET--PPE--------------  168
            NP L+  TILGVS+S  +                  Y  +T  PP               
Sbjct  133  NPALDTPTILGVSLSQQLLKPAKFLIGLFTAELQEPYNKQTSIPPAGFVGAQATVVSQIN  192

Query  169  -----ANHVDGESVKLEYYYNHLFGSTSLQLTEDT--GEFQDLVTWDQLTKLARYSLNNT  221
                 +N+  G +V +   + +      L LT  T  GE+ DLVTWDQLT+ AR +LN+ 
Sbjct  193  GWSNPSNYSGGSNVSIRVSHTYTNKDDWLALTFATQDGEYHDLVTWDQLTEEARAALNSA  252

Query  222  DWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D+ E+       K+P  D  F   L  +W F
Sbjct  253  DFGES-------KVPFSDQNFQRTLELSWLF  276

>PHYSO_514298
Length=264

 Score = 170 bits (430),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 134/242 (55%), Gaps = 25/242 (10%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI +++V+PF E EP T S+KAA+KYKP L I+DGC  Y AV   G  SGG+    P  G
Sbjct  21   VIDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAPDGG  80

Query  82   E---------CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPA--PLILRLFGHR  130
                      C GS LGSQ+Y+RS W  DVWAIMYAWYFP+      A  P +      R
Sbjct  81   TVEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWYEASYPPV------R  134

Query  131  HNWEYAIVWIDNPELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYN-HLFG  188
            H+W   IVW++NP LEN ++LGVS S     Y +  P     ++G   K+EY+   ++ G
Sbjct  135  HDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVGG  194

Query  189  STSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNK  248
              ++ ++ D G+FQDLV W QLT  AR +L   D+           +P  D  F++ L +
Sbjct  195  YHTIDVSLDAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNFEKNLER  248

Query  249  AW  250
             W
Sbjct  249  GW  250

>PHYRA_72541
Length=239

 Score = 169 bits (428),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 133/233 (57%), Gaps = 18/233 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKI--EDGCHPYPAVQKDGSISGGLKWSGPQD  80
            I H++V+PF +P+PVT ++K+ VK+KP+L I  E GC  YPAV   G  SGGLK +    
Sbjct  22   IDHDKVQPFPQPDPVTITEKSGVKFKPELHIDTEHGCASYPAVNSAGETSGGLKGTKGTS  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              CTG  LGSQ+Y R++W NDVWAIMYAWYFPKG     A         RH+W  A+VWI
Sbjct  82   A-CTGPILGSQVYGRAEWHNDVWAIMYAWYFPKGFWDSRAYW-------RHDWSNAVVWI  133

Query  141  DNPELENSTILGVSISASIS-YASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            D+P LEN  +LG+S+S S + Y  +  P     +G +  L Y     +    L     +G
Sbjct  134  DDPALENPKVLGLSLSTSENKYGHKYVPAEALRNGTTPSL-YRMMPTYKCAELVPYYASG  192

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            E QDL+ W QLT  AR +LN+        N    ++P+ D  F + L KAWP 
Sbjct  193  EVQDLIMWGQLTDAARAALNDQG------NFGRTEVPINDDHFLKHLEKAWPL  239

>PHYCA_109192
Length=278

 Score = 170 bits (431),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 135/276 (49%), Gaps = 63/276 (23%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H++V+PF +P+PVT S+KAAVKYKPQL I  GC  +PAV   G I+GGLK +   DG
Sbjct  21   TIDHDKVQPFKQPDPVTVSEKAAVKYKPQLVIGSGCVSFPAVNAAGDITGGLKGTKSTDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK----GRGAVPAPLILRLFGHRHNWEYAI  137
             CT + LGSQ+Y RS W  D WA+M+AWYFPK    G G             RH W   +
Sbjct  81   -CTEAPLGSQVYGRSTWYQDKWAMMFAWYFPKNFWGGEGE-----------SRHLWSNMV  128

Query  138  VWIDNPELENSTILGVSIS------------------ASISYASETPPEANHVDGESV--  177
            VWIDNP LE   ILG S+S                    + Y   T  +  H  G     
Sbjct  129  VWIDNPALETPKILGASLSRQTLDPPKALFLFSLADRQKVPYKKVTGIDPMHFVGMQAIQ  188

Query  178  -----KLEYYYNHLFGSTS----------------LQLTEDTGEFQDLVTWDQLTKLARY  216
                 +  Y YN+  GS +                L+     GE+QDL+ W+QLT  AR 
Sbjct  189  TGRIGRYRYTYNYTGGSNTSTRVYHGFPDSSAWIGLEFVNVNGEYQDLIMWNQLTDQARA  248

Query  217  SLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            +L + D+ E        K+P  D  F+  L +AWPF
Sbjct  249  TLESADFGEK------TKVPFNDKNFEAALAQAWPF  278

>PHYSO_328418
Length=219

 Score = 168 bits (426),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 123/228 (54%), Gaps = 26/228 (11%)

Query  26   NQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTG  85
             QV+  LEP      QKAAVK+KPQLK+ + CHPY AV   G ISGGL         C G
Sbjct  17   TQVQSALEP-----GQKAAVKFKPQLKLSNTCHPYAAVDAHGYISGGLNSELHIRNNCGG  71

Query  86   SKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPEL  145
            S LG+QIYARS W +DVWA +YAWYFPK       P        R  W YAI+W+  P +
Sbjct  72   SDLGAQIYARSAWHSDVWATVYAWYFPKNSNNGGGP--------RSLWMYAIIWVGGPGV  123

Query  146  ENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLV  205
                ++G ++          P +A+++DG S + ++ YN       L  T+ TG +QDL+
Sbjct  124  GAPEVVGATLKTDDDTEKHAPVDADYIDGTSFECKFTYNFWTTKAKLTATKKTGGYQDLI  183

Query  206  TWDQLTKLARYSLNNTDWDETLFNLAGLK-MPLKDGEFDELLNKAWPF  252
            TW+QL ++AR              LAG   MPL +G F+ELL   WPF
Sbjct  184  TWEQLPEVART------------GLAGYADMPLLNGTFEELLTNGWPF  219

>PITG_23051
Length=280

 Score = 169 bits (429),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 132/244 (54%), Gaps = 33/244 (14%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLK-WSGPQD  80
            + H++V PF +PEPVT S+KAA+K+K QL I  G C  YPAV   G + GGL  W    D
Sbjct  22   VDHDKVEPFPQPEPVTISEKAAIKFKTQLVIPQGVCVSYPAVNAAGEVGGGLNDWDNGND  81

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
              C  + LGSQ+Y R+ W  D WAIMYAWYFPK               HRH+W+  +VWI
Sbjct  82   A-CLSAALGSQVYGRAGWHKDRWAIMYAWYFPKD-------FWTGFPTHRHDWKSVVVWI  133

Query  141  DNPELENSTILGVSISASI-----------SYASETPPEANHVDGESVKLEYYYNHLFGS  189
            DNP LE   I GVS+S S            SY S  P      +G +  L + Y   FGS
Sbjct  134  DNPALEIPKIEGVSMSKSDTKYKKKLKLKESYFSGAP-----TNGSNTSLRFEYEAGFGS  188

Query  190  TSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAG-LKMPLKDGEFDELLNK  248
            T +  T   GE+Q+L+ W+QLT  AR +LN+ +      N      +P  D  F++ L++
Sbjct  189  TFMGFTRWDGEYQNLIMWEQLTDAARATLNDGN------NFGKEASVPFSDEHFEDRLDE  242

Query  249  AWPF  252
            AWPF
Sbjct  243  AWPF  246

>PPTG_13004
Length=255

 Score = 169 bits (427),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 138/245 (56%), Gaps = 36/245 (15%)

Query  28   VRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSK  87
            V+PF +PEPVT  +K A+K+KP L I+ GC  +PAV + G+IS GL+     DG C  + 
Sbjct  27   VKPFAQPEPVTVLEKVALKFKPTLLIDGGCVSFPAVNEAGAISSGLRPLNGNDG-CIKAP  85

Query  88   LGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWIDNPELE  146
             GSQ+Y RS    D WAIM+AWYFPKG    +P+         RH+W   +VWID+P+ E
Sbjct  86   QGSQVYGRSTQFQDKWAIMFAWYFPKGFWSGMPS--------RRHDWASMVVWIDDPDFE  137

Query  147  NSTILGVSISASIS-YASETPPEA----------------NHVDGE--SVKLEYYYNHLF  187
               +LGVS+S S   Y   T P +                 +V+G   S+++ +     F
Sbjct  138  TPKLLGVSLSKSKKRYTKATAPLSEVYFAGFQEYGRRGYKTYVNGSSTSIRISHSSGFFF  197

Query  188  GSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLN  247
            G  SL L+   G++QDL+ W QLT+ AR +LN+ ++ +++       +P  D  F+++L 
Sbjct  198  GPASLDLSTRDGDYQDLIMWKQLTEEARKALNSANFGKSV-------VPFNDDNFEDMLE  250

Query  248  KAWPF  252
            KAWPF
Sbjct  251  KAWPF  255

>PHYSO_480321
Length=254

 Score = 168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 124/247 (50%), Gaps = 36/247 (15%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGE  82
            I H++V+PF +P PVT S+K AVK+KP L I + CHPYPAV   G  S GLK  G  + +
Sbjct  24   IVHDKVQPFAQPAPVTISEKVAVKFKPSLAIRETCHPYPAVNAAGETSRGLKGEGKPESK  83

Query  83   CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDN  142
            C GS+LGSQ+Y R+ W   +WAIMYAWYFPK          +  FG RH W  A+VW+DN
Sbjct  84   CRGSELGSQVYGRATWHKGMWAIMYAWYFPKDS--------VSKFGQRHKWNAAVVWLDN  135

Query  143  PELENSTILGVS-ISASISYASET---PPEA--------------NHVDGESVKLEYYYN  184
            P +    IL VS I  +  Y   T   PP                + ++G +  L Y   
Sbjct  136  PAIVKPEILAVSAIGVNGVYDIRTISGPPRCYKTRSSEWCEPALVDCINGTTPMLRYIPG  195

Query  185  HLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDE  244
             +            GEFQDL+ W+QLT+ AR +L   D+            P  D  F  
Sbjct  196  KIASGLMTTTNRGRGEFQDLIMWEQLTEAARSALTAADFGA----------PFVDEAFKS  245

Query  245  LLNKAWP  251
             L+ A P
Sbjct  246  NLDSARP  252

>PHYCA_10570
Length=278

 Score = 169 bits (428),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/275 (39%), Positives = 138/275 (50%), Gaps = 61/275 (22%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H++V+PF +P+PVT S+KAA+KYKPQL I  GC  +PAV   G I+GGLK +   DG
Sbjct  21   TIDHDKVQPFKQPDPVTVSEKAALKYKPQLVIGGGCVSFPAVNAAGDITGGLKGTKSTDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPAPLILRLFGHRHNWEYAIV  138
             CT + LGSQ Y RS W  D WA+M+AWYFPK   G GA            RH W   +V
Sbjct  81   -CTEAPLGSQAYGRSTWYQDKWAMMFAWYFPKNFWGGGA----------DSRHLWSNMVV  129

Query  139  WIDNPELENSTILGVSIS------------------ASISYASETPPEANHVDG-ESVKL  179
            WIDNP LE   ILGVS+S                    + Y   T  +     G +++K 
Sbjct  130  WIDNPSLETPKILGVSLSQQTIDVPKLFYMFPLVNRQKVPYKKVTAIKPMDFAGMQAIKT  189

Query  180  ------EYYYNHLFGSTS----------------LQLTEDTGEFQDLVTWDQLTKLARYS  217
                   Y YN+  GST+                L      GE+QDL+ W+QLT  AR +
Sbjct  190  GRIGRHRYTYNYTGGSTTSTRVYNGYTDQSGWHGLDFVNADGEYQDLIMWNQLTDQARSA  249

Query  218  LNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            L + D+ E        K+P  D  F+  L +AWPF
Sbjct  250  LESADFGEK------TKVPFDDKNFEAALTQAWPF  278

>PHYSO_253029
Length=252

 Score = 168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 128/233 (55%), Gaps = 18/233 (8%)

Query  23   IGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDG-CHPYPAVQKDGSISGGLKWSGPQDG  81
            I  N+V PF +P   T +QKAAVK+KP+L I  G C  +PAV   G  S GL   G    
Sbjct  22   IDLNKVAPFAQPTASTSAQKAAVKFKPRLSIGSGACVSFPAVNSAGDTSSGLSEEGKGST  81

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWI  140
            +CT + LGSQ+Y R+ W N  +AI+YAWYFPKG     P          RH+W  A+VWI
Sbjct  82   DCTNAPLGSQVYGRAAWYNTRFAILYAWYFPKGFWNDYPT--------RRHDWASAVVWI  133

Query  141  DNPELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTG  199
            DNP+     ILG+S+S A   Y+++ P  +   DG + KL +  +   G   L  T+ +G
Sbjct  134  DNPDSNTPKILGLSLSTADWEYSTQAPATSGISDGTTPKLSHELSVECGDPYLTTTDGSG  193

Query  200  EFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            +FQ L+ W+QLT  AR +LN+ D           K+P  D  F+  L  AWPF
Sbjct  194  DFQPLIMWEQLTTAARTALNSAD-------FGNAKVPTSDVNFEMKLKSAWPF  239

>PHYSO_246397
Length=264

 Score = 168 bits (425),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 134/243 (55%), Gaps = 27/243 (11%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            VI +++V+PF E EP T S+KAA+KYKP L I+DGC  Y AV   G  SGG+    P  G
Sbjct  21   VIDYDKVQPFPELEPKTISEKAAIKYKPSLAIKDGCRSYAAVNAAGDTSGGMDPMAPDGG  80

Query  82   E---------CTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRG---AVPAPLILRLFGH  129
                      C GS LGSQ+Y+RS W  DVWAIMYAWYFP+      A   P+       
Sbjct  81   TVEKNPYGHGCRGSVLGSQVYSRSGWYRDVWAIMYAWYFPRDISWDEASYPPV-------  133

Query  130  RHNWEYAIVWIDNPELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYN-HLF  187
            RH+W   IVW++NP LEN ++LGVS S     Y +  P     ++G   K+EY+   ++ 
Sbjct  134  RHDWINTIVWLNNPALENPSLLGVSASREDAEYVAYPPTVKEFMNGTHPKMEYFMGFYVG  193

Query  188  GSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLN  247
            G  ++ ++ + G+FQDLV W QLT  AR +L   D+           +P  D  F++ L 
Sbjct  194  GYHTIDVSLEAGDFQDLVHWSQLTDQARKALETADFGVV------TPVPFNDVNFEKNLE  247

Query  248  KAW  250
            + W
Sbjct  248  RGW  250

>PHYCA_114913
Length=224

 Score = 167 bits (422),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 124/227 (55%), Gaps = 26/227 (11%)

Query  26   NQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTG  85
            ++V PF E EP T SQKAAV+ KPQL I  GCHPY AV   G I+ G+  +  +D +C+G
Sbjct  21   DKVEPFPELEPTTISQKAAVRLKPQLHISKGCHPYAAVNAAGEITAGI--TTTRDPDCSG  78

Query  86   SKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPEL  145
              +GSQ+Y RS W  DVWAIMYAWYF       P+ LI       H+W+  +VWIDNP L
Sbjct  79   RGIGSQVYVRSTWYKDVWAIMYAWYF-------PSSLI-------HDWKNIVVWIDNPSL  124

Query  146  ENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLV  205
                +LGVS      Y        +  DG S K++Y Y        L  T   GEFQ+L+
Sbjct  125  AVPRVLGVSAQVDGGYLRYNKFNWDKFDGASPKIKYDY------PDLDWTSKRGEFQNLI  178

Query  206  TWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             WDQLT+ AR +LNNT++           +P  D  F   L+ A P+
Sbjct  179  MWDQLTEAARTALNNTNFKGN----GDATVPFIDANFKANLDFAIPY  221

>PHYCA_108964
Length=277

 Score = 168 bits (426),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/271 (38%), Positives = 138/271 (51%), Gaps = 54/271 (20%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
            +I H++V+PF +PEPVT S+KAAVKYKPQL I D C  +PAV   G I+GGLK +   + 
Sbjct  21   IIDHDKVQPFAQPEPVTISEKAAVKYKPQLVIFDSCVSFPAVNAVGDITGGLKGTSGTNA  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             CT + LGSQ+Y RS W    WA+M+AWYFPK    + +         RH W   ++W+D
Sbjct  81   -CTEAPLGSQVYGRSTWYQGKWAMMFAWYFPKNFWNLES-------RSRHLWANMVLWLD  132

Query  142  NPELENSTILGVSISASI-----------------SYASETP-PEANHVDGESV------  177
            NP LE  TILG S+S                    SY+  TP P    V  + +      
Sbjct  133  NPALETPTILGASLSRQTLEVPKWLFIPSGVQQKDSYSKATPIPPMGFVGTQQIRTARIG  192

Query  178  KLEYYYNHLFGST----------------SLQLTEDTGEFQDLVTWDQLTKLARYSLNNT  221
            + +Y YN+  GST                 L  T   G++QDL+ W+QLT  AR +L + 
Sbjct  193  RFQYTYNYTGGSTISTRVSQSYPDTSGWVGLDFTYLDGQYQDLIMWNQLTDQARAALESA  252

Query  222  DWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            D+          K+P  D  F+  L +AWPF
Sbjct  253  DFGR------DTKVPFNDKNFEAALAQAWPF  277

>PPTG_15262
Length=233

 Score = 167 bits (422),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 128/232 (55%), Gaps = 21/232 (9%)

Query  21   QVIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQD  80
            +V+ ++ + PF +P PVT ++K AV++KPQ+    GC+PYP V  DG+    L  SGP  
Sbjct  18   KVVRYDDIVPFAQPVPVTITEKRAVEFKPQVHTNGGCYPYPVVDTDGNTGDCLASSGPDS  77

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPK---GRGAVPAPLILRLFGHRHNWEYAI  137
              C G  +GSQ+Y R+K   D WAIMYAWY PK   G G             RH W   I
Sbjct  78   KSCNGPSVGSQVYGRAKRFTDKWAIMYAWYLPKISNGWG----------IESRHLWLETI  127

Query  138  VWIDNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTED  197
            VW+D+  LE+ TIL V+      Y    P  A+ ++G SVKL+      +G   L +T  
Sbjct  128  VWLDSFVLESPTILAVTTWHQGKYQKYLPSLADTLNGTSVKLDCTNTLEYGYM-LDVTNR  186

Query  198  TGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKA  249
             GE QDL+ W+QLT  AR +L  TD++       GL  P+ DG F+ELL KA
Sbjct  187  IGETQDLIMWNQLTDAARSALQWTDFN-------GLSAPISDGRFEELLEKA  231

>PHYRA_47103
Length=226

 Score = 166 bits (420),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 124/222 (56%), Gaps = 17/222 (8%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             IGH++V+PF +PE VT ++K+ VK+KPQL IE GC PYPA    G  S GL+ +G  D 
Sbjct  21   AIGHDKVQPFPQPEAVTITEKSGVKFKPQLDIEXGCSPYPAANAAGETSEGLETNGAFD-  79

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGR-GAVPAPLILRLFGHRHNWEYAIVWI  140
             C    LGSQ+Y R++W NDVWAIMYAWYFPKG     P          RH+W  A+VWI
Sbjct  80   -CIIPSLGSQVYGRAEWYNDVWAIMYAWYFPKGFWDGTP--------WWRHDWSNAVVWI  130

Query  141  DNPELENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            DNP  E   +LG+S+S S +    T   A  ++  +            S +L    + GE
Sbjct  131  DNPAHEKPKVLGLSLSTSENKYGNTYVPAEGIENGTTPTLSRNVLPMRSAALGPAVNPGE  190

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEF  242
            FQDLV W QLT  AR +LN+ D      N    ++P+ D  F
Sbjct  191  FQDLVMWTQLTDAARAALNDQD------NFGRTEVPISDDHF  226

>PHALS_12600
Length=267

 Score = 167 bits (423),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 138/229 (60%), Gaps = 11/229 (5%)

Query  26   NQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTG  85
            ++V+PF + +P T SQ++A+KYKP+L +++GCHPYP VQ++GS+S G++W       C G
Sbjct  48   DEVQPFYQRKPTTISQESAIKYKPRLYVDEGCHPYPVVQENGSLSEGMQWKNYFRPSCEG  107

Query  86   SKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPEL  145
            S  GSQIY+RS W    WA++Y WY P    +        + GHRH W + ++W D+P+ 
Sbjct  108  SPRGSQIYSRSDWYQGKWAMLYTWYLPMALDST----AWFVDGHRHFWLWVVIWTDSPDP  163

Query  146  ENSTILGVSISASISYASETPPEANH--VDGESVKLEYYYNHLFGSTSLQLTEDTGEFQD  203
            ++STIL  S+S       +  P  +   +  +++K++   + +     L+LT+  GEFQD
Sbjct  164  DDSTILAASMSGFGDEIKKYAPLKSKYLIHDKTLKVKSTESRIRKKHGLELTKRVGEFQD  223

Query  204  LVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            L+TW+QL+  AR +L+N    E   N      P++D  F E+L K++PF
Sbjct  224  LITWEQLSDEARAALSNFHRLEKRAN-----PPIQDKLFYEVLEKSYPF  267

>PHALS_13512
Length=243

 Score = 166 bits (420),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 133/228 (58%), Gaps = 17/228 (7%)

Query  30   PFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECTGSKLG  89
            PF +P P T SQK+A+KY+P+L +   C+PYPAVQ +GS+S GL W      +C GS  G
Sbjct  28   PFKQPTPTTDSQKSAIKYQPRLYVVSDCYPYPAVQANGSLSYGLPWEVFAPTKCNGSPYG  87

Query  90   SQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPELENST  149
            SQIY+RS W   +WAIMYAWY P+            + GHRH W + +VW ++P+   ST
Sbjct  88   SQIYSRSDWYRGMWAIMYAWYLPRALDHSS----WLVDGHRHFWTFVVVWTNSPDPNVST  143

Query  150  ILGVSISASISYASETPPEANH--VDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTW  207
            IL  S S + +   +  P  +   +D  ++K++ Y N+    T L+LT+  G+ Q L+TW
Sbjct  144  ILAASTSGTDNRIKKYLPVKSKYLLDRRTLKVKLYQNYWLDKTGLKLTDKVGDLQPLITW  203

Query  208  DQLTKLARYSLNN---TDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            +QLT  AR +L++    DW         ++ P++D  F  +L+ A+PF
Sbjct  204  EQLTDEARAALSSFHYPDWR--------METPIQDKWFRYMLSSAYPF  243

>HYAP_04977
Length=262

 Score = 166 bits (421),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 129/226 (57%), Gaps = 15/226 (7%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H+Q++P+ +PE  T ++KAA +YKP L    GC+PYPAV  +G  +GGLK +G    +C 
Sbjct  30   HDQIKPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKATGGSRSKCG  89

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
               +G Q+YAR KW ++ + I++AWYFPK         +    GHRH+WE+A +W++NPE
Sbjct  90   QPYMGGQVYARGKWCDEQFGIIFAWYFPKDS-------VRDGVGHRHDWEWATIWLNNPE  142

Query  145  LENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDL  204
               S ILGV+   S         +  + +G++VKL+Y  +       + L+ + GE Q L
Sbjct  143  ANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDHGR--RHYIALSGNDGELQPL  200

Query  205  VTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            + WDQ+T+ +R +LN   W++         MPL D  FD  L  A+
Sbjct  201  IMWDQMTEASRCALNTVGWNKHRL------MPLADTVFDNNLATAY  240

>PHYSO_516261
Length=227

 Score = 165 bits (418),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 123/232 (53%), Gaps = 26/232 (11%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+ V+PF +P PVT S+KAAVK++P L +E GC P+PAV   G  SGGLK +G   G
Sbjct  21   TIDHDAVQPFAQPNPVTVSEKAAVKFQPLLFVESGCVPFPAVNSAGETSGGLKGTGGTSG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
                   GSQ+Y R+ W  D WAIMYAWYFPKG          R     H+W   +VWID
Sbjct  81   CKEAGATGSQVYGRAVWYKDDWAIMYAWYFPKG-------FWSRWASRHHDWASIVVWID  133

Query  142  NPELENSTILGVSIS-ASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGE  200
            NP LE   ++G+S S     Y +  P   + V   + +L      LF        +  G+
Sbjct  134  NPALETPKMIGISTSEGDNDYRTAGP---DDVYETTPRLRRVLAQLF--------KILGD  182

Query  201  FQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
             Q L+ W+QLT  AR +LN TD+ +        K+P+ D  F   L KAWPF
Sbjct  183  TQPLIMWEQLTDEARITLNTTDFGKA-------KVPMSDANFQGKLEKAWPF  227

>PHYCA_69122
Length=249

 Score = 166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 138/247 (56%), Gaps = 31/247 (13%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIED-GCHPYPAVQKDGSISGGLKWSGPQD  80
             + H+Q+ PF +PEPVT S+KAA+K+KPQL      C P+PAV   G I+GGLK +   D
Sbjct  16   TVNHDQIEPFPQPEPVTVSEKAAIKFKPQLYTPKLVCVPFPAVNTAGEITGGLKGTNGND  75

Query  81   GECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWI  140
            G C  +  G+QIY R+ W  D+WAIMY+WYFPKG G   +P        RH+W+  +VWI
Sbjct  76   G-CKYAPKGAQIYGRAGWYKDLWAIMYSWYFPKGFGWFDSPT------RRHDWKNIVVWI  128

Query  141  DNPELENSTILGVSISAS-ISYASETPPEANHVDGESV--KLEYYYNHLFGSTSLQLTED  197
            DNP+LE   I+GV++S S   Y+ E     ++  G     +      +L  +TSL+   D
Sbjct  129  DNPDLETPKIVGVAMSKSDTDYSKEVKIWPSYFVGYRTEGRFSSRVEYLGSNTSLRFEYD  188

Query  198  T--------------GEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFD  243
            T              GE+QDL+ W+QLT  AR +LN    D   F  A  ++P  D  ++
Sbjct  189  TSDIGNPLMHFAAWDGEYQDLIMWEQLTDAARVALN----DGKSFEKA--EVPFSDEHYE  242

Query  244  ELLNKAW  250
            + L KAW
Sbjct  243  DHLGKAW  249

>HYAP_14846
Length=221

 Score = 164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 127/238 (53%), Gaps = 31/238 (13%)

Query  23   IGHNQVRPFLE------PEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWS  76
            I H+QV+PF +      P  V     AA+K+KPQL I  GCH YPAV   G  SGGLK +
Sbjct  4    IKHDQVQPFQQVVGDDSPTAV-----AALKFKPQLHISSGCHSYPAVNTVGEFSGGLKPT  58

Query  77   GPQDGECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYA  136
            G  +G+C GS  GSQ+Y RS W  D WAIMY WYFPK                RH+WE+ 
Sbjct  59   GHDNGKCKGSGYGSQVYGRSAWHQDKWAIMYVWYFPKDNRD----------DDRHDWEHI  108

Query  137  IVWIDNPELENSTILGVSI--SASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQL  194
            +VW+DNP + N  +L VS+       Y +   P    VDG SVKL+Y   +     +L L
Sbjct  109  VVWLDNPAVANQKLLAVSLWNGRKSDYWTLAIPGPVFVDGSSVKLDYGKANK-DERTLSL  167

Query  195  TEDTGEFQDLVTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            T   GEFQ L+ W Q+++ AR + N   W +         MPL D  F++ L KA+ F
Sbjct  168  THLAGEFQPLIMWGQMSEKARTTFNTVLWRKEF-------MPLSDSCFEQHLKKAYDF  218

>HYAP_05559
Length=262

 Score = 166 bits (420),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 129/226 (57%), Gaps = 15/226 (7%)

Query  25   HNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDGECT  84
            H+Q++P+ +PE  T ++KAA +YKP L    GC+PYPAV  +G  +GGLK +G    +C 
Sbjct  30   HDQIQPYAQPEETTVTEKAAARYKPSLHSSHGCYPYPAVDAEGRTNGGLKATGGSRSKCG  89

Query  85   GSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWIDNPE  144
               +G Q+YAR KW ++ + I++AWYFPK         +    GHRH+WE+A +W++NPE
Sbjct  90   QPYMGGQVYARGKWCDEQFGIIFAWYFPKDS-------VRDGVGHRHDWEWATIWLNNPE  142

Query  145  LENSTILGVSISASISYASETPPEANHVDGESVKLEYYYNHLFGSTSLQLTEDTGEFQDL  204
               S ILGV+   S         +  + +G++VKL+Y  +       + L+ + GE Q L
Sbjct  143  ANVSEILGVTTIGSGKPKRTNKLKRENRNGDTVKLDYRDHGR--RHYIALSGNDGELQPL  200

Query  205  VTWDQLTKLARYSLNNTDWDETLFNLAGLKMPLKDGEFDELLNKAW  250
            + WDQ+T+ +R +LN   W++         MPL D  FD  L  A+
Sbjct  201  IMWDQMTEASRCALNTVGWNKHRL------MPLADTVFDNNLATAY  240

>PPTG_05581
Length=275

 Score = 166 bits (421),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 134/270 (50%), Gaps = 54/270 (20%)

Query  22   VIGHNQVRPFLEPEPVTFSQKAAVKYKPQLKIEDGCHPYPAVQKDGSISGGLKWSGPQDG  81
             I H+QV+PF +P+PVT S+KAAVKY+PQL ++DGC  +PAV   G I+GGLK +   DG
Sbjct  21   TINHDQVQPFAQPDPVTISEKAAVKYRPQLHVKDGCASFPAVNAAGDITGGLKPTKETDG  80

Query  82   ECTGSKLGSQIYARSKWVNDVWAIMYAWYFPKGRGAVPAPLILRLFGHRHNWEYAIVWID  141
             C  + LGSQ+Y RSKW  D WA+M+AWYFPKG        I      RH W   ++W+D
Sbjct  81   -CAEAPLGSQMYGRSKWYQDRWAMMFAWYFPKG-------FITSQPRIRHYWMSMVLWLD  132

Query  142  NPELENSTILGVSISASI------------------SYASETPP---------EANHVDG  174
            NP LE   +LG S+S  +                     +  PP           N +  
Sbjct  133  NPALETPKVLGASLSQQLLKPRRWMGFNMAGDKDPYQKFTSVPPIGFVGTQEIRQNRITR  192

Query  175  E------------SVKLEYYYNHLFGSTSLQLTEDTGEFQDLVTWDQLTKLARYSLNNTD  222
                         S ++       FG   L  +   G++ DL+ W+QLT  AR +LN+ D
Sbjct  193  TRWNFTYEGGSNISTRVSTIMVDSFGWLPLTFSYRDGQYHDLIMWEQLTDEARAALNSAD  252

Query  223  WDETLFNLAGLKMPLKDGEFDELLNKAWPF  252
            + E+       K+P  D  F+  L  AWPF
Sbjct  253  FGES-------KVPFNDENFETSLGLAWPF  275

Lambda      K        H        a         alpha
   0.317    0.135    0.432    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13825374792

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40