Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_184521475385685644380.0
PHYCA_5561601475364964228770.0
PHYKE_83911475377864027710.0
PHALS_064811475364462125220.0
HYAP_070951475361360525170.0
PHYSO_3489011475352648124210.0
PHYRA_508551475348947923690.0
PYIR_134521475364562523170.0
PYAP_177619907562262023010.0
PYIW_199721475360962221930.0
PYAR_135699907549447919950.0
PYVX_181701475351055719580.0
H310_085901475364062819260.0
H257_084361475364262919090.0
SPRG_141031475362862918170.0
SDRG_167201475362862918090.0
SPRG_0407412408750949910831e-137
SDRG_1440812408752849910753e-136
PPTG_17123147532012019372e-120
PHYCA_537323449662001809013e-115
PHYRA_81105534612011798727e-111
PHYSO_353401534611461467123e-88
HYAP_07096534612512167155e-87
PYVX_18173449665001777043e-82
PYAP_21882109045024856614e-76
SDRG_038221356704944766562e-75
SDRG_150451241574944766544e-75
SDRG_111311368074944766535e-75
PHALS_08068109044974876537e-75
PHYSO_254571109044894876473e-74
PYAR_17512109045335086443e-73
PYIR_17506109045094916371e-72
H257_09722114285184856372e-72
SDRG_03823114284974776318e-72
PYAP_234351008029514776551e-71
PPTG_18033109045004896273e-71
PHYKE_103271090612004876569e-71
H310_144471462305014796194e-70
PPTG_09787114284934776185e-70
SPRG_11769109044534766112e-69
SPRG_05609114284964796124e-69
SDRG_12187109044624776085e-69
PITG_14083114284934776098e-69
H257_170371462304984626091e-68
PHYCA_504517114284934776081e-68
PYIW_25301109045124926082e-68
CCA23647114284964686053e-68
PHYRA_71927109044854946026e-68
PHYSO_550665114284914776028e-68
CCI11048114284964705983e-67
PHYRA_72037114284934775974e-67
PHALS_09136114284934775889e-66
PHYCA_7619109044624755813e-65
PITG_13427109044634785814e-65
H310_11259114285194845793e-64
HYAP_08763114284734655737e-64
PYU1_G001739932032661625522e-63
PHYKE_6836114284934775615e-62
PYU1_G001738534612261605167e-59
PYVX_21517109044824995361e-58
PHYKE_8390534611301095013e-58
HYAP_04843109044304185214e-57
PYIW_18788932032441654782e-53
PYIR_23431114284684594911e-52
PYIR_25089854042621764689e-52
PYU1_G001740147522061614602e-51
PYAR_177141008024444774713e-50
PPTG_10635528561991604442e-49
PHYRA_84190720132061604419e-49
PHYRA_85631109792281604412e-48
PHYCA_14369109792481604413e-48
PYU1_G001744568762131574364e-48
PYU1_G001742932042131594364e-48
PPTG_10636109792461604395e-48
PHYSO_536424606911971754329e-48
PHYSO_507031586531971754329e-48
PHYSO_341599109791851654311e-47
PPTG_10634720132081594322e-47
PYU1_G001741854041991574293e-47
PHYCA_102852242061951604283e-47
PHYCA_102624720131951604267e-47
PPTG_10048213141901644204e-46
PHYCA_102550457052681604241e-45
PYVX_16175114284464624362e-45
PHYRA_82864231281931604126e-45
PHALS_00498109791991694118e-45
PPTG_15264231281941654109e-45
PPTG_17366239131941654109e-45
PHYKE_8388568762051604082e-44
PHYKE_8389147522041604083e-44
PHYSO_477820568762021654065e-44
PYIR_26626147522121744065e-44
PPTG_10643457052501594097e-44
PHYCA_129425147522041624031e-43
PHYKE_3446231281991604003e-43
PHYRA_81106147522021603977e-43
PHYKE_7718109792201603997e-43
PHYRA_81107568762021623977e-43
PHYCA_511409568762041603942e-42
PPTG_17121568762021603906e-42
PHYSO_284086147522041603891e-41
PYIW_18791854041941713852e-41
PHALS_03284309411881613843e-41
PPTG_17122147522041603854e-41
PYAR_24096932032271623715e-39
PYAP_22273932032681403738e-39
PYIR_26546866052391703663e-38
PYVX_18174854042041613616e-38
PITG_18450147522031603572e-37
PYIR_20273124015054853782e-37
PYAP_226451707615654863894e-37
PYVX_18176568762011603536e-37
CCI10477124014944843651e-35
PYAP_22279854042231643433e-35
SPRG_199431356703432583515e-35
CCA22989124014944823595e-35
PYU1_G014259109042442183427e-35
HYAP_12621124015014813534e-34
PHALS_0648053461159743267e-34
PYAP_22278932042891713361e-33
PHYSO_499978231281741383252e-33
PHYSO_501575820771741383252e-33
PHYCA_510817445761881403253e-33
PYVX_21248124015024393438e-33
PPTG_0882086622501653261e-32
PPTG_14254445761881403201e-32
PPTG_14255469372681383191e-31
PITG_13520109791711283083e-31
PHYKE_9185445762811383148e-31
PHYSO_343376532371721173022e-30
PHYSO_417649445761851383023e-30
PITG_1049986623231613072e-29
PHYCA_53693413059831383152e-28
PHYSO_254168462841701552862e-28
PHYSO_262732469371881202873e-28
PHYSO_340369526762001432874e-28
PYU1_G00173714753133962815e-28
PHYRA_72215124014994393038e-28
PHYSO_556052124015004832993e-27
PHYKE_9680124014984382983e-27
PHYCA_123621124014954822984e-27
PYAR_20075170764694842912e-26
PITG_15359124014964822895e-26
PHYSO_527908600641741262652e-25
PHYSO_34159652856231962692e-25
PHYRA_7388315665515062826e-25
PHALS_09942124014964642808e-25
SPRG_09825124014924882799e-25
SDRG_06945124014924882781e-24
CCA16670151565204902737e-24
PPTG_0093815665505062738e-24
PHYCA_50444515665485052693e-23
H257_01186151564964812647e-23
PHYRA_47253151564814962647e-23
PHALS_1202815665795122651e-22
PYAP_19280151565124922621e-22
PPTG_09121151565204992612e-22
CCI50816151568074892642e-22
PYAP_18131991722261192453e-22
PHYCA_14368528562191682453e-22
PYIR_1413215665135042593e-22
PYAR_16840151565365102594e-22
PYU1_G00569915665505042594e-22
H310_00561151564974842541e-21
PYIW_24688114282592812431e-21
PYU1_G011605151565244872523e-21
PHALS_10055151565164962513e-21
PYVX_20512151565284982505e-21
H257_16541124014944472486e-21
H310_02523124014944732488e-21
PYIW_2025715665035002461e-20
SDRG_14446151564954802442e-20
PHYKE_980715665575142443e-20
PYIW_19795151565194922416e-20
SDRG_0506015665595162416e-20
PYVX_2349915665195092407e-20
SPRG_1205415665585162409e-20
HYAP_0414915665645172391e-19
PYAP_1914815665355222381e-19
PHYSO_342364529831941262232e-19
PHYRA_74651699693441332312e-19
PITG_18935150674804802353e-19
PYIW_251901648732061862204e-19
PHYRA_73607194343431282285e-19
PYIR_1643542333041222265e-19
PHYCA_555180151565215042345e-19
CCI3999315665505122345e-19
H310_0764115665485152328e-19
H310_0636217301971352178e-19
PPTG_04622696962731332221e-18
PHYSO_48941815664714632291e-18
PHYRA_7358442332871302193e-18
H257_0745015665673692273e-18
PPTG_13000124013873452208e-18
PHYSO_533903604652081272109e-18
PHYKE_2864151564864892221e-17
PYAP_18711943562101212082e-17
PHYCA_534473423310501332232e-17
PYAR_1666415665774112203e-17
PITG_0494842342321232083e-17
PHYSO_484051571982851302113e-17
CCA1403015665605182194e-17
PHYKE_2937571983661302144e-17
PYAP_246891014392521352076e-17
PPTG_04647194343271302116e-17
PYVX_14662510865401332176e-17
PHYRA_73606571983661302127e-17
PHYCA_13036542352661252078e-17
PITG_0177815664704642141e-16
H257_1355017302661382051e-16
PITG_0527144782781242061e-16
PHYKE_10578778802391072032e-16
PHYCA_534296526713091262062e-16
PHYKE_600144782891282043e-16
PPTG_0461942342761232043e-16
PHYKE_2809752822911232043e-16
PHYSO_340333526712841262034e-16
PHYCA_531163194343141302044e-16
PYU1_G007476539131951271974e-16
PHYRA_86016727462361061995e-16
PHYSO_34033244782951262026e-16
PHYRA_77971705552301071987e-16
PHYRA_85794726192301071977e-16
PHYRA_86752732363001062019e-16
PYAP_19707995792411041971e-15
PHYRA_78175764333191252011e-15
PHYSO_48552442342781231981e-15
PYU1_G01469042342951241992e-15
PPTG_0461842353261282002e-15
PHYSO_48395542353201252002e-15
PHYSO_533747604512061261922e-15
PYU1_G005323943552511201943e-15
PPTG_0313997753201251983e-15
PHYRA_7868968382961261973e-15
PITG_0494942353371281983e-15
PHYCA_12942213313531011993e-15
PHYRA_83499204334731122014e-15
PHYSO_533682604462781311945e-15
PYIR_16443823992751201936e-15
PHALS_03179308833721281976e-15
PHYSO_438103557212381321907e-15
PHYCA_98479819502761061937e-15
SDRG_075651244122781441937e-15
PHYCA_1961197755311301998e-15
PHYSO_246676457051871601869e-15
PYIR_1644442341821201869e-15
PYIW_19151831912481741909e-15
PYAP_18709943552351201891e-14
PHYSO_459106194342231231871e-14
PHYKE_391342343211231921e-14
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18452

Length=856
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18452                                                            1714       0.0   
PHYCA_556160                                                          1112       0.0   
PHYKE_8391                                                            1071       0.0   
PHALS_06481                                                           976        0.0   
HYAP_07095                                                            974        0.0   
PHYSO_348901                                                          937        0.0   
PHYRA_50855                                                           917        0.0   
PYIR_13452                                                            897        0.0   
PYAP_17761                                                            890        0.0   
PYIW_19972                                                            849        0.0   
PYAR_13569                                                            773        0.0   
PYVX_18170                                                            758        0.0   
H310_08590                                                            746        0.0   
H257_08436                                                            739        0.0   
SPRG_14103                                                            704        0.0   
SDRG_16720                                                            701        0.0   
SPRG_04074                                                            421        1e-137
SDRG_14408                                                            418        3e-136
PPTG_17123                                                            365        2e-120
PHYCA_537323                                                          351        3e-115
PHYRA_81105                                                           340        7e-111
PHYSO_353401                                                          278        3e-88 
HYAP_07096                                                            280        5e-87 
PYVX_18173                                                            275        3e-82 
PYAP_21882                                                            259        4e-76 
SDRG_03822                                                            257        2e-75 
SDRG_15045                                                            256        4e-75 
SDRG_11131                                                            256        5e-75 
PHALS_08068                                                           256        7e-75 
PHYSO_254571                                                          253        3e-74 
PYAR_17512                                                            252        3e-73 
PYIR_17506                                                            249        1e-72 
H257_09722                                                            249        2e-72 
SDRG_03823                                                            247        8e-72 
PYAP_23435                                                            256        1e-71 
PPTG_18033                                                            246        3e-71 
PHYKE_10327                                                           257        9e-71 
H310_14447                                                            243        4e-70 
PPTG_09787                                                            242        5e-70 
SPRG_11769                                                            239        2e-69 
SPRG_05609                                                            240        4e-69 
SDRG_12187                                                            238        5e-69 
PITG_14083                                                            239        8e-69 
H257_17037                                                            239        1e-68 
PHYCA_504517                                                          238        1e-68 
PYIW_25301                                                            238        2e-68 
CCA23647                                                              237        3e-68 
PHYRA_71927                                                           236        6e-68 
PHYSO_550665                                                          236        8e-68 
CCI11048                                                              234        3e-67 
PHYRA_72037                                                           234        4e-67 
PHALS_09136                                                           231        9e-66 
PHYCA_7619                                                            228        3e-65 
PITG_13427                                                            228        4e-65 
H310_11259                                                            227        3e-64 
HYAP_08763                                                            225        7e-64 
PYU1_G001739                                                          217        2e-63 
PHYKE_6836                                                            220        5e-62 
PYU1_G001738                                                          203        7e-59 
PYVX_21517                                                            211        1e-58 
PHYKE_8390                                                            197        3e-58 
HYAP_04843                                                            205        4e-57 
PYIW_18788                                                            188        2e-53 
PYIR_23431                                                            193        1e-52 
PYIR_25089                                                            184        9e-52 
PYU1_G001740                                                          181        2e-51 
PYAR_17714                                                            186        3e-50 
PPTG_10635                                                            175        2e-49 
PHYRA_84190                                                           174        9e-49 
PHYRA_85631                                                           174        2e-48 
PHYCA_14369                                                           174        3e-48 
PYU1_G001744                                                          172        4e-48 
PYU1_G001742                                                          172        4e-48 
PPTG_10636                                                            173        5e-48 
PHYSO_536424                                                          171        9e-48 
PHYSO_507031                                                          171        9e-48 
PHYSO_341599                                                          170        1e-47 
PPTG_10634                                                            171        2e-47 
PYU1_G001741                                                          169        3e-47 
PHYCA_102852                                                          169        3e-47 
PHYCA_102624                                                          168        7e-47 
PPTG_10048                                                            166        4e-46 
PHYCA_102550                                                          167        1e-45 
PYVX_16175                                                            172        2e-45 
PHYRA_82864                                                           163        6e-45 
PHALS_00498                                                           162        8e-45 
PPTG_15264                                                            162        9e-45 
PPTG_17366                                                            162        9e-45 
PHYKE_8388                                                            161        2e-44 
PHYKE_8389                                                            161        3e-44 
PHYSO_477820                                                          160        5e-44 
PYIR_26626                                                            160        5e-44 
PPTG_10643                                                            162        7e-44 
PHYCA_129425                                                          159        1e-43 
PHYKE_3446                                                            158        3e-43 
PHYRA_81106                                                           157        7e-43 
PHYKE_7718                                                            158        7e-43 
PHYRA_81107                                                           157        7e-43 
PHYCA_511409                                                          156        2e-42 
PPTG_17121                                                            154        6e-42 
PHYSO_284086                                                          154        1e-41 
PYIW_18791                                                            152        2e-41 
PHALS_03284                                                           152        3e-41 
PPTG_17122                                                            152        4e-41 
PYAR_24096                                                            147        5e-39 
PYAP_22273                                                            148        8e-39 
PYIR_26546                                                            145        3e-38 
PYVX_18174                                                            143        6e-38 
PITG_18450                                                            142        2e-37 
PYIR_20273                                                            150        2e-37 
PYAP_22645                                                            154        4e-37 
PYVX_18176                                                            140        6e-37 
CCI10477                                                              145        1e-35 
PYAP_22279                                                            136        3e-35 
SPRG_19943                                                            139        5e-35 
CCA22989                                                              142        5e-35 
PYU1_G014259                                                          136        7e-35 
HYAP_12621                                                            140        4e-34 
PHALS_06480                                                           130        7e-34 
PYAP_22278                                                            134        1e-33 
PHYSO_499978                                                          129        2e-33 
PHYSO_501575                                                          129        2e-33 
PHYCA_510817                                                          129        3e-33 
PYVX_21248                                                            136        8e-33 
PPTG_08820                                                            130        1e-32 
PPTG_14254                                                            127        1e-32 
PPTG_14255                                                            127        1e-31 
PITG_13520                                                            123        3e-31 
PHYKE_9185                                                            125        8e-31 
PHYSO_343376                                                          120        2e-30 
PHYSO_417649                                                          120        3e-30 
PITG_10499                                                            122        2e-29 
PHYCA_536934                                                          125        2e-28 
PHYSO_254168                                                          114        2e-28 
PHYSO_262732                                                          115        3e-28 
PHYSO_340369                                                          115        4e-28 
PYU1_G001737                                                          112        5e-28 
PHYRA_72215                                                           121        8e-28 
PHYSO_556052                                                          119        3e-27 
PHYKE_9680                                                            119        3e-27 
PHYCA_123621                                                          119        4e-27 
PYAR_20075                                                            116        2e-26 
PITG_15359                                                            115        5e-26 
PHYSO_527908                                                          106        2e-25 
PHYSO_341596                                                          108        2e-25 
PHYRA_73883                                                           113        6e-25 
PHALS_09942                                                           112        8e-25 
SPRG_09825                                                            112        9e-25 
SDRG_06945                                                            111        1e-24 
CCA16670                                                              109        7e-24 
PPTG_00938                                                            109        8e-24 
PHYCA_504445                                                          108        3e-23 
H257_01186                                                            106        7e-23 
PHYRA_47253                                                           106        7e-23 
PHALS_12028                                                           106        1e-22 
PYAP_19280                                                            105        1e-22 
PPTG_09121                                                            105        2e-22 
CCI50816                                                              106        2e-22 
PYAP_18131                                                            99.0       3e-22 
PHYCA_14368                                                           99.0       3e-22 
PYIR_14132                                                            104        3e-22 
PYAR_16840                                                            104        4e-22 
PYU1_G005699                                                          104        4e-22 
H310_00561                                                            102        1e-21 
PYIW_24688                                                            98.2       1e-21 
PYU1_G011605                                                          101        3e-21 
PHALS_10055                                                           101        3e-21 
PYVX_20512                                                            100        5e-21 
H257_16541                                                            100        6e-21 
H310_02523                                                            100        8e-21 
PYIW_20257                                                            99.4       1e-20 
SDRG_14446                                                            98.6       2e-20 
PHYKE_9807                                                            98.6       3e-20 
PYIW_19795                                                            97.4       6e-20 
SDRG_05060                                                            97.4       6e-20 
PYVX_23499                                                            97.1       7e-20 
SPRG_12054                                                            97.1       9e-20 
HYAP_04149                                                            96.7       1e-19 
PYAP_19148                                                            96.3       1e-19 
PHYSO_342364                                                          90.5       2e-19 
PHYRA_74651                                                           93.6       2e-19 
PITG_18935                                                            95.1       3e-19 
PYIW_25190                                                            89.4       4e-19 
PHYRA_73607                                                           92.4       5e-19 
PYIR_16435                                                            91.7       5e-19 
PHYCA_555180                                                          94.7       5e-19 
CCI39993                                                              94.7       5e-19 
H310_07641                                                            94.0       8e-19 
H310_06362                                                            88.2       8e-19 
PPTG_04622                                                            90.1       1e-18 
PHYSO_489418                                                          92.8       1e-18 
PHYRA_73584                                                           89.0       3e-18 
H257_07450                                                            92.0       3e-18 
PPTG_13000                                                            89.4       8e-18 
PHYSO_533903                                                          85.5       9e-18 
PHYKE_2864                                                            90.1       1e-17 
PYAP_18711                                                            84.7       2e-17 
PHYCA_534473                                                          90.5       2e-17 
PYAR_16664                                                            89.4       3e-17 
PITG_04948                                                            84.7       3e-17 
PHYSO_484051                                                          85.9       3e-17 
CCA14030                                                              89.0       4e-17 
PHYKE_2937                                                            87.0       4e-17 
PYAP_24689                                                            84.3       6e-17 
PPTG_04647                                                            85.9       6e-17 
PYVX_14662                                                            88.2       6e-17 
PHYRA_73606                                                           86.3       7e-17 
PHYCA_130365                                                          84.3       8e-17 
PITG_01778                                                            87.0       1e-16 
H257_13550                                                            83.6       1e-16 
PITG_05271                                                            84.0       1e-16 
PHYKE_10578                                                           82.8       2e-16 
PHYCA_534296                                                          84.0       2e-16 
PHYKE_6001                                                            83.2       3e-16 
PPTG_04619                                                            83.2       3e-16 
PHYKE_2809                                                            83.2       3e-16 
PHYSO_340333                                                          82.8       4e-16 
PHYCA_531163                                                          83.2       4e-16 
PYU1_G007476                                                          80.5       4e-16 
PHYRA_86016                                                           81.3       5e-16 
PHYSO_340332                                                          82.4       6e-16 
PHYRA_77971                                                           80.9       7e-16 
PHYRA_85794                                                           80.5       7e-16 
PHYRA_86752                                                           82.0       9e-16 
PYAP_19707                                                            80.5       1e-15 
PHYRA_78175                                                           82.0       1e-15 
PHYSO_485524                                                          80.9       1e-15 
PYU1_G014690                                                          81.3       2e-15 
PPTG_04618                                                            81.6       2e-15 
PHYSO_483955                                                          81.6       2e-15 
PHYSO_533747                                                          78.6       2e-15 
PYU1_G005323                                                          79.3       3e-15 
PPTG_03139                                                            80.9       3e-15 
PHYRA_78689                                                           80.5       3e-15 
PITG_04949                                                            80.9       3e-15 
PHYCA_12942                                                           81.3       3e-15 
PHYRA_83499                                                           82.0       4e-15 
PHYSO_533682                                                          79.3       5e-15 
PYIR_16443                                                            79.0       6e-15 
PHALS_03179                                                           80.5       6e-15 
PHYSO_438103                                                          77.8       7e-15 
PHYCA_98479                                                           79.0       7e-15 
SDRG_07565                                                            79.0       7e-15 
PHYCA_19611                                                           81.3       8e-15 
PHYSO_246676                                                          76.3       9e-15 
PYIR_16444                                                            76.3       9e-15 
PYIW_19151                                                            77.8       9e-15 
PYAP_18709                                                            77.4       1e-14 
PHYSO_459106                                                          76.6       1e-14 
PHYKE_3913                                                            78.6       1e-14 
PYIW_27477                                                            75.5       2e-14 
PHYCA_127270                                                          77.8       2e-14 
PITG_11936                                                            78.6       2e-14 
PYU1_G007364                                                          77.8       2e-14 
PPTG_07507                                                            77.4       3e-14 
PPTG_07509                                                            77.4       3e-14 
PHYKE_6077                                                            77.8       3e-14 
PYIR_16375                                                            76.3       4e-14 
PHYRA_73583                                                           79.3       5e-14 
PYVX_20789                                                            76.6       5e-14 
PYVX_20783                                                            76.3       5e-14 
PHYCA_97965                                                           76.6       5e-14 
SPRG_19917                                                            75.5       5e-14 
PHALS_03176                                                           74.7       5e-14 
PHYCA_12943                                                           76.3       6e-14 
SDRG_08129                                                            74.7       6e-14 
SDRG_08137                                                            75.9       7e-14 
SDRG_17318                                                            75.1       8e-14 
PHYRA_78176                                                           76.3       8e-14 
PITG_19065                                                            77.4       9e-14 
PPTG_07516                                                            75.9       9e-14 
CCI47381                                                              73.9       9e-14 
PPTG_07520                                                            75.9       9e-14 
PHYCA_18657                                                           75.9       1e-13 
PHALS_05392                                                           76.6       1e-13 
PHYSO_562795                                                          76.6       1e-13 
PPTG_04620                                                            75.9       2e-13 
PYAR_14256                                                            72.8       2e-13 
HYAP_08069                                                            74.3       2e-13 
PYIR_24743                                                            75.9       2e-13 
PYU1_G005324                                                          72.8       2e-13 
PYU1_G005326                                                          72.8       2e-13 
PYU1_G005328                                                          72.8       2e-13 
PYIW_21964                                                            74.3       2e-13 
PHYRA_83494                                                           72.8       3e-13 
PHYRA_73582                                                           74.7       4e-13 
PHYRA_79140                                                           75.5       4e-13 
CCA17179                                                              71.6       4e-13 
SPRG_07795                                                            74.3       4e-13 
PYU1_G005325                                                          72.0       4e-13 
PHYRA_84947                                                           73.2       4e-13 
PHYRA_78174                                                           73.6       5e-13 
PYVX_16138                                                            75.9       5e-13 
PHYKE_5749                                                            73.9       5e-13 
PHYCA_112615                                                          71.6       5e-13 
PHYSO_524101                                                          73.9       5e-13 
PYAP_19712                                                            73.2       6e-13 
PITG_04947                                                            73.6       6e-13 
PYAR_18165                                                            72.8       7e-13 
PYVX_18175                                                            69.7       7e-13 
SPRG_19916                                                            73.2       9e-13 
PHYKE_2454                                                            73.9       9e-13 
SPRG_22161                                                            72.8       1e-12 
PYAR_14260                                                            70.9       1e-12 
PPTG_14221                                                            72.4       1e-12 
PYAP_18221                                                            71.2       1e-12 
PHYRA_78161                                                           73.6       1e-12 
PYU1_G005868                                                          72.0       1e-12 
PYIR_21896                                                            74.3       1e-12 
PYVX_18179                                                            68.9       1e-12 
PHYRA_83500                                                           73.6       1e-12 
PPTG_07521                                                            72.0       1e-12 
PYU1_G005866                                                          70.1       1e-12 
PYVX_21297                                                            71.6       1e-12 
PYU1_G001524                                                          72.4       2e-12 
PHYCA_123316                                                          72.4       2e-12 
PYIW_18792                                                            68.2       2e-12 
PYAR_24818                                                            70.1       2e-12 
PYIR_23585                                                            70.9       2e-12 
PYAP_24691                                                            68.6       2e-12 
PHYKE_6002                                                            70.1       2e-12 
PYU1_G001527                                                          71.6       2e-12 
PYU1_G001523                                                          71.6       2e-12 
PYIW_15526                                                            71.2       2e-12 
H257_11264                                                            71.6       2e-12 
PPTG_03153                                                            72.0       2e-12 
PHYKE_2379                                                            71.2       3e-12 
HYAP_11923                                                            73.6       3e-12 
PHYSO_374518                                                          67.0       3e-12 
H257_11265                                                            70.9       3e-12 
PYIW_24289                                                            69.3       3e-12 
PHYCA_19598                                                           72.4       3e-12 
SPRG_07627                                                            72.8       4e-12 
PYVX_24563                                                            70.1       4e-12 
PYIR_17978                                                            70.1       4e-12 
PHYCA_69583                                                           69.3       4e-12 
PYVX_22508                                                            70.9       4e-12 
PYAP_18713                                                            68.6       4e-12 
SDRG_15426                                                            72.4       5e-12 
PHYRA_84732                                                           70.1       5e-12 
PHALS_03177                                                           70.1       5e-12 
PHYSO_255056                                                          70.1       5e-12 
PITG_11937                                                            70.9       5e-12 
PYIW_19601                                                            69.7       5e-12 
PPTG_03138                                                            70.5       6e-12 
PHYKE_1913                                                            70.1       6e-12 
PYIR_22134                                                            70.5       7e-12 
SPRG_07797                                                            70.5       8e-12 
PYU1_G001526                                                          70.5       8e-12 
PHYKE_6078                                                            70.5       8e-12 
SPRG_04114                                                            70.9       8e-12 
PHYKE_6079                                                            70.1       8e-12 
PPTG_10073                                                            67.8       9e-12 
PYIW_24288                                                            67.8       1e-11 
SDRG_17317                                                            65.5       1e-11 
PITG_08892                                                            69.7       1e-11 
PHYKE_6076                                                            69.3       1e-11 
PPTG_04803                                                            69.3       1e-11 
SDRG_08782                                                            70.9       1e-11 
SPRG_07826                                                            70.1       1e-11 
PYAP_22257                                                            68.6       1e-11 
SPRG_04679                                                            67.8       2e-11 
PYIR_24867                                                            69.3       2e-11 
PYAR_16493                                                            68.2       2e-11 
PPTG_07511                                                            66.6       2e-11 
PYU1_G005869                                                          68.2       2e-11 
PPTG_18166                                                            70.5       2e-11 
PHYSO_246481                                                          69.3       2e-11 
PPTG_10186                                                            68.6       2e-11 
PHYSO_476077                                                          68.2       2e-11 
PHYSO_472009                                                          68.2       2e-11 
SPRG_07825                                                            68.9       2e-11 
PHYCA_10471                                                           68.6       2e-11 
PHYCA_120062                                                          67.0       3e-11 
PYVX_22510                                                            70.5       3e-11 
PHYKE_9024                                                            68.6       3e-11 
PYU1_G006405                                                          68.6       3e-11 
PHYRA_78172                                                           69.3       3e-11 
PPTG_06256                                                            68.6       3e-11 
PHYCA_19612                                                           70.1       3e-11 
PYU1_G006404                                                          67.8       4e-11 
PHYKE_2539                                                            67.4       4e-11 
SDRG_16534                                                            68.2       4e-11 
PITG_20312                                                            67.8       4e-11 
PITG_20631                                                            67.8       4e-11 
PHYRA_78626                                                           69.3       4e-11 
PHYRA_78625                                                           68.9       4e-11 
PHYSO_426658                                                          66.2       5e-11 
PHYCA_122958                                                          67.0       5e-11 
PHYRA_80750                                                           67.4       5e-11 
PHYKE_10295                                                           67.4       5e-11 
PHYCA_132255                                                          63.5       6e-11 
PYU1_G005871                                                          67.4       6e-11 
PHYCA_15125                                                           67.8       6e-11 
PYIR_20483                                                            67.0       6e-11 
PHYCA_6388                                                            67.0       7e-11 
PYAP_18138                                                            66.6       7e-11 
PYIR_20481                                                            67.0       7e-11 
SDRG_00972                                                            67.4       8e-11 
PPTG_03156                                                            68.2       9e-11 
PYIR_26867                                                            63.9       9e-11 
PHYRA_86751                                                           63.9       9e-11 
PYIR_24421                                                            65.1       1e-10 
PYU1_G005873                                                          65.1       1e-10 
PYVX_22511                                                            66.6       1e-10 
H310_05432                                                            66.6       1e-10 
PYAR_20617                                                            65.9       1e-10 
PYU1_G005872                                                          66.6       1e-10 
PHYCA_18729                                                           67.4       1e-10 
PHYRA_80631                                                           66.6       1e-10 
PHYRA_86241                                                           64.3       1e-10 
PPTG_06253                                                            66.2       1e-10 
HYAP_14170                                                            65.5       2e-10 
H310_05438                                                            66.6       2e-10 
PHYKE_7717                                                            67.8       2e-10 
PPTG_03140                                                            66.6       2e-10 
HYAP_01683                                                            66.2       2e-10 
PYU1_G006403                                                          65.1       2e-10 
PHYCA_103479                                                          65.9       2e-10 
PYIR_14463                                                            66.2       2e-10 
PHYRA_78162                                                           67.0       2e-10 
SDRG_17448                                                            64.7       3e-10 
PYIR_22634                                                            65.1       3e-10 
PHYSO_525076                                                          65.9       3e-10 
PHYSO_375794                                                          61.2       4e-10 
PHALS_04411                                                           64.3       4e-10 
PYIR_19612                                                            64.3       4e-10 
PHYSO_318683                                                          65.5       4e-10 
PYAP_23672                                                            64.3       4e-10 
PHYRA_73581                                                           64.3       5e-10 
PYAR_15391                                                            62.4       5e-10 
PYVX_19277                                                            65.1       5e-10 
PHYCA_15124                                                           64.3       6e-10 
PPTG_03160                                                            65.1       6e-10 
PHYKE_7445                                                            65.1       7e-10 
PHALS_01293                                                           65.1       7e-10 
PYAR_21271                                                            63.2       7e-10 
PYVX_21174                                                            59.3       7e-10 
PPTG_03144                                                            64.3       8e-10 
PHYCA_12944                                                           61.6       8e-10 
PITG_08202                                                            62.0       9e-10 
PYAP_22462                                                            62.4       9e-10 
PHYSO_488921                                                          63.9       9e-10 
PHYKE_3912                                                            63.2       1e-09 
PHYSO_262844                                                          63.2       1e-09 
PHYSO_329293                                                          63.5       1e-09 
PYU1_G005867                                                          62.0       1e-09 
PYU1_G001514                                                          64.7       1e-09 
PPTG_06249                                                            63.2       1e-09 
PHALS_05110                                                           61.2       1e-09 
PYAP_14265                                                            63.2       2e-09 
PYAR_21940                                                            62.4       2e-09 
PHYCA_562062                                                          62.0       2e-09 
PYAP_18226                                                            62.0       2e-09 
PHYCA_14560                                                           62.8       2e-09 
PHYRA_93650                                                           61.6       2e-09 
PYU1_G001519                                                          62.4       2e-09 
PYIW_18794                                                            61.6       3e-09 
H257_11258                                                            62.8       3e-09 
PYAP_16994                                                            61.6       3e-09 
PHYSO_488139                                                          61.6       3e-09 
PHYRA_79881                                                           61.6       3e-09 
PYU1_G001516                                                          62.0       4e-09 
PYIW_18790                                                            57.0       4e-09 
SDRG_16535                                                            62.0       4e-09 
PYU1_G005985                                                          60.1       4e-09 
PHYSO_337515                                                          61.6       5e-09 
PYU1_G001475                                                          61.2       5e-09 
PYIW_25463                                                            60.1       5e-09 
PHYKE_9023                                                            61.2       5e-09 
PHALS_02044                                                           60.5       6e-09 
PHYCA_15126                                                           61.6       6e-09 
PYIR_23689                                                            60.1       7e-09 
PYAR_17163                                                            57.4       7e-09 
SPRG_07799                                                            61.6       7e-09 
PHALS_10635                                                           61.2       7e-09 
SDRG_00948                                                            61.6       7e-09 
PHYRA_78177                                                           61.2       7e-09 
PHYRA_77293                                                           61.2       8e-09 
PYAP_20077                                                            60.1       8e-09 
PYIR_16437                                                            60.5       9e-09 
PITG_11944                                                            60.8       1e-08 
SPRG_07796                                                            60.8       1e-08 
PHYSO_324715                                                          60.5       1e-08 
PPTG_01148                                                            60.5       1e-08 
PYVX_21643                                                            60.1       1e-08 
PHYRA_78167                                                           60.1       1e-08 
PPTG_06106                                                            60.1       1e-08 
PPTG_03147                                                            60.1       1e-08 
PHYSO_255975                                                          58.5       1e-08 
PHYRA_78165                                                           60.1       2e-08 
PYIR_25999                                                            60.5       2e-08 
PYU1_G001518                                                          60.1       2e-08 
PYAP_23673                                                            60.1       2e-08 
PITG_08895                                                            58.2       2e-08 
PHYRA_78169                                                           60.5       2e-08 
PPTG_18176                                                            59.3       2e-08 
PYIW_24287                                                            60.1       2e-08 
PHYCA_123476                                                          59.7       2e-08 
PITG_01966                                                            60.1       2e-08 

>PITG_18452
Length=856

 Score = 1714 bits (4438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 856/856 (100%), Positives = 856/856 (100%), Gaps = 0/856 (0%)

Query  1    MASGVNLGDtlstalsssvatFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED  60
            MASGVNLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED
Sbjct  1    MASGVNLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED  60

Query  61   RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSSTIFVGGCDELLAFFRSGIAVGKP  120
            RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSSTIFVGGCDELLAFFRSGIAVGKP
Sbjct  61   RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSSTIFVGGCDELLAFFRSGIAVGKP  120

Query  121  QGVMPSEKQPTPSSALAPETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSK  180
            QGVMPSEKQPTPSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSK
Sbjct  121  QGVMPSEKQPTPSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSK  180

Query  181  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGW  240
            EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGW
Sbjct  181  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGW  240

Query  241  NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH  300
            NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH
Sbjct  241  NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH  300

Query  301  PRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALE  360
            PRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALE
Sbjct  301  PRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALE  360

Query  361  CAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  420
            CAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ
Sbjct  361  CAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  420

Query  421  LLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPN  480
            LLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPN
Sbjct  421  LLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPN  480

Query  481  IYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEED  540
            IYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEED
Sbjct  481  IYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEED  540

Query  541  SIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAG  600
            SIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAG
Sbjct  541  SIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAG  600

Query  601  EVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSGVYFRTSIFISTNMRLSG  660
            EVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSGVYFRTSIFISTNMRLSG
Sbjct  601  EVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSGVYFRTSIFISTNMRLSG  660

Query  661  SFPCSTFllllallPACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQG  720
            SFPCSTFLLLLALLPACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQG
Sbjct  661  SFPCSTFLLLLALLPACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQG  720

Query  721  INTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS  780
            INTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS
Sbjct  721  INTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS  780

Query  781  GYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYS  840
            GYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYS
Sbjct  781  GYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYS  840

Query  841  WQVYKNCVGLSKNPTA  856
            WQVYKNCVGLSKNPTA
Sbjct  841  WQVYKNCVGLSKNPTA  856

>PHYCA_556160
Length=649

 Score = 1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/642 (85%), Positives = 588/642 (92%), Gaps = 6/642 (1%)

Query  1    MASGVNLGDtlstalsssvatFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED  60
            MASGV L +TL T+  SSVATF+IAGWK+C SFVKA EVA AMQMLYPDRV FE HPFED
Sbjct  1    MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED  60

Query  61   RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSS--TIFVGGCDELLAFFRSGIAVG  118
            R AFK WLS SQD+    FG DS+ATKHVTSPFVWSS  T FVGGCD+LL +FRSG+ VG
Sbjct  61   REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVG  120

Query  119  KPQGVMPSEKQPTPSSALAPETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLAC  178
             PQG  P+   PT  +A   E D  M + + E +STA  EE +YDYDLVVIGGGSGGLAC
Sbjct  121  NPQGATPN-GSPTEKTA---EADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLAC  176

Query  179  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASF  238
            SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEV+HHD A+F
Sbjct  177  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANF  236

Query  239  GWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLEL  298
            GWN+SSG G+AP F+WKQLV+NVDGYI+ INFKYKVELRSKYVKYENFLGSF++PHTLEL
Sbjct  237  GWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLEL  296

Query  299  WHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVA  358
            WHPRKG+KQITTRDVVIAVGGRP+ELT PGGEHAISSDDIFWMK KEPGKTLVVGASYVA
Sbjct  297  WHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVA  356

Query  359  LECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLEN  418
            LECAGFLKGMGYDVKVMVRSILLRGFDQDMA+KIGEYMEVQSGIEFIRKTVPQSITKLEN
Sbjct  357  LECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLEN  416

Query  419  GQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTST  478
            GQLLVKWTSEDGESCEEAFD+VLNATGRDPD+AKL+LDKAGVKLNEK+GRIWVK+EQTST
Sbjct  417  GQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTST  476

Query  479  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSE  538
            PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN+TVQMDY+KVCTAVFTPIEYGCCG+SE
Sbjct  477  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSE  536

Query  539  EDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPN  598
            EDS +RFG+D IEVYHTNFVPLEWSLST+TR AAESCY+KVICD+ RDKFVVGFHYLGPN
Sbjct  537  EDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPN  596

Query  599  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  640
            AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  597  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  638

>PHYKE_8391
Length=778

 Score = 1071 bits (2771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/640 (82%), Positives = 569/640 (89%), Gaps = 7/640 (1%)

Query  6    NLGDtlstalsssvatFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFK  65
            NL +TL+TA +SSV TF+I+GW++C SF KA EVAAAMQMLYPD+V+FETH FEDR+AFK
Sbjct  136  NLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFK  195

Query  66   QWLSASQDDITAHFGADSRATKHVTSPFVWSST--IFVGGCDELLAFFRSGIAVGKPQGV  123
            QWLS S+D    HFGADS+A  HVTSPFVWSS    FVGGCD+LLAFFRSG+AVG PQG 
Sbjct  196  QWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGA  255

Query  124  MPSEKQPTPSSALAPETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAA  183
             P+EK    +S    E+  ++ +  A            YDYDLVVIGGGSGGLACSKEAA
Sbjct  256  DPAEKAEAAASIEVAESSMTVTETPAVPMEEETS----YDYDLVVIGGGSGGLACSKEAA  311

Query  184  SFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVS  243
            SFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGE +HHDSA+FGWNV+
Sbjct  312  SFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVA  371

Query  244  SGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRK  303
            SG+G    FDWKQLV+NVD YI+ INFKYKVELRSKYVKYENFLGSF+DPHTLELWHPRK
Sbjct  372  SGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRK  431

Query  304  GSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAG  363
            G+KQITTR VV+AVGGRP++LT PG E+AISSDDIFWMK   PGKTLVVGASYVALECAG
Sbjct  432  GTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAG  491

Query  364  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  423
            FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLV
Sbjct  492  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLV  551

Query  424  KWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYA  483
            KWT+ED ESCEE FD+VLNATGRDPD+AKL LDKAGVKLNEKTGRIW K+EQTSTPNI+A
Sbjct  552  KWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFA  611

Query  484  IGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIK  543
            IGDVIDAPELTPVAIQAGR LSRRLYNN+TVQMDYDKVCTAVFTPIEYGCCGLSEEDS +
Sbjct  612  IGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNE  671

Query  544  RFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVT  603
            RFG+D +EVYH NFVPLEWSLS E+R ++ESCYVKVICD  RDKFVVGFHYLGPNAGEVT
Sbjct  672  RFGEDNVEVYHKNFVPLEWSLS-ESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVT  730

Query  604  QAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSG  643
            QAMGLAMKLGFTYDQMVDTVGIHPTTAE+FTTLEVTKSSG
Sbjct  731  QAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEVTKSSG  770

>PHALS_06481
Length=644

 Score = 976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/621 (76%), Positives = 530/621 (85%), Gaps = 21/621 (3%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            FY+AGWK+C SF+KARE+ AAMQMLYPDR+AF+   FEDR  F+ WL ASQ D    FGA
Sbjct  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91

Query  82   DSRATKHVTSPFVWSS--TIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPE  139
             S+A KHVTSPFVWSS  T FVGGCD+LL FFRSGIAVG+PQG+  S++    SS    E
Sbjct  92   KSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAVQE  151

Query  140  TDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSP  199
                                  +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSP
Sbjct  152  KP-------------------IFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSP  192

Query  200  QGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVT  259
            QGT+WGLGGTCVNVGCIPKKL+HQSSLIGE++ HDSA FGW   +   + P+FDWKQLV 
Sbjct  193  QGTAWGLGGTCVNVGCIPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVA  252

Query  260  NVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGG  319
            NVDGYI+ INFKYKV+LRSK VKYENFLGSF+DPHT++L HPRKG+KQITTR+VVIAVG 
Sbjct  253  NVDGYIKTINFKYKVKLRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGS  312

Query  320  RPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  379
            RPRELT PGGE+A+SSDDIFWMK KEPGKTLV+GASYVALECAGFLKGMGY+VKVMVRSI
Sbjct  313  RPRELTCPGGEYAVSSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSI  372

Query  380  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDS  439
            LLR FDQ+MA+KIGEYMEVQSGI+FIRKTVPQSI++LEN QLLVKW  E G++CEEAF++
Sbjct  373  LLRSFDQEMADKIGEYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNT  432

Query  440  VLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQ  499
            VLNATGRDP++A L LDKAGVKLNEKTGRI VK+EQTST NIYAIGDV+DAPELTPVAIQ
Sbjct  433  VLNATGRDPEVAHLGLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQ  492

Query  500  AGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVP  559
            +GRLLS+RLYNN++VQMDYDKVCT VFTPIEYGCCGLSEE S  R+G+D IE+YHTNFVP
Sbjct  493  SGRLLSQRLYNNSSVQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVP  552

Query  560  LEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  619
            LEWSLS+ETR A+ SCY+KV+CD+ RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQM
Sbjct  553  LEWSLSSETRTASNSCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQM  612

Query  620  VDTVGIHPTTAESFTTLEVTK  640
            V+TVGIHP TAES T LEVTK
Sbjct  613  VNTVGIHPMTAESLTILEVTK  633

>HYAP_07095
Length=613

 Score = 974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/605 (78%), Positives = 522/605 (86%), Gaps = 4/605 (1%)

Query  43   MQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSS--TIF  100
            M ++YP RVAFETH FEDR+AFKQWLS S +D    FG DS+AT HVTSPFVW S  T F
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  101  VGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPETDGSMPDVaaetss--taake  158
            VGGCD+LLA FRSGIAVG  Q V  + +        AP  D +      E+ +     ++
Sbjct  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120

Query  159  easYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  218
            +ASYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180

Query  219  KLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRS  278
            KLMHQSSLIGE+LHHD ASFGWNV S  G  P FDWKQLV+NV  YI+ I+FKYKVELRS
Sbjct  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  240

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338
            K VKYEN LGSF+DPHTL+LWHP+KG+K+ITTR VVIAVGGRPR+L   GGE A+SSDDI
Sbjct  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  398
            FWMK KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360

Query  399  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKA  458
            QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FD+VLNATGRDPD+AKL LD+A
Sbjct  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420

Query  459  GVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDY  518
            GVKLNEKTGRIWV +EQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480

Query  519  DKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVK  578
            DK+CTAVFTPIEYGCCGLSEEDS + +G D +EVYH NFVPLEWSL+ +TR AAESCYVK
Sbjct  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540

Query  579  VICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEV  638
            V+CD+ R+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHPTTAE+FTTLE 
Sbjct  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTLET  600

Query  639  TKSSG  643
            TKSSG
Sbjct  601  TKSSG  605

>PHYSO_348901
Length=526

 Score = 937 bits (2421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/481 (92%), Positives = 463/481 (96%), Gaps = 0/481 (0%)

Query  162  YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM
Sbjct  37   YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            HQSSLIGE++HHDSA+FGWN++S  GSA  F WKQLV NVDGYIRGINFKYKVELRSKYV
Sbjct  97   HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWM  341
            KYENFLGSF+D HTLELWHPRKG+KQITTRDVVIAVGGRP+ELT PGGEHAISSDDIFWM
Sbjct  157  KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216

Query  342  KTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  401
            K KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG
Sbjct  217  KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276

Query  402  IEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVK  461
            IEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFD+VLNATGRDPD+AKL LDKA VK
Sbjct  277  IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336

Query  462  LNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKV  521
            LNEKTGRIWVK+EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN+T QMDYDK+
Sbjct  337  LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396

Query  522  CTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVIC  581
            CTAVFTPIEYGCCGLSEEDS +R+G+D IEVYH NFVPLEWSLS ETR AAESCY+KVIC
Sbjct  397  CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456

Query  582  DRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKS  641
            D+ RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE+FTTLE+TKS
Sbjct  457  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKS  516

Query  642  S  642
            S
Sbjct  517  S  517

>PHYRA_50855
Length=489

 Score = 917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/479 (91%), Positives = 463/479 (97%), Gaps = 2/479 (0%)

Query  162  YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            YDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM
Sbjct  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            HQSSLIGEV+HHDSA+FGWNV+S +GSAP F+WKQLV+NVD YI+ INFKYKVELRSKYV
Sbjct  62   HQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWM  341
            KYENFLGSF+DPHTLELWH RKG+KQITTRDVVIAVGGRP+EL+ PGGEHAISSDDIFWM
Sbjct  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180

Query  342  KTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  401
            K KEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANKIGEYMEVQSG
Sbjct  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240

Query  402  IEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVK  461
            IEFIRKTVPQSIT LENGQLLVKWT+EDGESCEEAFD+VLNATGRDPD+AKL LDKAGVK
Sbjct  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300

Query  462  LNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKV  521
            LNEK+GRIWVK+EQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNN+T QMDY+KV
Sbjct  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360

Query  522  CTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVIC  581
            CTAVFTPIEYGCCGLSEEDS +RFG+D +EVYHTNFVPLEWSLS ETR +AESCYVKVIC
Sbjct  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVIC  419

Query  582  DRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  640
            D+ RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK
Sbjct  420  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478

>PYIR_13452
Length=645

 Score = 897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/625 (70%), Positives = 508/625 (81%), Gaps = 32/625 (5%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQ--DDITAHF  79
            +++AGW+ C  + KA +V  AM++LYPD V FE H F DR AF++WL+AS   +++T  F
Sbjct  42   YHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECF  101

Query  80   GADSRATKHVTSPFVWSSTI-FVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAP  138
            GADS+A  H +SPFVW++T  F+GGCD+ LA FRSG++                    AP
Sbjct  102  GADSKALTHKSSPFVWANTRGFIGGCDDTLALFRSGVS--------------------AP  141

Query  139  ETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPS  198
             T  + P + A   + A   +  YDYDL+VIGGGSGGLACSKEA+ +G+KVCVLDYVKPS
Sbjct  142  ATLAATPTMVAAAPAPADDAK--YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPS  199

Query  199  PQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLV  258
            P GTSWGLGGTCVNVGCIPKKLMHQSSLIGE +H D+ +FGW V         FDW Q++
Sbjct  200  PVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQML  254

Query  259  TNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVG  318
             +V+ YI+ INFKYKVELR K VKYEN LGSF+D HTLELWHP+KG+K +TTRDVVIAVG
Sbjct  255  KSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVG  314

Query  319  GRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  378
            GRP+ L+  GG+ AISSDDIFW K + PGKTLVVGASYVALECAGF+KGMGYDVK+MVRS
Sbjct  315  GRPKPLSCEGGDLAISSDDIFWRK-EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRS  373

Query  379  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFD  438
            ILLRGFDQDMANKIGE+ME +S IEFIR  VPQSITKLE+GQLLVKW S DGE+CEEAFD
Sbjct  374  ILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFD  433

Query  439  SVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAI  498
            +VLNATGRDPD+AKL LDK GVKLN KTGRI V +EQTSTPNIYAIGDVIDAPELTPVAI
Sbjct  434  TVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAI  493

Query  499  QAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFV  558
            QAGRLL+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE SI+++G++ +E+YH NF 
Sbjct  494  QAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFT  553

Query  559  PLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  618
            PLEWSLS++ R AA SCYVKVICD  R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQ
Sbjct  554  PLEWSLSSD-REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQ  612

Query  619  MVDTVGIHPTTAESFTTLEVTKSSG  643
            MV+ VGIHPTTAE FTTLEVTKSSG
Sbjct  613  MVNVVGIHPTTAEIFTTLEVTKSSG  637

>PYAP_17761
Length=622

 Score = 890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/620 (70%), Positives = 501/620 (81%), Gaps = 30/620 (5%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            +Y+AGW +C  + KAR+VA AMQ+LY D VA E   FE R+AFK WL+ S       FG 
Sbjct  21   YYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFKAWLAESNAAFAQAFGT  80

Query  82   DSRATKHVTSPFVWSSTI-FVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPET  140
            DS A  H +SPFVWS+   F+GGCD  LA FRSG+A     G       P+ S  + P  
Sbjct  81   DSPALTHTSSPFVWSNARGFIGGCDATLAHFRSGVAARPLAG-------PSASPTMTP--  131

Query  141  DGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQ  200
                          A  E  +YDYDLVVIGGGSGGLACSKEAA +G+KVCVLDYVKPSP 
Sbjct  132  -------------VAVDESKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPL  178

Query  201  GTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTN  260
            GT+WGLGGTCVNVGCIPKKLMHQS+LIGE++H D+ +FGWN+   +     F W QLV +
Sbjct  179  GTTWGLGGTCVNVGCIPKKLMHQSALIGELMHKDAGAFGWNMGEQK-----FTWTQLVES  233

Query  261  VDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGR  320
            V+ YI+GINFKYKVELR K VKYENFLGSF+DPHT+ELWH +KG+K ITTR VV+AVGGR
Sbjct  234  VNNYIKGINFKYKVELRDKKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGR  293

Query  321  PRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSIL  380
            PR+L+ PGGEHAISSDDIFW KT EPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSIL
Sbjct  294  PRQLSCPGGEHAISSDDIFWRKT-EPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSIL  352

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSV  440
            LRGFD+DMAN+IG++M+ +S IEFIR  VP+SI KLENGQLLVKW S DGE+ EE FDSV
Sbjct  353  LRGFDEDMANRIGDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSV  412

Query  441  LNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQA  500
            LNATGRDPD++KL+LDKAGV+LN KTGRI V +EQTSTPN++AIGDVIDAPELTPVAIQA
Sbjct  413  LNATGRDPDVSKLNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQA  472

Query  501  GRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPL  560
            GRLL+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE +  ++G+D +E+YH +F+PL
Sbjct  473  GRLLARRLYNNETTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPL  532

Query  561  EWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  620
            EWSLS + R AA +CYVKVICD+ RDK+VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV
Sbjct  533  EWSLSQD-RVAANTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMV  591

Query  621  DTVGIHPTTAESFTTLEVTK  640
            + VGIHPTTAE FTTLEVTK
Sbjct  592  NVVGIHPTTAEVFTTLEVTK  611

>PYIW_19972
Length=609

 Score = 849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/622 (69%), Positives = 490/622 (79%), Gaps = 53/622 (9%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            ++IAGW+ C  + KA +V  AM++LYPD V  E H F DR AF+ WLSAS  D  A+FGA
Sbjct  33   YHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAFRAWLSASAADFAANFGA  92

Query  82   DSRATKHVTSPFVWSSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPETD  141
            DS+A  H +SPF         G DE                       PTP+   AP  D
Sbjct  93   DSKAATHTSSPFF--------GKDE----------------------SPTPTMVAAPVVD  122

Query  142  GSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  201
             ++                +YDYDL+VIGGGSGGLACSKEAA +G+KVCVLDYVKPSP G
Sbjct  123  DNV----------------TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGG  166

Query  202  TSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNV  261
            T+WGLGGTCVNVGCIPKKLMHQSSLIGE +H D+A+FGW+V   +     FDW Q++ +V
Sbjct  167  TTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQK-----FDWAQMLKSV  221

Query  262  DGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRP  321
            + YI+ INFKYKVELR K VKYEN LGSF+D HTLELWHP+KG+K +TTRDVVIAVGGRP
Sbjct  222  NSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRP  281

Query  322  RELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILL  381
            + L+  GGE AISSDDIFW K + PGKTLV+GASYVALECAGF+KGMGYDVK+MVRSILL
Sbjct  282  KPLSCEGGELAISSDDIFWRK-EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILL  340

Query  382  RGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVL  441
            RGFDQDMA+KIGE+MEV+S IEFIR  VPQSITKLE+GQLLVKW S DG+ CEEAFD+VL
Sbjct  341  RGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVL  400

Query  442  NATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAG  501
            NATGRDPD+AKL+LD  GV+LN KTGRI V +EQTS PNI+AIGDVIDAPELTPVAIQAG
Sbjct  401  NATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAG  460

Query  502  RLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLE  561
            R+L+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE SI++FG+DK+E+YH NF PLE
Sbjct  461  RMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLE  520

Query  562  WSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  621
            WSLS++ R AA SCYVKVICD  R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYD MV+
Sbjct  521  WSLSSD-RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579

Query  622  TVGIHPTTAESFTTLEVTKSSG  643
             VGIHPTTAE FTTLEVTKSSG
Sbjct  580  VVGIHPTTAEIFTTLEVTKSSG  601

>PYAR_13569
Length=494

 Score = 773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/479 (77%), Positives = 417/479 (87%), Gaps = 7/479 (1%)

Query  162  YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            YDYDLVVIGGGSGGLACSKEAA  G+KV VLDYVKPSP GT+WGLGGTCVNVGCIPKKLM
Sbjct  12   YDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCIPKKLM  71

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            HQS+L+GE++H D+ +FGW        A  F W QLV +V+ YI+GINFKYKVELR K V
Sbjct  72   HQSALLGELMHKDAPAFGWTTG-----AQSFTWTQLVASVNNYIKGINFKYKVELRDKKV  126

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWM  341
            KYENFLGSF+D HT+ELWH +K +K +TTR VVIAVGGRPR LT PGGEHAISSDDIFW 
Sbjct  127  KYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDDIFWR  186

Query  342  KTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  401
            KT EPGKTLVVGASYVALECAGFLKGMGYDVK+MVRSILLRGFDQDMAN+IG++M+ +S 
Sbjct  187  KT-EPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQDESR  245

Query  402  IEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVK  461
            IEFIR  VP+SI K ENG+LLVKW S DG+  EE FD+VLNATGRDPD+ KL+LDKAGV+
Sbjct  246  IEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDKAGVE  305

Query  462  LNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKV  521
            LN K+GRI   +EQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYNN T  MDYDK+
Sbjct  306  LNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKI  365

Query  522  CTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVIC  581
            CTAVFTPIEYGCCGLSEED+  ++G++ +E+YH +F+PLEWSLS E R AA +CYVKVIC
Sbjct  366  CTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLS-EERVAAATCYVKVIC  424

Query  582  DRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  640
            D+ RDK VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHPTTAE FTTLE+TK
Sbjct  425  DKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEITK  483

>PYVX_18170
Length=510

 Score = 758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/557 (69%), Positives = 439/557 (79%), Gaps = 57/557 (10%)

Query  89   VTSPFVWSS--TIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPETDGSMPD  146
            ++SPFVW+S  T FVGGCD LL  FRS +              P P++A  P+ +G +  
Sbjct  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQV--------------PRPNAASKPQANGEV--  44

Query  147  VaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGL  206
                                              EA+ FGQKV VLDYVKPSPQGT WGL
Sbjct  45   ----------------------------------EASKFGQKVLVLDYVKPSPQGTKWGL  70

Query  207  GGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIR  266
            GGTCVNVGCIPKKLMHQS+LIGEV+H D+A FGW   +    AP FDW QL ++V  YI+
Sbjct  71   GGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFEN----APKFDWSQLASSVSTYIK  126

Query  267  GINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTI  326
             +NFKYKV+LR K VKYENFLG+F+DPHT+EL +PRK SK +TTR VV+AVGGRPR L  
Sbjct  127  TLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPC  186

Query  327  PGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQ  386
            PGGE +I+SDDIFW KT  PGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQ
Sbjct  187  PGGELSITSDDIFWRKTA-PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQ  245

Query  387  DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGR  446
            DMAN+IGEYMEV++GIEFIR+TVP SITKLE+G+LLVKWT  DG + EEAFD+VLNATGR
Sbjct  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305

Query  447  DPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  506
            +PD+ KL LDKAGVKLN KTGRI V +EQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+R
Sbjct  306  NPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLAR  365

Query  507  RLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLST  566
            RLYNN T  MDY+KVCTAVFTPIEYGCCGLSEE+SI+RFG+D IEVYH NF PLEW+LS 
Sbjct  366  RLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSD  425

Query  567  ETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  626
            +TR +  +CY+KVICD+ RD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIH
Sbjct  426  DTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIH  485

Query  627  PTTAESFTTLEVTKSSG  643
            PTTAE+FTTLEVTKSSG
Sbjct  486  PTTAETFTTLEVTKSSG  502

>H310_08590
Length=640

 Score = 746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/628 (61%), Positives = 454/628 (72%), Gaps = 38/628 (6%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            +++ GWK C  +VKA  V ++MQ L+P +V    H   ++ +F  WL+ SQ +    F  
Sbjct  37   YHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDN  96

Query  82   DSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALA  137
            D+R  KH +SPF +     +  FVGGCD+ LAFFR+        G         PS+A A
Sbjct  97   DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGA--------PSAANA  148

Query  138  PETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKP  197
              +D S  D            E  YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKP
Sbjct  149  HVSDTSSSD------------ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKP  196

Query  198  SPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQL  257
            SP G++WGLGGTCVNVGCIPKKLMHQSS+IGE+LH D+  FGW VS+       FDW +L
Sbjct  197  SPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNAS-----FDWTKL  251

Query  258  VTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH--PRKGSKQITTRDVVI  315
            V++V  YI G+NFKY+++LR K VKYEN LG+F D HTL L +   +KG   +T R  VI
Sbjct  252  VSSVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVI  311

Query  316  AVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  375
            AVGGRP+ L+ PG EHAISSDDIF  K + PGKTLVVGASYVALECAGFLKG G+DV +M
Sbjct  312  AVGGRPKPLSCPGWEHAISSDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIM  370

Query  376  VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  435
            VRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KL NGQL V  T  +G     
Sbjct  371  VRSILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----  425

Query  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTP  495
             +D+VLNATGR PD+  L+L  AGV LN K+GRI V +EQTSTP+IYAIGDVIDAPELTP
Sbjct  426  IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTP  485

Query  496  VAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
            VAIQAG+LL+RRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+I   G+D I+VYH 
Sbjct  486  VAIQAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQ  545

Query  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615
            NF PLEWSLS E R  A+ CY K+I D  + K VVGFHYLGPNAGEVTQA+G+AMKL  T
Sbjct  546  NFTPLEWSLSHE-RPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHAT  604

Query  616  YDQMVDTVGIHPTTAESFTTLEVTKSSG  643
            YD  V+TVGIHPTTAE FTTLE+TK SG
Sbjct  605  YDDFVNTVGIHPTTAEIFTTLEITKESG  632

>H257_08436
Length=642

 Score = 739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/629 (60%), Positives = 456/629 (72%), Gaps = 40/629 (6%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            +++ GWK C  +VKA  VA++MQ L+P +V    H   ++ +F  WL+ SQ +    F  
Sbjct  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100

Query  82   DSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALA  137
            D+R  KH +SPF +     +  FVGGCD+ LAFFR+     + Q    +        A  
Sbjct  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRA-----RTQSAPSAPASSASIHA--  153

Query  138  PETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKP  197
               D S  DV              YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKP
Sbjct  154  --NDTSDADVK-------------YDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKP  198

Query  198  SPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQL  257
            SP G++WGLGGTCVNVGCIPKKLMHQSS+IGE+LH D+  FGW+VS+       FDW +L
Sbjct  199  SPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKL  253

Query  258  VTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH--PRKGSKQITTRDVVI  315
            V++V  YI G+NFKY+V+LR K VKYEN LG+F D HTL L +   +KG   +T R  VI
Sbjct  254  VSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVI  313

Query  316  AVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  375
            AVGGRP+ L+ PG EHA+SSDDIF  K   PGKTLVVGASYVALECAGFLKG G+DV +M
Sbjct  314  AVGGRPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIM  372

Query  376  VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  435
            VRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V  T+      ++
Sbjct  373  VRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----QD  427

Query  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTP  495
             +D++LNATGR PD+ KL+LD AGV LN K+GRI V +EQTSTPNIYA+GDVIDAPELTP
Sbjct  428  VYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTP  487

Query  496  VAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
            VAIQAG+LLSRRL+ N T  MDY K+CTAVFTP+EYGCCGLSEED+I   G++ +EVYH 
Sbjct  488  VAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQ  547

Query  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615
            NF PLEWSLS + R  A+ CY K+I D  + K V+GFHYLGPNAGEVTQA+G+A+KL  T
Sbjct  548  NFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNAT  606

Query  616  YDQMVDTVGIHPTTAESFTTLEVTKSSGV  644
            YD  ++TVGIHPTTAE FTTLE+TK SGV
Sbjct  607  YDDFINTVGIHPTTAEIFTTLEITKESGV  635

>SPRG_14103
Length=628

 Score = 704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/629 (59%), Positives = 448/629 (71%), Gaps = 41/629 (7%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            +++ GWKSC  + +A  VA++MQ L+P +V    H    + +F  WL ASQ      F  
Sbjct  28   YHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLEASQATFATQFVG  87

Query  82   DSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALA  137
            D+RAT H TSPF +    + T FVGGCD+ LAFFRS       +    +       +  A
Sbjct  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-------RTQSAAAPSAPARNVHA  140

Query  138  PETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKP  197
             + D                  A+YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKP
Sbjct  141  NDVDDG----------------ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKP  184

Query  198  SPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQL  257
            SPQG++WGLGGTCVNVGCIPKKLMHQS+++GE+LH D+ +FGW V +       FDW +L
Sbjct  185  SPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKL  239

Query  258  VTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGS--KQITTRDVVI  315
            VT+V  YI G+NFKY+V+LR K VKYENFLG+F D HTL L +P KG   K +T R  +I
Sbjct  240  VTSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALI  299

Query  316  AVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  375
            AVGGRP+ L  PG + AISSDDIF   T  PGKTLVVGASYVALECAGFLK  G+DV VM
Sbjct  300  AVGGRPKSLDCPGADLAISSDDIFSRPTP-PGKTLVVGASYVALECAGFLKAQGFDVTVM  358

Query  376  VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  435
            VRSILLRGFD DMA +IG YME ++ I+FI+  VP SI +L NGQL V  T  +G     
Sbjct  359  VRSILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----  413

Query  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTP  495
             +D+VLNATGR+PD++ L+L  AGV LN KTGRI V HEQTS P+IYA+GDVID PELTP
Sbjct  414  IYDTVLNATGRNPDVSGLNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTP  473

Query  496  VAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
            VAIQAGRLL++RL++N+   M YDKVCTAVFTPIEYGCCGLSE+ +I+  G D + VYH 
Sbjct  474  VAIQAGRLLAKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQ  533

Query  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615
            +F PLEWSLS + RA A+ CY K+I DR ++  VVGFHYLGPNAGEVTQA+G+AMKL  +
Sbjct  534  SFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNAS  592

Query  616  YDQMVDTVGIHPTTAESFTTLEVTKSSGV  644
            YD  V TVGIHPTTAE FTTLE+TK SG+
Sbjct  593  YDDFVSTVGIHPTTAEIFTTLEITKESGL  621

>SDRG_16720
Length=628

 Score = 701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/629 (59%), Positives = 446/629 (71%), Gaps = 41/629 (7%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            +++ GWKSC  + +A  VA +MQ L+P +V    H    + +F  WL  SQ      F  
Sbjct  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87

Query  82   DSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALA  137
            D+RAT H TSPF +    + T FVGGCD+ LAFFRS       +    +       +  A
Sbjct  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-------RTQSAAAPSAPARNVHA  140

Query  138  PETDGSMPDVaaetsstaakeeasYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKP  197
             + D                  A+YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKP
Sbjct  141  NDVDDG----------------ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKP  184

Query  198  SPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQL  257
            SPQG++WGLGGTCVNVGCIPKKLMHQS+++GE+LH D+ +FGW V +       FDW +L
Sbjct  185  SPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKL  239

Query  258  VTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGS--KQITTRDVVI  315
            +T+V  YI G+NFKY+V+LR K VKYENFLG+F D HTL L +P KG   K +T R  +I
Sbjct  240  ITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALI  299

Query  316  AVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  375
            AVGGRP+ L  PG + AISSDDIF   T  PGKTLVVGASYVALECAGFLKG G+DV VM
Sbjct  300  AVGGRPKSLDCPGADLAISSDDIFSRPTP-PGKTLVVGASYVALECAGFLKGQGFDVTVM  358

Query  376  VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  435
            VRSILLRGFD DMA +IG YME ++ I FI+  VP SI +L NGQL V  T  +G     
Sbjct  359  VRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----  413

Query  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTP  495
             +D+VLNATGR PD++ L+L  AGV LN KTGRI V HEQTSTP+IYA+GDVID PELTP
Sbjct  414  IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTP  473

Query  496  VAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
            VAIQAGRLLS+RL++N+   M YDKVCTAVFTPIEYGCCGLSE+ +++  G D + VYH 
Sbjct  474  VAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQ  533

Query  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615
            +F PLEWSLS + RA A+ CY K+I DR ++  VVGFHYLGPNAGEVTQA+G+A+KL  +
Sbjct  534  SFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNAS  592

Query  616  YDQMVDTVGIHPTTAESFTTLEVTKSSGV  644
            Y+  V TVGIHPTTAE FTTLE+TK SG+
Sbjct  593  YEDFVSTVGIHPTTAEIFTTLEITKESGL  621

>SPRG_04074
Length=509

 Score = 421 bits (1083),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 245/499 (49%), Positives = 318/499 (64%), Gaps = 25/499 (5%)

Query  162  YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+M
Sbjct  4    FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  63

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            H S ++G  L HD+A  GW V          +W+ LV  V  +++ +NF Y+V LRS  V
Sbjct  64   HYSGILGAGL-HDAAHLGWQVPEKVEH----NWETLVEAVQAHVKKLNFSYRVGLRSNKV  118

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPR-ELTIPG-GEHAISSDDIF  339
            +Y N L  F DPHTL        ++ +T   ++IA GGRP     IPG  E+AI+SDD+F
Sbjct  119  QYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLF  178

Query  340  WMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQ  399
             + T  PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M V 
Sbjct  179  SLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VA  236

Query  400  SGIEFIRKTVPQSITKLE-NGQLLVKW-TSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
             G++F   T+P SI K E  GQL V +  SE  E+  EAFD+VL A GR  D   + L+K
Sbjct  237  QGMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEK  296

Query  458  AGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-NATVQ  515
            AGVK     G+    +E T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T  
Sbjct  297  AGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKT  355

Query  516  MDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA---  572
            M+YD + T VFTP+EYG  GLSEE++I R+GKD I VY   F  LEW      +A +   
Sbjct  356  MNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQE  415

Query  573  --------ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  624
                     +C  K++C +  ++ V+GFH++GPNAGEVTQ   +A+ +G T +   + +G
Sbjct  416  GDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIG  475

Query  625  IHPTTAESFTTLEVTKSSG  643
            IHPT AESF  L VTK SG
Sbjct  476  IHPTDAESFMALTVTKESG  494

>SDRG_14408
Length=528

 Score = 418 bits (1075),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 241/499 (48%), Positives = 317/499 (64%), Gaps = 25/499 (5%)

Query  162  YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+M
Sbjct  23   FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  82

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            H S ++G  L HD+A  GW +          +W+ LV  V  +++ +NF Y+V LRS  V
Sbjct  83   HYSGILGAGL-HDAAHLGWQLPEKVEH----NWETLVETVQAHVKKLNFSYRVGLRSNKV  137

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPR-ELTIPG-GEHAISSDDIF  339
            +Y N L  F DPHTL        ++ +T   ++IA GGRP     IPG GE+AI+SDD+F
Sbjct  138  QYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEIPGVGEYAITSDDLF  197

Query  340  WMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQ  399
             + T  PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M V 
Sbjct  198  SLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VA  255

Query  400  SGIEFIRKTVPQSITKLE-NGQLLVKW-TSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
             G++F   T+P SI K +  GQL V +  SE  E+  E FD+VL A GR  D   + L+K
Sbjct  256  QGMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNIGLEK  315

Query  458  AGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-NATVQ  515
             GVK     G+    +E T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T  
Sbjct  316  VGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKT  374

Query  516  MDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA---  572
            M+YD + T VFTP+EYG  GLSEE++I R+GKD + VY   F  LEW      +A +   
Sbjct  375  MNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQKAESAQE  434

Query  573  --------ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  624
                     +C  K++C +  ++ V+GFH++GPNAGEVTQ   +A+ +G T +   + +G
Sbjct  435  GDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIG  494

Query  625  IHPTTAESFTTLEVTKSSG  643
            IHPT AESF  L VTK SG
Sbjct  495  IHPTDAESFMALTVTKESG  513

>PPTG_17123
Length=201

 Score = 365 bits (937),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 192/201 (96%), Gaps = 0/201 (0%)

Query  656  MRLSGSFPCSTFllllallPACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAY  715
            MRLSG+  CST LLLLALL AC+AGQRRLDAGLGEGQ+VLHPPPFFVVDGLDFQGMALAY
Sbjct  1    MRLSGTSLCSTSLLLLALLAACIAGQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAY  60

Query  716  LQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN  775
            LQEQG+NTSIEAQSWMQQ GY+SLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN
Sbjct  61   LQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN  120

Query  776  SFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYV  835
            SFQTSGYTLDGPCE+WLDDTKV+SGRNCHTEFPHGQH+VDYSSCG +C LSWYWLGIKY+
Sbjct  121  SFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYI  180

Query  836  EGIYSWQVYKNCVGLSKNPTA  856
            EGIYSWQVYKNCVGLS  PTA
Sbjct  181  EGIYSWQVYKNCVGLSTAPTA  201

>PHYCA_537323
Length=200

 Score = 351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 170/180 (94%), Gaps = 0/180 (0%)

Query  677  CVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGY  736
            CV GQRRLDAGLGEGQ+V HPPPFF+VDGLDFQGMALAYLQEQG+NTSIEAQSWM+Q GY
Sbjct  21   CVTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGY  80

Query  737  SSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTK  796
            +SLRAMLDDESLY+VTEEAIFECGLTSP+TETQPIPTNNSFQTSGYTLDGPCE+WLDDTK
Sbjct  81   TSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTK  140

Query  797  VASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            V++GRNCHTEFP GQHQVDYSSCG SC LSWYWLGIKYVEGIYSWQVYKNCVGL    TA
Sbjct  141  VSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200

>PHYRA_81105
Length=201

 Score = 340 bits (872),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)

Query  678  VAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYS  737
            +AGQRRLDAGLGEGQIVLHPPPFF+VDGLDFQGMALAYLQEQG+NTSIEAQ WMQQ GY+
Sbjct  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82

Query  738  SLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKV  797
            SLR+MLDDESLY+VTEEAIF+CGLTSP+TETQ IPTN+SFQ+SGYTLDGPCE+WLDDTK 
Sbjct  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKA  142

Query  798  ASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            A+GRNCHTEFPHGQHQ+DYS+CG +C L WYWLGIKYVEG YSWQVYKNC+ L K  TA
Sbjct  143  AAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201

>PHYSO_353401
Length=146

 Score = 278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  711  MALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  770
            MALAYLQEQG+NTSIEAQSWMQ+ GY+SLRAMLDDESLYKVTEEA+F+CGLTSP+TETQP
Sbjct  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60

Query  771  IPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWL  830
            IP+N+SFQTSGYTLDGPCE+WLDDTKVA+GRNCHT+FPHGQH++DYS+CG SC L WYWL
Sbjct  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120

Query  831  GIKYVEGIYSWQVYKNCVGLSKNPTA  856
            GIKYVEG YSWQVYKNCV LSK  TA
Sbjct  121  GIKYVEGAYSWQVYKNCVALSKTATA  146

>HYAP_07096
Length=251

 Score = 280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 165/216 (76%), Gaps = 4/216 (2%)

Query  644  VYFRTSIFISTNMRL--SGSFPCSTFllllallPACVAGQRRLDAGLGEGQIVLHPPPFF  701
             Y  T + I++  R   S S P + F LL   L  CV GQR L + L EGQ+VL+P P F
Sbjct  37   TYRMTLVSITSKRRYVRSPSPPITLFHLLALSLSVCVTGQR-LTSDLSEGQVVLYPSPHF  95

Query  702  VVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGL  761
            +VD    QG ALAYLQEQGI+TSIEAQSW Q+ GY SLRAMLDD+SLY V+++AIF+CG 
Sbjct  96   IVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGF  155

Query  762  TSPRTET-QPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCG  820
            TS  +ET Q IPTN + ++SGYTLDGPCE+W DDT+V SGRNC TEFPHGQHQVDYSSCG
Sbjct  156  TSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCG  215

Query  821  GSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
             SC L WYWLGI+Y++GIYSWQVYKNC+GL +N TA
Sbjct  216  DSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251

>PYVX_18173
Length=500

 Score = 275 bits (704),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 150/177 (85%), Gaps = 1/177 (1%)

Query  677  CVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGY  736
            C A QRRLD+GLGEGQ+VL+PPPFFVVDG+D++G  +AYL++QG++T+IEAQ+W+ ++GY
Sbjct  24   CFA-QRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGY  82

Query  737  SSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTK  796
            ++LRA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCEIW+D+T 
Sbjct  83   ATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTL  142

Query  797  VASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853
              +GRNCHTEFP G H +DYS CG SC +SW+WLGIKY    YSWQV+KNC+ LS +
Sbjct  143  ALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199

 Score = 165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +   ++   G+ SLRA +DD+SLY V
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A F CG T P    QPIP +   +++GYT DGPCE+WLDDT+V    NCH       
Sbjct  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYS+C GSC L WYWLG++Y++ +YSWQVYK CV +S
Sbjct  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

>PYAP_21882
Length=502

 Score = 259 bits (661),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 260/485 (54%), Gaps = 33/485 (7%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQ-KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSA--PIFDWKQLVTNVDGYIRGINFKYKVELRSKY  280
             ++ +G  LH D   +G+  + G+  A    F WK+L    D Y+  +N  Y   L +  
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNSK  141

Query  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFW  340
            V       +F     +E+       K+I  ++V+IAVGG+P    IPG EH I SD  F 
Sbjct  142  VDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  196

Query  341  MKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQ  399
            ++ ++P K  VVGA Y+A+E AG L G+G D  +  R   +LRGFD+ +   + + M  +
Sbjct  197  LE-EQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAM-AK  254

Query  400  SGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAG  459
             G+     +    + K  +G   +     DG S    FDSV+ A GR P    L+L+ AG
Sbjct  255  EGVNLRPHSSVTKVIKAADGTKTLVLA--DG-SEHSGFDSVIYAAGRVPLTESLNLEAAG  311

Query  460  VKLNEKTGRIWVKHEQTSTP--NIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNAT-VQM  516
            ++ ++  G I +   Q +T   NI+A+GDV   P LTPVAI AGR L+ RL+      + 
Sbjct  312  IETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDAKA  370

Query  517  DYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTE-----TRAA  571
             Y+ + T VF+    G  GL+E+ +  +FG D+I+VY + FV + + +  E      +  
Sbjct  371  SYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQKP  430

Query  572  AESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  631
                 +K++C + +D+ VVG H +G  A E+ Q  G+A+K+G T       V IHPT AE
Sbjct  431  KPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHPTAAE  489

Query  632  SFTTL  636
               T+
Sbjct  490  ELVTM  494

>SDRG_03822
Length=494

 Score = 257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 164/476 (34%), Positives = 252/476 (53%), Gaps = 18/476 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++L  E+LH   A     V   Q  A  FDW  +    D Y++ +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGVQDIQFGA--FDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
                  F+D HT+E+   R  +K I     +IAVGG P    +PG EHAISSD  F ++T
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFALET  173

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
             +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + +   ME  +G+
Sbjct  174  -QPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
             F+R++   SI K E+G L ++ T          F++VL A GR P    L L+   + L
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  463  NEKTGRIWVKHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMDYDK  520
            +          E T+ PN++A+GDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  351

Query  521  VCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVI  580
            + T VF+    G  GL+E  ++ ++G   +  + ++F  + +++S E      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA--MKLV  409

Query  581  CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            C  + +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  410  CIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_15045
Length=494

 Score = 256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 163/476 (34%), Positives = 254/476 (53%), Gaps = 18/476 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++L  E+LH   A     VS  Q  A  FDW  +    D Y+  +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGVSDIQYGA--FDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
                  F+D HT+E+       ++ T + ++IAVGG P    IPG EHAISSD  F ++T
Sbjct  119  VMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALET  173

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
             +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME  +G+
Sbjct  174  -QPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R++   +I K  +G L ++ T          F++VL A GR P    L L+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  463  NEKTGRIWVKHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMDYDK  520
            + +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  521  VCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVI  580
            + T VF+    G  GL+E  +I+++G   +  + ++F  + +++  E      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--MKLV  409

Query  581  CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            C  + +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  410  CIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_11131
Length=494

 Score = 256 bits (653),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 163/476 (34%), Positives = 253/476 (53%), Gaps = 18/476 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++L  E+LH   A     VS  Q  A  FDW  +    D Y+  +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGVSDIQYGA--FDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  118

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
                  F+D HT+E+       ++ T + ++IAVGG P    IPG EHAISSD  F ++T
Sbjct  119  VMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALET  173

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
             +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME  +G+
Sbjct  174  -QPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R++   +I K  +G L ++ T          F++VL A GR P    L L+   + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  463  NEKTGRIWVKHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMDYDK  520
            + +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N     ++Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  521  VCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVI  580
            + T VF+    G  GL+E  +I ++G   +  + ++F  + +++  E      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--MKLV  409

Query  581  CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            C  + +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  410  CIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PHALS_08068
Length=497

 Score = 256 bits (653),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 258/487 (53%), Gaps = 34/487 (7%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAP---IFDWKQLVTNVDGYIRGINFKYKVELRS  278
            + ++ +   LHHD   +G+  ++  G       F+W +L    D Y+  +N  Y+  L +
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLAN  133

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338
              V        F +   +E+       K++  + ++IAVGGRP    IPG E  I SD  
Sbjct  134  SKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRPLIPDIPGKELCIDSDGF  188

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  397
            F ++T  P K  +VGA Y+A+E AG L  +G    V  R   +LR FD  +   + E M 
Sbjct  189  FELETL-PTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAM-  246

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
               G+     +    + +  +G   +  T+    S    FD V+ ATGR P  + L+L+K
Sbjct  247  ANDGVHLRPNSTVARVKEAADGTKTLVLTN---GSEHRGFDVVICATGRVPLTSTLNLEK  303

Query  458  AGVKLNEKTGRIWVKH-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNAT-VQ  515
            AG+  ++  G I V   ++T+  N+YA+GDV + P LTPVAI AGR LS RL+      +
Sbjct  304  AGITTDD-NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDAK  362

Query  516  MDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA---  572
            + Y+ + T +F+    G  GL+EE + K++G + I+VY + FV + + L  ET  A    
Sbjct  363  LSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGVP  422

Query  573  ---ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  629
                   +K++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT 
Sbjct  423  KEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  481

Query  630  AESFTTL  636
             E   TL
Sbjct  482  GEELVTL  488

>PHYSO_254571
Length=489

 Score = 253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 175/487 (36%), Positives = 252/487 (52%), Gaps = 34/487 (7%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  222  HQSSLIGEVLHHDSASFGW---NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRS  278
              ++ +   LHHD   +G+         G    FDW +L    D Y+  +N  Y+  L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338
              V        F D   +E+       K+I  ++V+IAVGG+P    IPG E  I SD  
Sbjct  126  SKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDIPGKELCIDSDGF  180

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  397
            F ++T  P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD D+     E   
Sbjct  181  FELETL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDAM  238

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
             + G+     +    + K ++G   +     DG S    +D V+ A GR P  + L LDK
Sbjct  239  AKDGVHLRPHSNIARVEKADDGTKTLVLA--DG-SEYSGYDVVIYAAGRVPLTSNLQLDK  295

Query  458  AGVKLNEKTGRIWVKH-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNAT-VQ  515
            AGV   +K G I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+      +
Sbjct  296  AGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDAK  354

Query  516  MDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA---  572
            + Y+ + T VF+    G  GL+EE + +++G D+I+VY + FV + + L  E   A    
Sbjct  355  VSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEATGEP  414

Query  573  ---ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  629
                   +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + V IHPT 
Sbjct  415  KDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTA  473

Query  630  AESFTTL  636
             E   TL
Sbjct  474  GEELVTL  480

>PYAR_17512
Length=533

 Score = 252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 172/508 (34%), Positives = 266/508 (52%), Gaps = 50/508 (10%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQG---SAPIFDWKQLVTNVDGYIRGINFKYKVELRS  278
            + ++ +G +LH D   +G+    G G       F W +L    D Y+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  279  KYVKYENFLGSFIDPHTLEL---WHPRKG------------------SKQITTRDVVIAV  317
              V+      +F     +E+     P K                    K+I+ ++V+IAV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  318  GGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR  377
            GG+P    IPG EH I SD  F ++ + P K  VVGA Y+A+E AG L G+G D  +  R
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELE-EMPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCR  262

Query  378  SI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA  436
               +LRGFD+ + + + + M+ + G++    ++   +TK  +G   +    +DG      
Sbjct  263  KDGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADGTKTLVL--QDGTE-HAG  318

Query  437  FDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQ--TSTPNIYAIGDVIDAPELT  494
            FD+V+ A GR P    L+L+ AGV+ + + G I +   Q  T+  NI+A+GDV   P LT
Sbjct  319  FDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVCGTPALT  377

Query  495  PVAIQAGRLLSRRLYNNAT-VQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVY  553
            PVAI AGR LS RL+      +M Y+ + T VF+    G  GL+E+++  + G D ++VY
Sbjct  378  PVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVY  437

Query  554  HTNFVPLEWSLSTE-----TRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGL  608
             + FV + + +  E      +       +K++C    +K VVG H +G  A E+ Q  G+
Sbjct  438  SSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGFGV  496

Query  609  AMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            A+K+G T       V IHPT AE   T+
Sbjct  497  AVKMGATKADFDSCVAIHPTAAEELVTM  524

>PYIR_17506
Length=509

 Score = 249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 175/491 (36%), Positives = 260/491 (53%), Gaps = 46/491 (9%)

Query  164  YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  223  QSSLIGEVLHHDSASFGWNVSSGQ--GSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKY  280
             ++ +   LH D+  +G+    G   G    F W +L    D YI  +N  Y+  L +  
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFW  340
            V       +F     +E+       K I+ R+V+IAVGG+P    IPG EH I SD  F 
Sbjct  150  VDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  204

Query  341  MKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ-------DMANKI  392
            ++ + P K  VVGA Y+A+E AG L G+G D  +  R   +LR FD+       D   K 
Sbjct  205  LE-ELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAMAKD  263

Query  393  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAK  452
            G  +  QS +  I KT       L+  + LV     DG S    FD+V+ A GR P  + 
Sbjct  264  GIVVRPQSNVARIEKT-------LDGKKTLV---LADG-SEHAGFDTVIYAAGRIPLTSN  312

Query  453  LDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  511
            L++  AG++  +K G I V +++ TS  N++A+GDV     LTPVAI AGR LS RL+  
Sbjct  313  LNISAAGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGG  371

Query  512  AT-VQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRA  570
                ++ Y+ + T VF+    G  GL+E+++ +++G  +I+ Y + FV + + L  E  A
Sbjct  372  MEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDA  431

Query  571  AAES-----CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  625
               +       +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V I
Sbjct  432  EGNTKPKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAI  490

Query  626  HPTTAESFTTL  636
            HPT  E   TL
Sbjct  491  HPTAGEELVTL  501

>H257_09722
Length=518

 Score = 249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 178/485 (37%), Positives = 272/485 (56%), Gaps = 31/485 (6%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+GGGSGG++ ++ AAS+G  V V++  +   QG + GLGGTCVNVGC+PKK+M+ 
Sbjct  28   YDYIVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKKVMYN  84

Query  224  SSLIGEVLHHDSA-SFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            ++   E+LH   A +F      G GS   FDW  + T  D Y+  ++  Y+  L    + 
Sbjct  85   AAFHAEILHSAKAYAFKGVQDVGFGS---FDWATMKTKRDSYVARLHGIYERNLAKDNIT  141

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMK  342
              +   SF+D HT+ +          T   +++AVGG P+  +IPG EHAISSD  F ++
Sbjct  142  LVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFFGLE  196

Query  343  TKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSG  401
            T +P K  V+GA Y+A+E AG    +  +  V  R   +LR FD  + + + + M  +SG
Sbjct  197  T-QPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSG  254

Query  402  IEFIRKTVPQSITKLENGQLLVK--WTSEDGESCE----EAFDSVLNATGRDPDIAKLDL  455
            ++F+  +  QSI K  +G L ++   T+EDG S        FD+++ A GR P  +   +
Sbjct  255  VQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-M  313

Query  456  DKAGVKLNEKTGRIWVK-HEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNA  512
            +   +  NEK G I V   E TS P +YAIGDV +   ELTPVAI AGR L+ RL+    
Sbjct  314  EHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEP  372

Query  513  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWS-LSTETRAA  571
               + Y ++ T VF+    G  G +E D++ +FG   ++VY ++FV L +S L+ E +  
Sbjct  373  DACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENK--  430

Query  572  AESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  631
                 +K+IC   +++ VVG H  G  A E+ Q  G+A+K+G     + + V IHPT +E
Sbjct  431  -PKTAMKLICVG-KEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASE  488

Query  632  SFTTL  636
             F T+
Sbjct  489  EFVTM  493

>SDRG_03823
Length=497

 Score = 247 bits (631),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 257/477 (54%), Gaps = 20/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG + ++ AA++G KV V++           G+GGTCVNVGC+PKK+M  
Sbjct  7    YDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQ-GSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            +++  E+LH   A    N+   + GS   FDW  L    D Y+  +N  Y+  L +  + 
Sbjct  64   AAMHAEMLHSAHAYTFKNIQDVEYGS---FDWAALKKKRDAYVARLNGIYERNLGNNKIP  120

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMK  342
                   F+D HT+E+   R  +K I     +IAVGG P    +PG EHAISSD  F ++
Sbjct  121  LIYGAAKFVDNHTIEVNGDRYTAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFALE  175

Query  343  TKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSG  401
            T +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + +   ME  +G
Sbjct  176  T-QPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAG  233

Query  402  IEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVK  461
            + F+R++   SI K E+G L ++ T          F++VL A GR P    L L+   + 
Sbjct  234  VRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIA  293

Query  462  LNEKTGRIWVKHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
            L+          E T+ PN++A+GDV     ELTPVAI AGR L+ RL+ N     ++Y 
Sbjct  294  LSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYH  353

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T VF+    G  GL+E  +I+++G   ++VY + F  + +++S +     +   +K+
Sbjct  354  QIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDE--KQKTAMKL  411

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            +C    ++ V+G H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  412  MCIG-EEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PYAP_23435
Length=951

 Score = 256 bits (655),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 174/477 (36%), Positives = 257/477 (54%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK+M  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++   E L  +   +  N +        FDW  + T  D YI  +N  Y+  + +  +  
Sbjct  528  AAAHVEHLARN-GDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGIDL  586

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               + + +  + +E+       K  T + V++AVGG P    IPG EHAI SD  F +++
Sbjct  587  VQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKLES  641

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
             +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME + G+
Sbjct  642  -QPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-KHGV  699

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
             F+R++  + I K  +G+L +    +  +   E FD VL A GR+P    L LDKAGVKL
Sbjct  700  NFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGVKL  759

Query  463  NEKTGRIWV-KHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
            N+  G I V   E TS P +YAIGD      ELTPVAI AGR L+ RL+ N     + Y 
Sbjct  760  ND-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLHYH  818

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T VF+    G  G +E +++ +FG DK++VY + FV L  S++        +  +  
Sbjct  819  QIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTAMKLVC  878

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + D   D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT AE F T+
Sbjct  879  VGD---DEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>PPTG_18033
Length=500

 Score = 246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 173/489 (35%), Positives = 258/489 (53%), Gaps = 38/489 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  222  HQSSLIGEVLHHDSASFGW-NVSSGQ--GSAPIFDWKQLVTNVDGYIRGINFKYKVELRS  278
              ++ +   L HD   +G+ + ++G+  G    FDW +L    D Y+  +N  Y+  L +
Sbjct  77   FIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLAN  136

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338
              V+       F +   +E+       K++  ++V+IAVGG+P    IPG E  I SD  
Sbjct  137  SKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDIPGKELCIDSDGF  191

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  397
            F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD D+     E   
Sbjct  192  FELEIL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDAM  249

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
            V+ G+     +    + +  +G   V  T  DG S    +D V+ A GR P  + L LDK
Sbjct  250  VKDGVHLRPHSNVARVEQAADGTKTVVLT--DG-SEYNGYDVVMYAAGRVPLTSNLQLDK  306

Query  458  AGVKLNEKTGRIWVKH-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY---NNAT  513
            AGV  +E  G I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+   NN+ 
Sbjct  307  AGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGLNNSK  365

Query  514  VQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA-  572
            V   Y+ + T VF+    G  GL+E+ + +++G D ++VY + FV + + L  E   +  
Sbjct  366  VS--YENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVDESTG  423

Query  573  -----ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  627
                     +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  424  EPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  482

Query  628  TTAESFTTL  636
            T  E   TL
Sbjct  483  TAGEELVTL  491

>PHYKE_10327
Length=1200

 Score = 257 bits (656),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 171/487 (35%), Positives = 258/487 (53%), Gaps = 34/487 (7%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSA---PIFDWKQLVTNVDGYIRGINFKYKVELRS  278
              ++ +G  LHHD   +G+  ++  G       FDW +L T  D Y+  +N  Y+  L +
Sbjct  77   FIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERNLAN  136

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338
              V+      +F D   + +       K++  ++V+IAVGG+P    IPG E  I SD  
Sbjct  137  SKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPGKELCIDSDGF  191

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  397
            F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD  +   + + M+
Sbjct  192  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMK  250

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
             + G+   R +    + +  +G   +     DG S    +D V+ A GR P  + L LDK
Sbjct  251  -KDGVHLQRHSNIARVNQAADGTKTLVLA--DG-SEHSGYDVVIYAAGRVPLTSTLKLDK  306

Query  458  AGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-ATVQ  515
            AG+   +K G I V K ++TS   + A+GDV   P LTPVAI AGR LS RL+      +
Sbjct  307  AGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMGGAK  365

Query  516  MDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA---  572
            + Y+ + T VF+    G  GL+EE + +++G D I+VY + FV + + L  E        
Sbjct  366  VSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEMDETTGEP  425

Query  573  ---ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  629
                   +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + + IHPT 
Sbjct  426  KDKPKTAMKLVCAG-KDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCMAIHPTA  484

Query  630  AESFTTL  636
             E   TL
Sbjct  485  GEELVTL  491

>H310_14447
Length=501

 Score = 243 bits (619),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 265/479 (55%), Gaps = 23/479 (5%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ 
Sbjct  9    YDYIVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKKIMYN  65

Query  224  SSLIGEVLHH-DSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + +  E+LH     SF   V+   GS   FDW  +    D Y+  ++  Y+  L  + + 
Sbjct  66   AGVHAEILHSAKDYSFKDVVNVKFGS---FDWAAMKAKRDAYVNWLSAAYEEGLGEENID  122

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMK  342
            +      F+D HT+E+       ++ T   ++IAVGG P+   IPG EHA+SSD  F + 
Sbjct  123  HVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFFDLP  177

Query  343  TKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSG  401
            T +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + + + M  ++G
Sbjct  178  T-QPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAG  235

Query  402  IEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE--AFDSVLNATGRDPDIAKLDLDKAG  459
            + F+     +SI K  +G L V   ++ GE+  E   FD++++A GR P    + LDK  
Sbjct  236  VAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTH  293

Query  460  VKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNATVQ-MD  517
            V+L++    +    E T+   +YAIGDV     ELTPVAI AGR L+ RL+   T   + 
Sbjct  294  VELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIH  353

Query  518  YDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYV  577
            Y ++ T VF+    G  GL+E D+I ++G+D + VY + F  + ++L+T +    ++  +
Sbjct  354  YHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTA-M  412

Query  578  KVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            K++C  + +  V+G H  G  A E+ Q  G+A+KLG       + V IHPT AE   T+
Sbjct  413  KLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>PPTG_09787
Length=493

 Score = 242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 258/477 (54%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG+A ++ AA+FG KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++   E L+ +   +  N +S       FDW  + T  D YI+ +N  Y+  L +  V +
Sbjct  64   TAAHVEHLNRNK-DYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               +   +    +E+       +  T + V++A GG P    +PG EH I SD  F ++ 
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFFKLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R +    + K ENG+L    T    E     FD+++ A GR+P    L L++ GVKL
Sbjct  236  KFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEIGVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
            +E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+       ++Y 
Sbjct  296  SE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G  G +E ++I ++G++ I+VY + FV L  S++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAMKLVT  414

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>SPRG_11769
Length=453

 Score = 239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 166/476 (35%), Positives = 254/476 (53%), Gaps = 35/476 (7%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++ +   + HD+ ++G+            DW  L    D Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNT----TVDWATLKQRRDAYVTRLNGIYARNLQGSGVDF  111

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
             + L SF             GS      + ++AVGG+P    IPG EH ISSD  F +  
Sbjct  112  AHGLCSF-------------GSDGRRGDERLVAVGGQPVMPDIPGIEHCISSDGFFELDE  158

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGI  402
            + P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  159  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGI  216

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
                 +    + K++     +  T+  G+     FD VL ATGR P    L L+  G++L
Sbjct  217  TLQPHSTVARVDKVDPATGTLSLTTTAGDY-HTGFDCVLVATGRTPMTKHLGLEHRGIEL  275

Query  463  NEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-ATVQMDYDK  520
            +   G I V  ++ TS P ++A+GDV++   LTPVAI AGR L+ RL+      + DY  
Sbjct  276  SPN-GFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTS  334

Query  521  VCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVI  580
            + + VF+    G  GL+E+++ K + +D+I+VY + FV + +SL  E      +  +K+I
Sbjct  335  IPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLY-EHAHEKPTTAMKLI  393

Query  581  CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            C    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  394  CVGPTEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>SPRG_05609
Length=496

 Score = 240 bits (612),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 257/479 (54%), Gaps = 24/479 (5%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG + ++ AA++G KV +++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++L  E+LH   A    N+   +  +  FDW  L    D Y+  +N  Y+  L +  +  
Sbjct  63   AALHAEMLHSAHAYTFKNIQDVEYGS--FDWAALKKKRDAYVARLNGIYERNLGNNQIPL  120

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
                  F+D HT+E+   R  +K I     +IAVGG P    +PG EHAISSD  F ++T
Sbjct  121  VYGAAKFVDNHTVEVNGDRYTAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFALET  175

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
             +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME  +G+
Sbjct  176  -QPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGV  233

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA---FDSVLNATGRDPDIAKLDLDKAG  459
             F+R++   SI K  +G       S DG    ++   F++VL A GR P    L L+   
Sbjct  234  HFVRESGITSIEKAVDGY---ADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTD  290

Query  460  VKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMD  517
            + L+          E TS PN+YA+GDV     ELTPVAI AGR L+ RL+ N     ++
Sbjct  291  IALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACIN  350

Query  518  YDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYV  577
            Y ++ T VF+    G  GL+E  +I ++G + ++VY ++F  + +++S +     +   +
Sbjct  351  YHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDD--KQKTAM  408

Query  578  KVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            K+IC    ++ VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  409  KLICIG-EEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>SDRG_12187
Length=462

 Score = 238 bits (608),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 168/477 (35%), Positives = 254/477 (53%), Gaps = 28/477 (6%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++ +   + HD+ ++G+            DW  L    D Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNT----TVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDF  111

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               L SF     +++             +V++AVGG+P    IPG EH ISSD  F +  
Sbjct  112  AQGLCSFGSDGRVQI---DATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDE  168

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGI  402
            + P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  169  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRDGI  226

Query  403  EF-IRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVK  461
                  T+ +       G L V  T+ +  S    FD VL ATGR P    L L+  G++
Sbjct  227  TLQPHSTIARVDKDPTTGSLSVTTTAGEHHS---GFDCVLVATGRTPMTKDLGLEHRGIQ  283

Query  462  LNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNA-TVQMDYD  519
            L+   G I V  ++ TS P ++A+GDV+D   LTPVAI AGR L+ RL+      + DY 
Sbjct  284  LSPN-GFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYT  342

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
             + + VF+    G  GL+E+++ K +  D+++VY + FV + +SL  E      +  +K+
Sbjct  343  NIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLY-EHAHEKPTTAMKL  401

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            IC    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  402  ICVGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>PITG_14083
Length=493

 Score = 239 bits (609),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 166/477 (35%), Positives = 254/477 (53%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++   E L+ +   +  N +S       FDW  + T  D YI+ +N  Y+  L +  V +
Sbjct  64   AAAHVEHLNRNK-DYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               +   +    +E+       +  T + V++A GG P    +PG EH I SD  F ++ 
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
             F+R +    + K +NG+L    T +  E     FDS++ A GR P    L L++ GVKL
Sbjct  236  NFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
             E  G I V   E TS   +YAIGD  +   ELTPVAI AGR LS RL+       ++Y 
Sbjct  296  AE-GGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G  G +E ++I ++G++ ++VY + FV L  S++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLVT  414

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + D+   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGDK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>H257_17037
Length=498

 Score = 239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 158/462 (34%), Positives = 246/462 (53%), Gaps = 19/462 (4%)

Query  179  SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHH-DSAS  237
            +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ +    E+LH     S
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILHSAKDYS  79

Query  238  FGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLE  297
            F   V+   GS   FDW  +    D Y+  +   Y+  L  + + +     +F+D HT+E
Sbjct  80   FKEVVNVKFGS---FDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVE  136

Query  298  LWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYV  357
            +   R      T   ++IAVGG P+  TIPG EHAISSD  F + T +P K  VVGA Y+
Sbjct  137  VNGLR-----FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPT-QPKKVAVVGAGYI  190

Query  358  ALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKL  416
            A+E AG    +  D  V  R   +LR FD  + + + + M  +SG+ F+ ++  QSI K 
Sbjct  191  AVELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKE  249

Query  417  ENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQT  476
             +G L +  T  D  +    F+++++A GR P    + LDK  V+L+     +    E T
Sbjct  250  ADGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENT  309

Query  477  STPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NNATVQMDYDKVCTAVFTPIEYGCC  534
            + P +YAIGD  I   ELTPVAI AGR L+ RL+ + A   + Y ++ T +F+    G  
Sbjct  310  TVPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTI  369

Query  535  GLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHY  594
            GL+E ++I ++G+  +  Y ++F  L +SL        ++  +K++C  + +  VVG H 
Sbjct  370  GLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTA-MKLVCIGVEET-VVGAHV  427

Query  595  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
             G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  428  AGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PHYCA_504517
Length=493

 Score = 238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 163/477 (34%), Positives = 257/477 (54%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++   E L+ +   +  N +  +     FDW  +    D YI+ +N  Y+  L +  V +
Sbjct  64   TAAHVEHLNRNK-DYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANVDH  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               +   +    +++     G K  T + V++A GG P    +PG E+ I SD  F ++ 
Sbjct  123  VQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFFKLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R      + K +NG+L    T    E     FD++L A GR+P    L L++ GVKL
Sbjct  236  KFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEVGVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
            +E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+       ++Y 
Sbjct  296  SE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G  G +E ++++++G++ ++VY + FV L  S++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAMKLVT  414

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PYIW_25301
Length=512

 Score = 238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 168/492 (34%), Positives = 255/492 (52%), Gaps = 48/492 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  223  QSSLIGEVLHHDSASFGWNVSSGQ--GSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKY  280
             ++ +  +LH D+  +G+    G   G    F W +L    D YI  +N  Y+  L +  
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFW  340
            V        F     +E+       K+I  ++++IAVGG+P    IPG E  I SD  F 
Sbjct  151  VDLLTGTAVFNAHGNVEM-----DGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFE  205

Query  341  MKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ-------DMANKI  392
            ++ + P K  VVGA Y+A+E AG L G+G +  +  R   +LR FD+       D   K 
Sbjct  206  LE-QLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAKD  264

Query  393  GEYMEVQSGIEFIRKTVPQSITK-LENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIA  451
            G  +  QS +  + +T     T  L+NG            S    FD+V+ A GR P  +
Sbjct  265  GIVVRPQSNVARVEQTADGKKTLFLQNG------------SEHAGFDTVIYAAGRVPLTS  312

Query  452  KLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  510
            +L+L  AG+   +K G I V +++ TS  N++A+GDV     LTPVAI AGR LS RL+ 
Sbjct  313  ELNLSAAGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFG  371

Query  511  N-ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETR  569
              A  ++ YD + T VF+    G  GL+E ++ ++ G  +I+ Y + FV + + L  +  
Sbjct  372  GMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVD  431

Query  570  AAAES-----CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  624
            A   +       +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V 
Sbjct  432  ADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVA  490

Query  625  IHPTTAESFTTL  636
            IHPT  E   T+
Sbjct  491  IHPTAGEELVTM  502

>CCA23647
Length=496

 Score = 237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 160/468 (34%), Positives = 246/468 (53%), Gaps = 25/468 (5%)

Query  180  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSA---  236
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++    V H + A   
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAA--AHVEHIERAPDY  76

Query  237  SFGWNVSSGQGSAPI----FDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFID  292
            S     S G  S       FDW ++    D YI  +N  Y   L +  +     +   I 
Sbjct  77   SIRPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIA  136

Query  293  PHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVV  352
               +++            + ++IAVGG P   +IPG EHAI SD  F ++T +P K  VV
Sbjct  137  KDRVQVNQ----DSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLET-QPKKVAVV  191

Query  353  GASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQ  411
            GA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+ F+RK+  +
Sbjct  192  GAGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLE  250

Query  412  SITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWV  471
             I K E+ +L +     D       FD ++ A GR P    L L+  GV+LNE TG I V
Sbjct  251  KIVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNE-TGHIIV  309

Query  472  K-HEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNATVQ-MDYDKVCTAVFTP  528
               E TS P +YA+GDV     ELTPVAI AGR L+ RL+NN     + Y ++ T VF+ 
Sbjct  310  DAQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSH  369

Query  529  IEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKF  588
               G  G +E ++I ++G++ ++ Y + FV L +S++ +     ++C +K++C   ++  
Sbjct  370  PPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-  427

Query  589  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            VVG H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  428  VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYRA_71927
Length=485

 Score = 236 bits (602),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 166/494 (34%), Positives = 251/494 (51%), Gaps = 48/494 (10%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  222  HQSSLIGEVLHHDSASFGW--NVSSGQ-GSAPIFDWKQLVTNVDGYIRGINFKYKVELRS  278
              ++ +   L HD   +G+    + G  G    FDW +L    D Y+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  338
              V+  +    F +   +E+       K++  ++V++AVGG+P    IPG E  I SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFD-------QDMAN  390
            F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD       +D   
Sbjct  177  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMA  235

Query  391  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDI  450
            K G ++   S +  + +    + T      L++   SE        +D V+ A GR P  
Sbjct  236  KDGVHLRPHSNVTRVEQVADGTKT------LVLADGSE-----HSGYDVVIYAAGRVPLT  284

Query  451  AKLDLDKAGVKLNEKTGRIWVKH-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  509
            + L LD A +   +K G I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+
Sbjct  285  SNLQLDNADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLF  343

Query  510  NNAT-VQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTET  568
                  ++ Y+ + T VF+    G  GL+EE + +++G D  +VY + FV + + L  E 
Sbjct  344  GGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEV  403

Query  569  RAAA------ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDT  622
              A           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + 
Sbjct  404  DEATGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNC  462

Query  623  VGIHPTTAESFTTL  636
            + IHPT  E   TL
Sbjct  463  IAIHPTAGEELVTL  476

>PHYSO_550665
Length=491

 Score = 236 bits (602),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 165/477 (35%), Positives = 253/477 (53%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++   E L  +   +  N ++       FDW  + T  D YI+ +N  Y+  L +  V +
Sbjct  64   AAAHVEHLARNK-DYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAQVDH  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               +   +    +E+       K  T + V++A GG P    +PG EH I SD  F ++ 
Sbjct  123  VQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFFKLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R      + K  +G+L    T    E     FD++L A GR+P    L L++ GVKL
Sbjct  236  KFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGLEEVGVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
            +E  G I V   E TS P +YAIGD  I   ELTPVAI AGR LS RL+       ++Y 
Sbjct  296  SE-GGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G  G +E +++ ++G++ ++ Y + FV L  S++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAMKLVT  414

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>CCI11048
Length=496

 Score = 234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 161/470 (34%), Positives = 250/470 (53%), Gaps = 29/470 (6%)

Query  180  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSAS--  237
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++    V H + AS  
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAA--AHVEHIERASDY  76

Query  238  -----FGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFID  292
                      +S   S   FDW ++ T  D YI  +N  Y   L +  +     +   I 
Sbjct  77   SIRPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIA  136

Query  293  PHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVV  352
               +++            + ++IAVGG P   ++PG EHAI SD  F ++T +P K  VV
Sbjct  137  KDRVQVNQ----DSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLET-QPKKVAVV  191

Query  353  GASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQ  411
            GA Y+A+E AG    +  D  V  R   +LR FD  + + + E ME + G+ F+RK+  +
Sbjct  192  GAGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVRKSHLE  250

Query  412  SITKLENGQLLVKWTSEDGESCE--EAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRI  469
             ITK ++ +L +  T+  GE  +    FD ++ A GR P    L L++ GV LNE TG I
Sbjct  251  KITKAKDDKLAI--TARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNE-TGHI  307

Query  470  WVK-HEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNATVQ-MDYDKVCTAVF  526
             V   E TS P +YA+GDV     ELTPVAI AGR L+ RL+NN     + Y ++ T VF
Sbjct  308  IVDAQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVF  367

Query  527  TPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRD  586
            +    G  G +E ++I ++G++ ++ Y + FV L +S++ +     ++  +K++C   ++
Sbjct  368  SHPPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCVGSKE  426

Query  587  KFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
              VVG H  G  A E+ Q  G+AMK+G T     + V IHPT +E   T+
Sbjct  427  T-VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYRA_72037
Length=493

 Score = 234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 164/477 (34%), Positives = 253/477 (53%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++   E LH +   +    ++   +   FDW  +    D YI  +N  Y+  L +  V +
Sbjct  64   AAAHVEHLHRNE-DYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDH  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               + + +    +E+       K  T + V++A GG P    +PG EH   SD  F ++ 
Sbjct  123  VQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFFRLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + + ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R T    + K ++G+L    T +  E     FD +L A GR+P    L L+K GVKL
Sbjct  236  KFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVGVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNATVQMDYD  519
             +  G I V   E TS P +YAIGD      ELTPVAI AGR LS RL+       ++Y 
Sbjct  296  AD-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G  G +E +++ +FG++ ++VY + FV L  S++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMKLVT  414

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  415  VGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHALS_09136
Length=493

 Score = 231 bits (588),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 164/477 (34%), Positives = 250/477 (52%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG+A ++ AA+ G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            +++  E L+ +   +  N  +       FDW  + T  D YI+ +N  Y+  L +  V  
Sbjct  64   TAVHVEHLNRNK-DYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNAQVDV  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               +   +    +++          T + V++A GG P    IPG EH I SD  F ++ 
Sbjct  123  IQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFFKLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            EF+R      I K  + +L    T    E     FD++L A GR P    L L++ GVKL
Sbjct  236  EFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIGVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYN-NATVQMDYD  519
             +  G I V   E T+ P +YAIGDV +   ELTPVAI AGR L+ RL+       ++Y 
Sbjct  296  ADG-GYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G  G +E ++I RFGK+ I++Y + FV L  +++   R    +  +  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAMKLVT  414

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            + +   ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  415  VGE---EETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>PHYCA_7619
Length=462

 Score = 228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 165/475 (35%), Positives = 243/475 (51%), Gaps = 36/475 (8%)

Query  176  LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHD  234
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   LHHD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  235  SASFGWN--VSSGQ-GSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFI  291
               +G+   V+ G  G    FDW +L    D Y+  +N  Y+  L +  V        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  292  DPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLV  351
                +E+       K+I   +V+IAVGG+P    IPG E  I SD  F ++T  P K  V
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETL-PKKVAV  165

Query  352  VGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFI-RKTV  409
            VGA Y+A+E AG L  +G +  +  R   +LR FD  +   + + ME + G+       V
Sbjct  166  VGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHLCPHSNV  224

Query  410  PQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRI  469
             +     +N + LV     DG S    ++ V+ A GR P    L LDKAGV   +  G I
Sbjct  225  VRVEQAADNTRTLV---LADG-SEHSGYEVVIYAAGRVPLTTSLQLDKAGVT-TDNHGFI  279

Query  470  WV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNAT-VQMDYDKVCTAVFT  527
             V +++QTS  N++A+GD    P LTPVAI AGR LS RL+      ++ Y+ + T VF+
Sbjct  280  QVDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFS  339

Query  528  PIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA------ESCYVKVIC  581
                G  GL+E  +  ++G D+I+VY + FV + + L  E               +K++C
Sbjct  340  HPPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC  399

Query  582  DRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
               +D+ VVG H +G  A E+ Q  G+A+K+G T     D + IHPT  E   TL
Sbjct  400  AG-KDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>PITG_13427
Length=463

 Score = 228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 166/478 (35%), Positives = 246/478 (51%), Gaps = 41/478 (9%)

Query  176  LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHD  234
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   L HD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  235  SASFGW--NVSSGQ-GSAPIFDWKQLVTNVDGYIRGINFKY-KVELRSKYVKYENFLGSF  290
               +G+    + G  G    FDW +L    D Y+  +N  Y +  L +  V+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  291  IDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTL  350
             +   +E+     G K++  ++V+IAVGG+P    +PG E  I SD  F ++T  P K  
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETL-PKKVA  165

Query  351  VVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTV  409
            VVGA Y+A+E AG L  +G D  +  R   +LR FD D+     E    + G+       
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD-DIVRTTLEDAMAKEGVHL----R  220

Query  410  PQS-ITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGR  468
            P S + ++E G    K       S    +D V+ A GR P  + L LDKAG+  +E  G 
Sbjct  221  PHSNVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTDEH-GF  279

Query  469  IWVKH-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY---NNATVQMDYDKVCTA  524
            I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+   N+A V   Y+ + T 
Sbjct  280  IPVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVS--YENIPTV  337

Query  525  VFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA------ESCYVK  578
            VF+    G  GL+EE + +++G D I+VY + FV + + L  E   +           +K
Sbjct  338  VFSHPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMK  397

Query  579  VICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            ++C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT  E   TL
Sbjct  398  LVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>H310_11259
Length=519

 Score = 227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 168/484 (35%), Positives = 267/484 (55%), Gaps = 29/484 (6%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+GGGSGG+A ++ AAS+G KV V   V+        GLGGTCVNVGC+PKK+M+ 
Sbjct  29   YDYIVLGGGSGGIASARRAASYGAKVLV---VERGRTLGGAGLGGTCVNVGCVPKKVMYN  85

Query  224  SSLIGEVLHHDSASFGWNVSSGQ--GSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++ + E++ H + ++ +    G   GS   FDW  + +  D Y+  ++  Y+  L    +
Sbjct  86   AAFLAEIM-HSAKTYTFKGVQGVEFGS---FDWPAMKSKRDAYVTRLHGIYERNLAKDGI  141

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWM  341
               + + +F+D HT+ +     G+K  T   +++AVGG P+  +IPG E AISSD  F +
Sbjct  142  SLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPGIELAISSDGFFAL  196

Query  342  KTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQS  400
            +T +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + + M  ++
Sbjct  197  ET-QPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RA  254

Query  401  GIEFIRKTVPQSITKLENGQLLVKWT--SEDGESCEEAF---DSVLNATGRDPDIAKLDL  455
            G+ F+ ++   SI K  NG L ++ T   E+G +  + F   D+V+ A GR P       
Sbjct  255  GVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGF  314

Query  456  DKAGVKLNEKTGRIWVK-HEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NNA  512
            D+  +  + K G I V   E T+ P +YAIGD      ELTPVAI AGR L+ RL+    
Sbjct  315  DRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEP  373

Query  513  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA  572
               ++Y ++ T VF+    G  G +E D+I ++G   ++VY ++FV L ++L        
Sbjct  374  DACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKD--M  431

Query  573  ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  632
             S  +KV+C   +++ VVG H  G  A E+ Q  G+A+K+G     + + + IHPT +E 
Sbjct  432  PSTAMKVVCVG-KEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEE  490

Query  633  FTTL  636
              T+
Sbjct  491  LVTM  494

>HYAP_08763
Length=473

 Score = 225 bits (573),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 147/465 (32%), Positives = 245/465 (53%), Gaps = 21/465 (5%)

Query  176  LACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDS  235
            +A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK+M  ++    V H + 
Sbjct  1    MASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTA--AHVEHLNR  55

Query  236  ASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHT  295
            A   +++ + + +   FDW ++ T  D YI  +   Y+  L +  V +   +  F+  + 
Sbjct  56   AK-DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNK  114

Query  296  LELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGAS  355
            +++       +  T + V+IA GG P +  +PG  H I SDD F ++ ++P K  VVGA 
Sbjct  115  VQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLE-QQPQKVAVVGAG  168

Query  356  YVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT  414
            Y+A+E AG    +  D  +  R   +LR F+  + + + E ME ++G+ F+R      + 
Sbjct  169  YIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVE  227

Query  415  KLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVK-H  473
            K  +G+L +     + E     FD++L A GR P    L L+  GVKL E  G I V   
Sbjct  228  KQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKLAE-GGFIQVDAQ  286

Query  474  EQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYN-NATVQMDYDKVCTAVFTPIEY  531
            E TS P +YAIGD  +   ELTPVAI AGR L+ RL+       ++Y ++ + +F+    
Sbjct  287  ENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPI  346

Query  532  GCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVG  591
            G  G +E +++ ++G++ ++VY + FV L  S++        +  +  + ++   + VVG
Sbjct  347  GTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGEQ---ETVVG  403

Query  592  FHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
             H  G  A E+ Q  G+A+K+  T     + V IHPT +E   T+
Sbjct  404  VHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PYU1_G001739
Length=266

 Score = 217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 122/162 (75%), Gaps = 0/162 (0%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+++ P PFF+VDG D Q   LA+L+ QG+NTS +   +M+Q+GY++LRA++DDE LY+V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
              +A+FECG T P  E+QPIPT  + +++GYT DGPCE+WLDD KV SG NCH +FP   
Sbjct  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853
              +DYSSC GSC L WYWLG++Y++  YSWQ+YK CV LS N
Sbjct  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDN  186

>PHYKE_6836
Length=493

 Score = 220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 162/477 (34%), Positives = 252/477 (53%), Gaps = 19/477 (4%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKKVMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            +++  E L  +   +  N +        FDW  + T  D YI  +N  Y+  L+++ V +
Sbjct  64   TAMHVEHLARNR-DYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  122

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
               +   +    +++       +  T +++++A GG P     PG EH I SD  F ++ 
Sbjct  123  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLE-  176

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  402
            ++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  177  QQPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  403  EFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKL  462
            +F+R +    + K  +G+L    T +  E     FD++L A GR P    L L++  VKL
Sbjct  236  KFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEINVKL  295

Query  463  NEKTGRIWVK-HEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYN-NATVQMDYD  519
            ++  G I V   E TS   +YAIGD      ELTPVAI AGR LS RL+       ++Y 
Sbjct  296  SQD-GFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
            ++ T +F+    G CG +E +++++FG++ I+ Y + FV L  S++   R    +     
Sbjct  355  QIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAMK---  411

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            +     ++ VVG H  G  A E+ Q  G+AMK+  T     + V IHPT AE   T+
Sbjct  412  LVCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVTM  468

>PYU1_G001738
Length=226

 Score = 203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)

Query  694  VLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTE  753
            VL+P PF++VDG + Q   +A+L+EQGI TS +   +M+Q+GY++LRAMLDD+ LY V  
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  754  EAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQ  813
            +A+ ECG T P  E+QPIP  N+F ++GY L+GPCE+WLDD KV S  NCHT++P     
Sbjct  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144

Query  814  VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853
            +DYSSC GSC L WYWLGI+ V   YSWQVYK CV L  N
Sbjct  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184

>PYVX_21517
Length=482

 Score = 211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 157/499 (31%), Positives = 246/499 (49%), Gaps = 78/499 (16%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            ++DL+VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  27   EFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKKIM  77

Query  222  HQSSLIGEVLHHDSASFGWN--VSSGQ--GSAPIFDWKQLVTNVDGYIRGINFKYKVELR  277
            +  + +   LH D+  +G+    S G+  G+   FDW++L    D Y+  +N  Y+  L 
Sbjct  78   YTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERNLA  137

Query  278  SKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIP----GGEHAI  333
            +  V+       F     +E+        ++  + V++AVGG+P    IP    G E  I
Sbjct  138  NSKVELLTGTARFNVDGKIEV-----DGVEVRAKKVLLAVGGKPLIPDIPVAATGKELCI  192

Query  334  SSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKI  392
             SD  F ++ + P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD   +   
Sbjct  193  DSDGFFELE-QLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNS---  248

Query  393  GEYMEVQSGIEFIRKTVPQSI----------TKLENGQLLVKWTS----EDGESCEEAFD  438
             +++   S  E +R T+  ++          + +E  +L    T      DG S    F+
Sbjct  249  -QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADG-STHTGFE  306

Query  439  SVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVA  497
            SV+ A GR P    L LD AGV  +E+ G I V +++QT+ P+I A+GD      LTP++
Sbjct  307  SVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTPIS  365

Query  498  IQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNF  557
                                Y+ V T VF+    G  GL+E+ +  +FG ++I++Y + F
Sbjct  366  --------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTF  405

Query  558  VPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  617
            V + + +  E   A              D+ +VG H +G  A E+ Q  G+A+K+G T  
Sbjct  406  VNMYYGVVNELVCAGP------------DEKIVGLHVIGMGADEMLQGFGVAVKMGATKA  453

Query  618  QMVDTVGIHPTTAESFTTL  636
             +   V IHPT AE   T+
Sbjct  454  DLDSCVAIHPTGAEELVTM  472

>PHYKE_8390
Length=130

 Score = 197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)

Query  680  GQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSL  739
            GQRRL A LGEGQIVL PPPFF+VDGLDFQGMALAYLQEQG+NTSIE Q WM   GY SL
Sbjct  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78

Query  740  RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  788
            RAMLDDE+LYKVTEEA+F+CGLTSP+TETQ IPTN++FQTSGYT+DGPC
Sbjct  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>HYAP_04843
Length=430

 Score = 205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 213/418 (51%), Gaps = 24/418 (6%)

Query  231  LHHDSASFGWNVSSGQGSAPI---FDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFL  287
            L HD   +G+      GS      FDW +L T  D Y+R +N  Y+  L S  V++    
Sbjct  5    LQHDVVHYGFEKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGS  64

Query  288  GSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPG  347
              F     +E+       K++  ++V+IAVGG+P    IPG E  I SD  F + T  P 
Sbjct  65   ARFNKQGNVEV-----DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTL-PK  118

Query  348  KTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIR  406
            K  V+GA Y+A+E AG L  +G +  +  R   +LR FD  +   + + M +  G+    
Sbjct  119  KVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID-GLHLRP  177

Query  407  KTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKT  466
             +    + +  +G   +  T  DG S    FD V+ A GR P   KLDLD AGV  N K 
Sbjct  178  NSNVARVEQAADGTNTLVLT--DG-SAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KH  233

Query  467  GRIWVKH-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNAT-VQMDYDKVCTA  524
            G I V   ++TS   ++A+GDV   P LTPVA+ AGR LS RL+ N    ++ Y+ + T 
Sbjct  234  GYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTV  293

Query  525  VFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA------ESCYVK  578
            VF+    G  GL+E+ +  ++G D I+VY ++FV + + L  E   A           +K
Sbjct  294  VFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIK  353

Query  579  VICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            ++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT +E   TL
Sbjct  354  LVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYIW_18788
Length=244

 Score = 188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 115/165 (70%), Gaps = 3/165 (2%)

Query  694  VLHPPPFFVVDGLDFQGMA-LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVT  752
            V +P PFF++DG D++  A +A L++Q + TS +   +++Q+GY+SLRAMLDDE+LY V 
Sbjct  30   VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88

Query  753  EEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQH  812
             ++IFECG T P  E+QPIPTN   + +GY  DGPCEIW+DD K+ S  NC  +FP    
Sbjct  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148

Query  813  QVDYSSCGGSCHLSWYWLGI-KYVEGIYSWQVYKNCVGLSKNPTA  856
            ++DYSSC G C L WY L + K   G YSW+VYKNCV LS  PTA
Sbjct  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTA  193

>PYIR_23431
Length=468

 Score = 193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 144/459 (31%), Positives = 218/459 (47%), Gaps = 40/459 (9%)

Query  180  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFG  239
            + AA++G KV V   V+   +    GLGGTCVN GC+PKK+M  +S   E L+ ++    
Sbjct  23   RRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADYSI  79

Query  240  WNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELW  299
                S +     FDW  + T  D YI  +N  Y+  L +  V     +   +  + +E+ 
Sbjct  80   TTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQIEV-  138

Query  300  HPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVAL  359
                     T + +++AVGG+P    IPG EH I SD  F ++  +P K  VVGA Y+A+
Sbjct  139  ----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEA-QPKKVAVVGAGYIAI  193

Query  360  ECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLEN  418
            E AG    +  D  +  R   +LR FD  + + I E  E ++GI F+R +  + I K  +
Sbjct  194  ELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQAD  252

Query  419  GQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTST  478
            G L +    +  E     FD++L A GR+P    L L++ GVKL +    +    E TS 
Sbjct  253  GTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENTSV  312

Query  479  PNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLS  537
            P IYAIGD  I   ELTP+                          T VF+    G  G +
Sbjct  313  PGIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTIGYT  347

Query  538  EEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGP  597
            E  +I++FG + ++VY + FV L ++++        +     +     D+ VVG H  G 
Sbjct  348  EPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTAMK---LVTVGEDEVVVGVHVAGE  404

Query  598  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
             A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  405  GADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYIR_25089
Length=262

 Score = 184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 115/176 (65%), Gaps = 0/176 (0%)

Query  676  ACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQG  735
            A V+     D  +   Q V+ P P F V     Q   LA+L+ QG  T+ +  ++ + +G
Sbjct  13   AIVSSAALYDTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKG  72

Query  736  YSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDT  795
            Y +LRA +DD+S YKV + A FECG T      QPIP+ ++ +++GYT DGPCE+WLD T
Sbjct  73   YKTLRAFMDDKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKT  132

Query  796  KVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            +V  G NCH+EFP    ++DYSSC GSC L WYW+GI++++G YSWQVYKNCV ++
Sbjct  133  RVLKGTNCHSEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVT  188

>PYU1_G001740
Length=206

 Score = 181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 109/161 (68%), Gaps = 2/161 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+V+ P P F V   D +   LA+L+ QG  T+ +  ++ + +GY SLRA +DD+  YKV
Sbjct  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A FECG T+     QPIP N  F+T+GYT DGPCE+WLD+TKV SG NCH +FP   
Sbjct  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSK  852
            H + Y++C GSC L WYW+GI++++G +SWQVYK CV L +
Sbjct  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGR  187

>PYAR_17714
Length=444

 Score = 186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 146/477 (31%), Positives = 234/477 (49%), Gaps = 62/477 (13%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  224  SSLIGEVLHHDSASFGWNVSSG-QGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            ++     + H + +  +++ SG +     FDW  +    D YI  +N  Y+  + +  + 
Sbjct  64   AA---SHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKID  120

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMK  342
                + S      + +      +     + +++AVGG P    IPG EHAI SDD F +K
Sbjct  121  LIEGIASLTAKDAVTV---DGKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFKLK  177

Query  343  TKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSG  401
            T +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + +   M+ + G
Sbjct  178  T-QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHG  235

Query  402  IEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVK  461
            + F+R++   +I K  +G+L V+ T +  ++    FD VL A GR+P    L L+  GVK
Sbjct  236  VHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVK  295

Query  462  LNEKTGRIWV-KHEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNATVQMDYD  519
            L++  G I V K E TS   +YAIGD      ELTP                        
Sbjct  296  LSD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTP------------------------  330

Query  520  KVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKV  579
                                +++++FG D ++VY + FV L ++++     +  +  +K+
Sbjct  331  -------------------PEAVEKFGADHVKVYTSTFVNLLYAMADPDHKSKTA--MKL  369

Query  580  ICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            +C    ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHPT AE   T+
Sbjct  370  VCVG-ENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PPTG_10635
Length=199

 Score = 175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 105/160 (66%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  D +   LA+L+ QG  T  + +SW  + GY SLR  +D  + Y+V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  70

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP  N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + VDYSSC GSC L WYWLG+++++  YSWQVYK C+ L+
Sbjct  131  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLT  170

>PHYRA_84190
Length=206

 Score = 174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 105/160 (66%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  D  D +   LA+L+ +G  T  +  +W  + GY SLR  +D+ + Y V
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP +N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  130

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + VDYSSC G+C L WYW+G+++++  YSWQVYK C+ L+
Sbjct  131  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLT  170

>PHYRA_85631
Length=228

 Score = 174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   LA+L+ +G  T  +  SW  + GY SLR  +D+ + Y V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
             + A F CG T P+   QPIP  N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + VDYSSC G+C L WYWLGI++++  YSWQVYK C+ L+
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLT  187

>PHYCA_14369
Length=248

 Score = 174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 103/160 (64%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  D +   LA+L+ QG  T  +  +W  + GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP  N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + VDYSSC G+C L WYWLG+++++  YSWQVYK C+ L+
Sbjct  148  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLA  187

>PYU1_G001744
Length=213

 Score = 172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 105/157 (67%), Gaps = 1/157 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V+ P P F V     Q   LA+L+ QG  T+ +  ++ + +GY SLRA +DD+  YKV
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A F+CG T    + QPIP   + +++GYT DGPCE+WLD+T V  G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            H++ Y+SC GSC L WYW+GI++++G YSWQVYKNCV
Sbjct  148  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCV  184

>PYU1_G001742
Length=213

 Score = 172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 106/159 (67%), Gaps = 1/159 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V+ P P F V     Q   LA+L+ QG  T+++  ++ + +GY +LRA +DD   YKV
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A F+CG T    + QPIP   + +++GYT DGPCE+WLD T+V  G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
             ++DYSSC GSC L WYW+GI++++G YSWQVYKNCV +
Sbjct  148  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PPTG_10636
Length=246

 Score = 173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  D +   LA+L+ QG  T  +  SW  +  Y SLR  +D+ + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP  N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + VDYSSC G+C L WYWLGI++++  YSWQVYK C+ LS
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  187

>PHYSO_536424
Length=197

 Score = 171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 107/175 (61%), Gaps = 1/175 (1%)

Query  682  RRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRA  741
            RR    +   QIVL P P +  +  + +   LA+L+ +G  T  +  +W ++ GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  742  MLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGR  801
             +D  + Y VT  A F CG T P+   QPIP  N  +++GYT DGPCE+WLDDT V  G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  802  NCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            NCH +FP   + VDYSSC G+C L WYWLG+++++  YSWQVYK C+ L+    A
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYSO_507031
Length=197

 Score = 171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 107/175 (61%), Gaps = 1/175 (1%)

Query  682  RRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRA  741
            RR    +   QIVL P P +  +  + +   LA+L+ +G  T  +  +W ++ GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  742  MLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGR  801
             +D  + Y VT  A F CG T P+   QPIP  N  +++GYT DGPCE+WLDDT V  G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  802  NCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            NCH +FP   + VDYSSC G+C L WYWLG+++++  YSWQVYK C+ L+    A
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYSO_341599
Length=185

 Score = 170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 104/165 (63%), Gaps = 1/165 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  + +   LA+L+ QG  T  +  +W ++ GY SLR  +D  + Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  70

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP  N  +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            + VDYSSC G+C L WYWLG+++++  YSWQVYK C+ L+    A
Sbjct  131  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMA  175

>PPTG_10634
Length=208

 Score = 171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 105/159 (66%), Gaps = 1/159 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  + +   LA+L+ +G  T  +  +W ++ GY SLR  LD+   Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A F+CG T P+   QPIP  N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
            + VDYSSC G+C L WYWLG+++++  YSWQVYK C+ L
Sbjct  148  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PYU1_G001741
Length=199

 Score = 169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 1/157 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V+ P P F V     Q   LA+L+ QG  T+ +  ++ + +GY +LRA +DD+  Y V
Sbjct  28   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A FECG T      Q IP   + +++GYT DGPCE+WLD T+V  G NCHTEF    
Sbjct  88   ASGADFECGWTKLDGTRQSIPAG-TIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            H +DYSSC GSC L WYW+GI++++G YSWQVYKNCV
Sbjct  147  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCV  183

>PHYCA_102852
Length=195

 Score = 169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  D +   LA+L+ +G  T  +  +W  + GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A F+CG T P    QPIP  N+ +++GYT DGPCE+WLDDT V  G NCH +FP   
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC G+C L W+WLG+++++  YSWQVYK C+ L+
Sbjct  148  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLT  187

>PHYCA_102624
Length=195

 Score = 168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 101/160 (63%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D Q   L +L+  G  T  +  +W ++ GY SLR  +D+   Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            +E A F+CG T P    QPIP  N+ +++GYT DGPCE+W+DDT V  G NCH +FP   
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYS C G C L WYWLG+++++  YSWQVYK C+ L+
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLT  187

>PPTG_10048
Length=190

 Score = 166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 105/164 (64%), Gaps = 1/164 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VLHP P ++ D  D Q   LA+L+ QG  T  + +SW  Q GY +LR  ++  + Y V
Sbjct  26   QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A F CG T+P+   QPIP     +++GYT +GPCE+W+ DT+V    NCH   P  +
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  144

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPT  855
            + +DYS C G+C L WYWLG+++++  YSWQVYK C+ L+ N T
Sbjct  145  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNST  188

>PHYCA_102550
Length=268

 Score = 167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 100/160 (63%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D Q   LA+L+ QG  T  +  +W  + GY SLR  +D  + Y V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A F+CG T P    QPIP  N+ +++GYT DGPCE+W+DDT V  G NCH +FP   
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYS C G C L WYWLG+++++  YSWQVYK C+ L+
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLA  187

>PYVX_16175
Length=446

 Score = 172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 137/462 (30%), Positives = 216/462 (47%), Gaps = 64/462 (14%)

Query  180  KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFG  239
            + AAS G KV +++  + +      GLGGTCVN GC+PKK+M  ++    V H + A   
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAA--AHVEHLNRAGDY  77

Query  240  WNVSSGQGSAPI--FDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLE  297
               + G+       FDW  + T  D YI  +N  Y+  L +  +     +   +  + LE
Sbjct  78   SVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQLE  137

Query  298  LWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYV  357
            +       K  T +++++A GG P    IPG EHAI SD  F ++ ++P K  VVGA Y+
Sbjct  138  V-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLE-QQPRKVAVVGAGYI  191

Query  358  ALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKL  416
            A+E AG    +  +  +  R   +LR FD  + + +   ME ++G++F+R++    I KL
Sbjct  192  AVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKL  250

Query  417  ENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVK-HEQ  475
            E+G+L +    +        FD+VL A GR+P  A L L+  GV L++K G I V   E 
Sbjct  251  EDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQEN  309

Query  476  TSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCC  534
            TS   +YAIGD      ELTP                                       
Sbjct  310  TSAAGVYAIGDATTTGWELTP---------------------------------------  330

Query  535  GLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHY  594
                 D++ ++G + ++VY + FV L  +++        +  +  +  +   + VVG H 
Sbjct  331  ----PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAMKLVTVGAQ---ETVVGVHV  383

Query  595  LGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
             G  A E+ Q  G+A+KLG T     + V IHPT +E   T+
Sbjct  384  AGEGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>PHYRA_82864
Length=193

 Score = 163 bits (412),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 103/160 (64%), Gaps = 2/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   LA+L+ QG  T  +  +W +  GY +LR  +D  + Y V
Sbjct  29   QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A + CG T P    QPIP  N  +++GYT DGPCE+WLD+T+V  G NCH +FP   
Sbjct  88   TEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKD  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC G+C L WYW+G+++++  YSWQVYK C+ L+
Sbjct  147  YPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLT  186

>PHALS_00498
Length=199

 Score = 162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 107/169 (63%), Gaps = 1/169 (1%)

Query  684  LDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAML  743
            L   +   QIVL P P +  +  D +   LA+L+ Q   T+ +AQ++ +Q  + +LR  +
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  744  DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNC  803
            D+   Y V + A   CG T P    QPIP NN+ +++GYT DGPCE+WL++T+V S  NC
Sbjct  81   DNAK-YTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  139

Query  804  HTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSK  852
            H +FP   + +DYSSC  +C L WYWLG+++++  YSWQVYK C+ LS+
Sbjct  140  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSR  188

>PPTG_15264
Length=194

 Score = 162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 101/165 (61%), Gaps = 3/165 (2%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  D  D +   LA+L+ QG  T  +  +W +  GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A + CG T P+   QPIP   + +++GYT DGPCE+WLDD +V  G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  812  HQVDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNP  854
            + +DYSSC   G C L WYWLG+++++  YSWQVYK C+ L+  P
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTP  189

>PPTG_17366
Length=194

 Score = 162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 101/165 (61%), Gaps = 3/165 (2%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  D  D +   LA+L+ QG  T  +  +W +  GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A + CG T P+   QPIP   + +++GYT DGPCE+WLDD +V  G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  812  HQVDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNP  854
            + +DYSSC   G C L WYWLG+++++  YSWQVYK C+ L+  P
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTP  189

>PHYKE_8388
Length=205

 Score = 161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 100/160 (63%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D    +   LA+L++QG +T  +  +W    GY+SLRA  DD S Y V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            ++ A F CG T      QPIP +N+ +++GYT DGPCE+WLDDT V    NCH       
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC  +C L W+W+G++Y++  YSWQVYK CV LS
Sbjct  148  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLS  187

>PHYKE_8389
Length=204

 Score = 161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 100/160 (63%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   LA+L+ QG  T  +  +W +  GY +LRA +D    Y V
Sbjct  28   QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTV  86

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A + CG T+     Q IP+ N+ +++GYT DGPCE+WLD T+V +  NCH       
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC G+C L WYWLG+++++  YSWQVYK CV LS
Sbjct  147  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186

>PHYSO_477820
Length=202

 Score = 160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 100/165 (61%), Gaps = 1/165 (1%)

Query  689  GEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESL  748
            G  Q+VL P P +  D    +   LA+L++QG  T  +  +W    GY SLRA  D  S 
Sbjct  23   GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS-  81

Query  749  YKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFP  808
            Y V + A F CG T+   E QPIP +N+ +++GYT DGPCE+WLDDT V    NCH    
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  809  HGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853
               + +DYSSC  +C L W+WLG++Y++  YSWQ+YK CV LS +
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTS  186

>PYIR_26626
Length=212

 Score = 160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 109/174 (63%), Gaps = 2/174 (1%)

Query  676  ACVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQG  735
            A V+     D+ +   Q V+ P P F     +     LA+L+ QG  T+ +   +++ +G
Sbjct  13   AIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKG  72

Query  736  YSSLRAMLDDESLYKVTEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDD  794
            Y +LRA +DD+  YKV    A FECG T+   + QPIP   + +++GYT DGPCE+WLD+
Sbjct  73   YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDN  131

Query  795  TKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            TKV SG NC+ +FP   H + Y+SC GSC L WYW+G+++++  +SWQVYK CV
Sbjct  132  TKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185

>PPTG_10643
Length=250

 Score = 162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  D +   LA+L+ QG     +  +W ++ GY SLR  +D  + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T+P+   QPIP     +++GYT DGPCE++LDDT V  G NCH +FP   
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
              +DYSSC G+C L WYWLGI++++  YSWQVYK C+ L
Sbjct  148  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PHYCA_129425
Length=204

 Score = 159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 101/162 (62%), Gaps = 2/162 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W +  GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A + CG T+ +   QPIP + + +++GYT DGPCE+WLD T+V    NCH  FP   
Sbjct  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853
            + +DYSSC GSC L WYWLG ++++  +SWQVYK C+ LS +
Sbjct  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188

>PHYKE_3446
Length=199

 Score = 158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 102/160 (64%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  D  + +   LA+L+ QG  T  +A +W +  GY +LRA +D  + Y+V
Sbjct  29   QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A + CG T P    QPIP   + +++GYT DGPCE+W+D+T+V    NCH       
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYS+C G+C L WYWLG+++++  YSWQVYK C+ L+
Sbjct  148  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLT  187

>PHYRA_81106
Length=202

 Score = 157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   LA+L+ QG  T  +  +W +  GY +LRA +D    Y V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
             + A + CG T+     Q IP  N+ +++GYT DGPCE+WLD T+V +  NCH       
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC G+C L WYW+G++Y++  YSWQVYK CV LS
Sbjct  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187

>PHYKE_7718
Length=220

 Score = 158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  D  D +   LA+L+ +G     +  +W  + GY SLR  +D+ + Y V
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  91

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A   CG T P    QPIP  N+ +++GYT DGPCE+W+DDT      NCH  FP   
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  151

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYS+C G+C L WYWLG+++++  YSWQVYK C+ L+
Sbjct  152  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  191

>PHYRA_81107
Length=202

 Score = 157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 100/162 (62%), Gaps = 1/162 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D    +   LA+L++QG +T  +  +W ++ GY SLRA  DD + Y V
Sbjct  26   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            ++ A F CG T    + Q IP  N+ +++GYT DGPCE+WLDDT V    NCH       
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  144

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853
            + +DYSSC  +C L W+W+G++Y+   YSWQVYK CV LS +
Sbjct  145  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSAS  186

>PHYCA_511409
Length=204

 Score = 156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 99/160 (62%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D    +   LA+L++QG  T  +  +W Q  GY SLRA  +D + Y V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  86

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            ++ A F CG T+   + Q IP  N+ +++GYT DGPCE+WLDDT V    NCH       
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC  +C L W+WLG++Y++  YSWQ+YK CV LS
Sbjct  147  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  186

>PPTG_17121
Length=202

 Score = 154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL   P +  D  D +   LA+L++QG  T  +  +W +  GY SLRA  D  S Y V
Sbjct  26   QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-YTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            ++ A   CG T+   + QPIP  N+ +++GYT DGPCE+WLDDT V    NCH       
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  144

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC  +C L W+WLG++Y++  YSWQ+YK CV LS
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  184

>PHYSO_284086
Length=204

 Score = 154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 2/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D    +   LA+L+ QG  T  +  +W + +GY +LRA +D  S Y V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
             + A + CG T  +   QPIP + + +++GYT DGPCE+WLD T+V    NCH  F    
Sbjct  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC GSC L WYWLG+++++  YSWQVYK CV LS
Sbjct  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186

>PYIW_18791
Length=194

 Score = 152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 106/171 (62%), Gaps = 2/171 (1%)

Query  687  GLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDE  746
            G    Q V  P P + V         L++L++ G+ TS     +M+ +GYS+LRA++DD 
Sbjct  18   GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  77

Query  747  SLYKVTEEA-IFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHT  805
             LYK    A  F CG T P   +Q IP +++ +T+GYT  GPCE+W+DD +V +G NCH 
Sbjct  78   KLYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHE  137

Query  806  EFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            +  +   +VDYS+C G C + WYWLG++Y++  +SWQVYKNC+ L+ +  A
Sbjct  138  QVSN-TTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGAA  187

>PHALS_03284
Length=188

 Score = 152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 100/161 (62%), Gaps = 1/161 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QI+L P P +  +  D +   LA+L+ Q   TS +   ++++  Y+SLR  L   + Y V
Sbjct  15   QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANYTV  73

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            TE A  +CG T P    QPIP  N+ + +GYT DG CE+WLDDTKV SG NCH +FP   
Sbjct  74   TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  133

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSK  852
              VDYSSC  +C + WYWL ++ ++  YSWQVYK C+ L++
Sbjct  134  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTR  174

>PPTG_17122
Length=204

 Score = 152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 97/160 (61%), Gaps = 2/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W +  GY +LR  +D  + Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A + CG T+     QPIP + + +++GYT DGPCE+WLD  +V    NCH       
Sbjct  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC G+C L WYWLG++Y++  YSWQ+YK C+ LS
Sbjct  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLS  186

>PYAR_24096
Length=227

 Score = 147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 94/162 (58%), Gaps = 2/162 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V  P   + V   +      A L++QG  T+ +  ++++   Y +LR  +D    YK 
Sbjct  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
               A FECG T P+   QPIP + +F+TSGYT +GPCEIW+DD +V  G NCH +     
Sbjct  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147

Query  812  --HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
               ++DYS+C G+C L WYWLGI+     YSWQ+YK C+ LS
Sbjct  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PYAP_22273
Length=268

 Score = 148 bits (373),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 65/140 (46%), Positives = 87/140 (62%), Gaps = 2/140 (1%)

Query  714  AYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPT  773
            A L+ QG  T+ +  +++   GY +LR  +D    YK  + A  ECG T P    QPIPT
Sbjct  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108

Query  774  NNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHG--QHQVDYSSCGGSCHLSWYWLG  831
            N  F+TSGYT +GPCEIW+DD  V SG+NCH +        ++DYS+C G C L WYWLG
Sbjct  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168

Query  832  IKYVEGIYSWQVYKNCVGLS  851
            I+ +   YSWQ+YK C+ L+
Sbjct  169  IRPMGKKYSWQIYKACIPLA  188

>PYIR_26546
Length=239

 Score = 145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 105/170 (62%), Gaps = 3/170 (2%)

Query  684  LDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQ-GINTSIEAQSWMQQQGYSSLRAM  742
            LD+     Q+V+ P P + ++G   Q   +AYL+ Q G + + +   ++  +G+ ++R  
Sbjct  21   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  80

Query  743  LDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRN  802
            +D++ LY+   +A F+CG T    E QPIP N+  +T+GYT +GPCEIWLDD KV  G+N
Sbjct  81   MDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  140

Query  803  CHTEFPHGQH--QVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
            CH +   G +  ++D+SSC G C + WYW+GI+      SWQ+YK C+ L
Sbjct  141  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PYVX_18174
Length=204

 Score = 143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 94/161 (58%), Gaps = 4/161 (2%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V+ P P +     D     LA+L++QG  T  +  +W +  GY +LRA +D  S Y V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A   CG T      QPIP N  F+++GYT DGPCEIWLD T+V +  NCH       
Sbjct  88   TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKD  145

Query  812  HQVDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
              +DYS    G+C L WYW+G++Y+   YSWQVYKNCV LS
Sbjct  146  TAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLS  186

>PITG_18450
Length=203

 Score = 142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 5/160 (3%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q+VL P P +  D  D +   L +L+ QG  T  +   W +  GY +LR  ++    Y V
Sbjct  29   QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
             + A + CG T+     QP P + + +++GYT DGPCE+WLD T+V    NCH       
Sbjct  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC G+C L WYWLG+++++  YSWQ+YK C+ LS
Sbjct  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183

>PYIR_20273
Length=505

 Score = 150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 136/485 (28%), Positives = 219/485 (45%), Gaps = 40/485 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   EYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALL  84

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             S+ +     HD A +G  VS         ++ +++ + +  ++ +    +   +   V 
Sbjct  85   HSTHLYHSAQHDFAKYGIEVSEVS-----MNFGKMMKSKEKAVKTLTGGIEQLFKKNKVT  139

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSDDI  338
            Y    G  +  + + +     G++ +T ++++IA G     L  +P    A   + S   
Sbjct  140  YIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKIVDSTGA  199

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR---GFDQDMANKIGEY  395
              +K K P   +VVGA  + LE     K +G   KV V   L R   G D ++  +  + 
Sbjct  200  LELK-KVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFTKL  256

Query  396  MEVQS-GIEFIRKTVPQSIT----KLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDI  450
            ++ Q  G EF  K     +      L             G +     D+VL ATGR P  
Sbjct  257  LKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVATGRRPYT  316

Query  451  AKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  509
              L L+  G++  +K GRI V  H +T  PNI+AIGDVI  P L   A + G   +  + 
Sbjct  317  NGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAETIA  375

Query  510  NNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETR  569
                  ++Y+ +   ++T  E    G +EE       K++   Y+    P+    ++  R
Sbjct  376  GKHG-HVNYNAIPGVIYTFPEVASVGKTEEQL-----KEEGVTYNVGKFPMLA--NSRAR  427

Query  570  AAAES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPT  628
            A  E+   VKVI D+  DK ++G H +  NAGE+     L M+ G + + +  T   HPT
Sbjct  428  AVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAHPT  486

Query  629  TAESF  633
             +E+F
Sbjct  487  LSEAF  491

>PYAP_22645
Length=1565

 Score = 154 bits (389),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 147/486 (30%), Positives = 232/486 (48%), Gaps = 48/486 (10%)

Query  163   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
             +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  1099  EYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALL  1150

Query  223   QSSLIGEVLHHDSASFGWNVSSGQGSAPIFD-----WKQLVTNVDGYIRGINFKYKVELR  277
              ++ +     HD + +G  VS  + +   FD      ++ V  + G I G+  K KV   
Sbjct  1151  HATHMYHAAQHDFSKYGIEVSDVKMN---FDGMMKSKEKAVKTLTGGIEGLFKKNKV---  1204

Query  278   SKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---I  333
               YVK     G  +  + + +     G++ +  ++++IA G     L  +P    A   +
Sbjct  1205  -TYVKG---FGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKIV  1260

Query  334   SSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  392
              S     +K K P   +V+G   + LE     K +G  V V+     +  G DQ++  + 
Sbjct  1261  DSTGALELK-KVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEF  1319

Query  393   GEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIA  451
              + ++ Q G++F   T V  S    +   L V+  +    S  EA D+VL ATGR P   
Sbjct  1320  TKLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTK  1377

Query  452   KLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  510
              L L++ G++  +K GRI V  H +T  PNI+AIGDVI  P L   A + G      + N
Sbjct  1378  GLGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIAC---VEN  1433

Query  511   NATV--QMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTET  568
              A +   ++YD +   ++T  E    G +EE       K++   Y+    P+    ++  
Sbjct  1434  IAGLHGHVNYDAIPGVIYTYPEVASVGKTEEQL-----KEEGVAYNVGKFPM--MANSRA  1486

Query  569   RAAAES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  627
             RA AES  +VKVI D+  D+ ++G H +  NAGE+     L M+ G   + +  T   HP
Sbjct  1487  RAVAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHP  1545

Query  628   TTAESF  633
             T +E+F
Sbjct  1546  TLSEAF  1551

>PYVX_18176
Length=201

 Score = 140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 94/160 (59%), Gaps = 2/160 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V+ P P +  D  D     LA+L++QG +T  +  +W    GY SLRA +D  S Y V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTV  84

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A   CG T+     Q +P +   +++GYT  GPCE+WLDDT V    NCH       
Sbjct  85   TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKT  143

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            + +DYSSC  +C L W+W+G++Y+   YSWQVYKNCV LS
Sbjct  144  YDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLS  183

>CCI10477
Length=494

 Score = 145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 135/484 (28%), Positives = 229/484 (47%), Gaps = 42/484 (9%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             SS +     HD  S G  VS  +      ++ +++   +  ++ +    +   +   V 
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSDLR-----LNFGKMMKAKEKSVKVLTSGIEGLFKKNKVA  132

Query  283  YENFLGSFIDPH--TLELWHPRKGSKQITTRDVVIAVGGR-----PRELTIPGGEHAISS  335
            Y    G  +  +  ++ L    KG++ IT ++++IA G       P  +    G+  + S
Sbjct  133  YIKGHGKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGK-IVDS  191

Query  336  DDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGE  394
                 +K+  P + +VVGA  + LE     + +G +V V+   + +  G D ++  +  +
Sbjct  192  TGALVLKSI-PKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAK  250

Query  395  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEA---FDSVLNATGRDPDIA  451
             ++ Q G++F   T   S TK+      V  T ED +   E     D VL ATGR P   
Sbjct  251  TLQKQ-GLKFKFATRVTS-TKVNGDN--VTITMEDAKGGNETSMECDVVLVATGRRPFTN  306

Query  452  KLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  510
             L L+  G++  +K GRI V  H +T+ P+IYAIGDVI  P L   A + G + +  +  
Sbjct  307  GLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIML  364

Query  511  NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRA  570
                 ++Y+ +   ++T  E  C G +EE       K++   Y+    P+    ++  RA
Sbjct  365  GKHGHVNYNAIPGVIYTHPEVACVGKTEEQL-----KEEGISYNVGKFPMIA--NSRARA  417

Query  571  AAES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  629
              E+  +VKV+  +  D+ ++G H +  NAGE+     L ++ G   + +  T   HPT 
Sbjct  418  VGETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTL  476

Query  630  AESF  633
            +E+ 
Sbjct  477  SEAL  480

>PYAP_22279
Length=223

 Score = 136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 99/164 (60%), Gaps = 6/164 (4%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q +  P P    D  +     LA+L+ QG+  + +   +++Q+G  +LR  +D+++ YKV
Sbjct  23   QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  752  TEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKV--ASGRNCHTEFP  808
                A FECG T P    QPIP+N   +++GYT DGPCE+WLD+T+V  ++  +CH +  
Sbjct  82   EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIG  141

Query  809  HG--QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
             G   +++D+S C G+C L WYWL  + +   +SWQVYK CV L
Sbjct  142  QGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>SPRG_19943
Length=343

 Score = 139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/258 (35%), Positives = 137/258 (53%), Gaps = 18/258 (7%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD +V+G GSGG++ +  A ++G KV V++           GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVPKKIMFN  77

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++L  E+LH   A     V   Q  A  FDW  +    D Y++ +N  Y   +    V  
Sbjct  78   AALHAEMLHSARAYAFKGVQDIQFGA--FDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  135

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKT  343
                  F+D HT+E+        + T + ++IAVGG P    +PG EHAISSD  F ++T
Sbjct  136  VMGAAKFVDNHTVEV-----NGDRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALET  190

Query  344  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMANKIGEYM---  396
             +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD   +D+ N   E+    
Sbjct  191  -QPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAGKE  249

Query  397  EVQSGIEFIRKTVPQSIT  414
            +VQ+ ++ +   V +++ 
Sbjct  250  KVQTAMKLVCIGVEETVV  267

 Score = 41.6 bits (96),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (2%)

Query  577  VKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTL  636
            +K++C  + +  VVG H  G  A E+ Q  G+A+K+G       + V IHPT +E   T+
Sbjct  255  MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>CCA22989
Length=494

 Score = 142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 131/482 (27%), Positives = 223/482 (46%), Gaps = 38/482 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQK-VCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP K +
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPSKAL  76

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
              SS +     HD  + G   S  +      ++ +++   +  ++ +    +   +   V
Sbjct  77   LHSSHMFHTAQHDFKAIGIEASDLR-----LNFGKMMKAKEKSVKVLTSGIEGLFKKNKV  131

Query  282  KYENFLGSFI--DPHTLELWHPRKGSKQITTRDVVIAVGGR-----PRELTIPGGEHAIS  334
             Y    G+ +  D  ++      KG + I  ++++IA G       P  +    G    S
Sbjct  132  AYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDS  191

Query  335  SDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIG  393
            +  +    T  P + +VVGA  + LE     + +G +V V+   + +  G D ++  +  
Sbjct  192  TGALVLKST--PKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFA  249

Query  394  EYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKL  453
            + ++ Q G +F   T   S    E+   +    ++ G       D VL ATGR P    L
Sbjct  250  KTLQKQ-GFKFKFATKVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNL  308

Query  454  DLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNA  512
             L+  G++  +K GRI V  H +T  PNIYAIGDVI  P L   A + G + +  +    
Sbjct  309  GLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGK  366

Query  513  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA  572
               ++Y+ +   ++T  E  C G +EE       K++   Y+    P+    ++  RA  
Sbjct  367  QGHVNYNAIPGVIYTFPEVACVGRTEEQL-----KEEGVSYNVGKFPMIA--NSRARAVG  419

Query  573  ES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  631
            E+  +VKV+  +  D+ ++G H +  NAGE+     L ++ G + + +  T   HPT +E
Sbjct  420  ETDGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSE  478

Query  632  SF  633
            + 
Sbjct  479  AL  480

>PYU1_G014259
Length=244

 Score = 136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 120/218 (55%), Gaps = 18/218 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  221
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  222  HQSSLIGEVLHHDSASFGWNVSSGQ--GSAPIFDWKQLVTNVDGYIRGINFKYKVELRSK  279
            + ++ +  +LH D+  +G+    G+  G    F W +L    D Y+  +N  Y+  L + 
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRLNGIYERNLANS  144

Query  280  YVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIF  339
             V       +F     +E+       K++  ++++IAVGG+P    IPG EH I SD  F
Sbjct  145  KVDLLQGTAAFNAQGNVEV-----DGKEVKAKNILIAVGGKPLIPDIPGKEHCIDSDGFF  199

Query  340  WMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR  377
             ++   P K  VVGA Y+A+E AG L G+G D  +  R
Sbjct  200  ELEVL-PKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>HYAP_12621
Length=501

 Score = 140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 133/481 (28%), Positives = 218/481 (45%), Gaps = 37/481 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             S+ +     H+  S+G +  +   + P     Q++   +  +R +    +       V 
Sbjct  86   HSTHLLHTAQHEFKSYGIDAPNVTANFP-----QMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  283  YENFLGSFIDPHTLEL-WHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSDD  337
            Y   +G       + +    R+G+  +T +++++A G     L  +P    A   + S  
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  338  IFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYM  396
               + T+ P   +VVGA  + LE     K +G  V V+        G D+    +  + +
Sbjct  201  ALAL-TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKLL  259

Query  397  EVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAKL  453
            + Q G+EF   T    +T  E    +V  T+E    G+      D+VL ATGR    A L
Sbjct  260  KKQ-GLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAGL  315

Query  454  DLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNA  512
             L++ G++  +K GRI V H  QT  P ++AIGDVI    L   A + G      +    
Sbjct  316  GLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKH  374

Query  513  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA  572
               ++Y  +   ++T  E+   G +EE+ +K  G +    Y+    P+  +    T A A
Sbjct  375  G-HVNYGAIPNVIYTFPEFASVGKTEEE-LKAEGVE----YNVGKFPMMANSRARTVAEA  428

Query  573  ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  632
            +   VKV+ D+  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E+
Sbjct  429  DG-MVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEA  486

Query  633  F  633
            F
Sbjct  487  F  487

>PHALS_06480
Length=159

 Score = 130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)

Query  677  CVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGY  736
            C+ G RRL+AGLGEGQ+VL+P PF+VVDGLDFQGMALAYL+EQGINTSIE QSWM+   Y
Sbjct  20   CIYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAY  79

Query  737  SSLRAMLDDESLYK  750
            +SLRAMLDD+ LYK
Sbjct  80   NSLRAMLDDDMLYK  93

>PYAP_22278
Length=289

 Score = 134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 101/171 (59%), Gaps = 6/171 (4%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            Q V  P P F  +  +     LA+L+ QG+    +   +++ +G  +LR  +D+++ YK+
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  752  TEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGR--NCHTEFP  808
                A FECG T+P    QPIP N   +++GYT DGPCE+WLD+T+V      NCH +  
Sbjct  86   EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVG  145

Query  809  HG--QHQVDYSSCGGSCHLSWYWLGIKYVEG-IYSWQVYKNCVGLSKNPTA  856
            +    +++D+S C G+C L WYWLG + + G  +SWQ+YK CV L  + TA
Sbjct  146  NKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTA  196

>PHYSO_499978
Length=174

 Score = 129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  + +   LA+L+ QG  T  + + W  + GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A F CG T P+   QPIP  ++ +++GYT DGPCE+W+D+T+V  G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  812  HQVDYSSCGGSCHLSWYW  829
            + +DYS+C G+C L WYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +  + +   LA+L+ QG  T  + + W  + GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T+ A F CG T P+   QPIP  ++ +++GYT DGPCE+W+D+T+V  G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  812  HQVDYSSCGGSCHLSWYW  829
            + +DYS+C G+C L WYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYCA_510817
Length=188

 Score = 129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 87/140 (62%), Gaps = 1/140 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            L++L+++G  T      +    GY SLR  ++ ++ YKV++ A   CG + P+   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
            ++ + +TSGYT DGPCEIW+ D    S  NCH   P    ++DYS CG SC L WYWLG+
Sbjct  109  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  833  KYVEGIYSWQVYKNCVGLSK  852
            + ++G YSWQVYK C+ L K
Sbjct  169  RKLKGKYSWQVYKECIPLYK  188

>PYVX_21248
Length=502

 Score = 136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 127/439 (29%), Positives = 209/439 (48%), Gaps = 31/439 (7%)

Query  206  LGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGS--APIFDWKQLVTNVDG  263
            LGGTC+NVGCIP K +  S+ +     HD A +G  V   + +    +   ++ VT + G
Sbjct  70   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMKAKEKAVTTLTG  129

Query  264  YIRGINFKYKVELRSKYVKYENFLGSFIDPHTLEL-WHPRKGSKQITTRDVVIAVGGRPR  322
             I  +  K KV     Y+K     G  +  + + +  +  KG++ +T ++++IA G  P 
Sbjct  130  GIESLFKKNKV----TYIKGH---GKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPA  182

Query  323  EL---TIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  379
             L    +   +  I          K P   +VVGA  + LE     K +G   KV V   
Sbjct  183  PLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEF  240

Query  380  LLR---GFDQDMANKIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTSEDGESCEE  435
            L R   G D +++ +  + ++ Q G+EF   T V  S  K +N  L V+  S  G +   
Sbjct  241  LDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVE-PSAGGSAASI  298

Query  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELT  494
              D+VL ATGR P    L L++ G++  +K GR+ V  H +T  PNIYA GDVI    L 
Sbjct  299  ECDTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAMLA  357

Query  495  PVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYH  554
              A + G +    + +     ++YD +   ++T  E    G +EE+      K++   Y+
Sbjct  358  HKAEEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEEL-----KNEGVTYN  411

Query  555  TNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  614
                P+  +    T A A+  +VK++ D+  D+ ++G H +  NAGE+     L ++ G 
Sbjct  412  VGKFPMMANSRARTIAEADG-FVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYGA  469

Query  615  TYDQMVDTVGIHPTTAESF  633
            + + +  T   HPT +E+F
Sbjct  470  SSEDIARTCHAHPTLSEAF  488

>PPTG_08820
Length=250

 Score = 130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 94/165 (57%), Gaps = 5/165 (3%)

Query  692  QIVLHPPPFFV--VDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLY  749
            Q++L P P +   ++  D +   LA+L+ QG     +   W  Q GY +LR  +D     
Sbjct  29   QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYT  88

Query  750  -KVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFP  808
              VT  A   CGLT  +   +PIP +   +++GYT DGPC ++LDD  V    NCH + P
Sbjct  89   TSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLP  148

Query  809  HGQHQVDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
               +++DYSSC   G C L W+WLGI++V+  +SWQVYK CV L+
Sbjct  149  GKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLT  193

>PPTG_14254
Length=188

 Score = 127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 1/140 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            L++L+++G  T      +    GY SLR  +D  + YKVTE A   CG T P+   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
             + + +T+GYT DGPCEI++ +    S  NCH   P    ++DYS CG SC L WYWLG+
Sbjct  109  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  833  KYVEGIYSWQVYKNCVGLSK  852
            + ++G YSWQVYK C+ + K
Sbjct  169  RKLKGKYSWQVYKECIPIYK  188

>PPTG_14255
Length=268

 Score = 127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 85/138 (62%), Gaps = 1/138 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            L++L+++G  T      +    GY SLR  +D+ + Y VT+ A   CG T P+   Q IP
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  107

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
             + + +TSGYT DGPCEI++ DT   S  NCH        ++DYS+CG SC L WYWLG+
Sbjct  108  EDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV  167

Query  833  KYVEGIYSWQVYKNCVGL  850
            +Y++  YSWQVYK C+ L
Sbjct  168  RYLKKKYSWQVYKECIPL  185

>PITG_13520
Length=171

 Score = 123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 76/128 (59%), Gaps = 1/128 (1%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +     D +   LA+L+ QG  T  + ++W  + GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  87

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP   + +++GYT DGPCE+WLDD  V  G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKD  147

Query  812  HQVDYSSC  819
            + VDYSSC
Sbjct  148  YTVDYSSC  155

>PHYKE_9185
Length=281

 Score = 125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 1/138 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            L++L+++GI T      +     Y+SLR  +D ++ YKV++ A   CG T P+   Q IP
Sbjct  52   LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  110

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
             + + +TSGYT DGPCEI++ D    S  NCH        ++DYS+CG SC L WYWLG+
Sbjct  111  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGV  170

Query  833  KYVEGIYSWQVYKNCVGL  850
            + ++G YSWQ+YK C+ L
Sbjct  171  RKLKGSYSWQIYKECIPL  188

>PHYSO_343376
Length=172

 Score = 120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 75/117 (64%), Gaps = 1/117 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            LA+L+ QG  T  + ++W  + GY +LR  +D    Y VT+ A F CG T P+   QPIP
Sbjct  48   LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  106

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYW  829
              ++ +++GYT DGPCE+W+D+T+V  G NCH +     + +DYS+C G+C L WYW
Sbjct  107  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PHYSO_417649
Length=185

 Score = 120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 1/138 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            L++L+++G  T      +    GY SLR  ++  + YK+T+ A   CG T P+   Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
             + + +TSGYT DGPCEI++ D    S  NCH        ++DYS CG SC L WYWLG+
Sbjct  107  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  166

Query  833  KYVEGIYSWQVYKNCVGL  850
            + ++G +SWQVYK C+ L
Sbjct  167  RKLKGKFSWQVYKECIPL  184

>PITG_10499
Length=323

 Score = 122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 91/161 (57%), Gaps = 5/161 (3%)

Query  696  HPPPFFV--VDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDD-ESLYKVT  752
             P P +   ++  D +   LA+L+ QG     +   W  + GY  LR  +D  + +  VT
Sbjct  3    QPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVT  62

Query  753  EEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQH  812
              A   CGLT  +   +PIP + + +++GYT DGPC I+LDD  V    NCH   P   +
Sbjct  63   PGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTY  122

Query  813  QVDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            ++D+SSC   G C L W+WLGI++V+  +SWQVYK C+ L+
Sbjct  123  KIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PHYCA_536934
Length=983

 Score = 125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 81/138 (59%), Gaps = 1/138 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            L++L+++G  T      +    GY +LR  +D+   Y VT+ A   CG + P    Q IP
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIP  124

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
             + + +TSGYT DGPCEIW+ D    S  NCH        ++DYS CG SC L WYWLG+
Sbjct  125  EDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  184

Query  833  KYVEGIYSWQVYKNCVGL  850
            +Y++  YSWQVYK C+ L
Sbjct  185  RYLKKKYSWQVYKECIPL  202

>PHYSO_254168
Length=170

 Score = 114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 86/155 (55%), Gaps = 18/155 (12%)

Query  702  VVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGL  761
             V+  D +   LA+L+ QG  T     +  +  GY +LR  +D    Y VT+ A + CG 
Sbjct  27   AVEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGW  85

Query  762  TSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSC--  819
            T+P+   QPIP     +++GYT DGPCEIWLDD +V                +DYSSC  
Sbjct  86   TNPKGTPQPIP-----RSTGYTHDGPCEIWLDDVRVL----------ERSPTIDYSSCEK  130

Query  820  GGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNP  854
             G C + WYWLG+++++  YSWQVYK C+ L+  P
Sbjct  131  KGGCTMHWYWLGVRFLKNSYSWQVYKECIPLTAAP  165

>PHYSO_262732
Length=188

 Score = 115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 73/120 (61%), Gaps = 0/120 (0%)

Query  729  SWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  788
            ++++ QG+ +      D + Y VTE A   CG T P+   Q IP++ + +TSGYT DGPC
Sbjct  50   AFLENQGFQTHLRDFMDNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPC  109

Query  789  EIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            EI++ D    S  NCH        ++DYS CG SC L WYWLG++++   YSWQVYK C+
Sbjct  110  EIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECI  169

>PHYSO_340369
Length=200

 Score = 115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 79/143 (55%), Gaps = 15/143 (10%)

Query  711  MALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  770
            M LAY ++QG NTS     W    G+ +LR  +D+ +             +TSP    Q 
Sbjct  50   MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNY-----------SVTSP----QQ  94

Query  771  IPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWL  830
            IP +N  +T GYT DGPCEIWLD+T   S  +C    P+  + +DYS CG SC + WY L
Sbjct  95   IPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTL  154

Query  831  GIKYVEGIYSWQVYKNCVGLSKN  853
            G+   + +YSW+VYK C+ L  N
Sbjct  155  GVAKPDRVYSWEVYKECIPLYMN  177

>PYU1_G001737
Length=133

 Score = 112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 1/96 (1%)

Query  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81
            ++IAGW+ C+ F KA +V +AMQ+LYPD + F  H F DR+AF+ WL  S+DD   HFGA
Sbjct  38   YHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGA  97

Query  82   DSRATKHVTSPFVWSST-IFVGGCDELLAFFRSGIA  116
             S A  H +SPFVWS+   FVGGCD LLA  R  I+
Sbjct  98   TSPALTHTSSPFVWSNAGEFVGGCDALLATIRGSIS  133

>PHYRA_72215
Length=499

 Score = 121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 123/439 (28%), Positives = 200/439 (46%), Gaps = 31/439 (7%)

Query  206  LGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAP--IFDWKQLVTNVDG  263
            LGGTC+NVGCIP K +  S+ +     HD  S+G +      + P  +   ++ VT + G
Sbjct  67   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVTANFPQMMKAKEKAVTTLTG  126

Query  264  YIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRE  323
             I  +  K KV     Y K                 +  KG++ +  ++++IA G     
Sbjct  127  GIESLFKKNKVTYIKGYGKVS------AQGEVSVALNDNKGNETVKAKNIIIATGSEVTP  180

Query  324  L-TIPGGEHA---ISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRS  378
            L  +P    A   I S     + T+ P   +VVGA  + LE     K +G  V V+  + 
Sbjct  181  LPPVPVDNAAGKIIDSTGALAL-TRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQD  239

Query  379  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF-  437
                G D++   +  + ++ Q G++F   T    +T  E    +VK T+E  +    A  
Sbjct  240  AACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAATI  295

Query  438  --DSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELT  494
              D+VL ATGR    A L L++ G++  +K GRI V    +T  P I+AIGDVI    L 
Sbjct  296  ECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLA  354

Query  495  PVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYH  554
              A + G      +       ++Y  +   ++T  E+   G +EE+       + IE Y+
Sbjct  355  HKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEE----LKAEGIE-YN  408

Query  555  TNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  614
                P+  +    T A A+   VKV+ D+  DK ++G H +  NAGE+     +A++ G 
Sbjct  409  VGKFPMMANSRARTVAEADG-LVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEYGA  466

Query  615  TYDQMVDTVGIHPTTAESF  633
            + + +  T   HPT +E+F
Sbjct  467  SSEDIARTCHAHPTLSEAF  485

>PHYSO_556052
Length=500

 Score = 119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 138/483 (29%), Positives = 218/483 (45%), Gaps = 41/483 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAP--IFDWKQLVTNVDGYIRGINFKYKVELRSKY  280
             S+ +     HD  S+G +    + + P  +   ++ V  + G I  +  K KV     Y
Sbjct  85   HSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKV----TY  140

Query  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSD  336
            +K   F             +  KG++ +  ++++IA G     L  +P    A   I S 
Sbjct  141  IK--GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDST  198

Query  337  DIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEY  395
                +K + P   +VVGA  + LE     K +G  V V+  +     G D++   +  + 
Sbjct  199  GALSLK-RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKL  257

Query  396  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAK  452
            ++ Q G+EF   T    +T  E    +VK T+E    G++     D+VL ATGR    A 
Sbjct  258  LKKQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAG  313

Query  453  LDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  511
            L L++ G++  +K GRI V    +T  P I+AIGDVI    L   A + G      +   
Sbjct  314  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGK  372

Query  512  ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAA  571
                ++Y  +   ++T  E+   G +EE+        K E    N        ++  R  
Sbjct  373  HG-HVNYGAIPGVIYTFPEFASVGKTEEEL-------KAEGIEYNVGKFPMMANSRARTV  424

Query  572  AES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  630
            AES   VKV+ D+  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +
Sbjct  425  AESDGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLS  483

Query  631  ESF  633
            E+F
Sbjct  484  EAF  486

>PHYKE_9680
Length=498

 Score = 119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 117/438 (27%), Positives = 201/438 (46%), Gaps = 29/438 (7%)

Query  206  LGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYI  265
            LGGTC+NVGCIP K +  S+ +     HD  S+G +    + + P     Q++   +  +
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVKANFP-----QMMKAKEKAV  120

Query  266  RGINFKYKVELRSKYVKYENFLGSFIDPHTLEL-WHPRKGSKQITTRDVVIAVGGRPREL  324
            + +    ++  +   V Y    G       + +     KG++ +  ++++IA G     L
Sbjct  121  KTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPL  180

Query  325  -TIPGGEHA---ISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSI  379
              +P    A   I S     +K + P   +VVGA  + LE     K +G  V V+  +  
Sbjct  181  PPVPVDNEAGKIIDSTGALVLK-RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDA  239

Query  380  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF--  437
               G D++   +  + ++ Q G++F   T    +T  E    +VK T+E  +  +EA   
Sbjct  240  ACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASIE  295

Query  438  -DSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTP  495
             D+VL ATGR    A L L++ G++  +K GR+ V    +T  P I+AIGDVI    L  
Sbjct  296  CDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLAH  354

Query  496  VAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
             A + G      +       ++Y  +   ++T  E+   G +EE+       + IE Y+ 
Sbjct  355  KAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEE----LKAEGIE-YNV  408

Query  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615
               P+  +    T A A+   VKV+ D+  DK  +G H +  NAGE+     +A++ G +
Sbjct  409  GKFPMMANSRARTVAEADG-LVKVLSDKKTDKM-LGVHIIASNAGEMIAEGVIALEYGAS  466

Query  616  YDQMVDTVGIHPTTAESF  633
             + +  T   HPT +E+ 
Sbjct  467  SEDIARTCHAHPTLSEAL  484

>PHYCA_123621
Length=495

 Score = 119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 138/482 (29%), Positives = 221/482 (46%), Gaps = 39/482 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  28   DYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  79

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAP--IFDWKQLVTNVDGYIRGINFKYKVELRSKY  280
             S+ +     HD  S+G +    + + P  +   ++ VT + G I  +  K KV     Y
Sbjct  80   HSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKV----TY  135

Query  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSD  336
            +K   F             +  KG++ +  ++++IA G     L  +P    A   I S 
Sbjct  136  IK--GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDST  193

Query  337  DIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEY  395
                + T+ P   +VVGA  + LE     K +G  V V+        G D+    +  + 
Sbjct  194  GALSL-TRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFTKL  252

Query  396  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAK  452
            ++ Q G++F   T    +T  E    +VK T+E    G++     D+VL ATGR    A 
Sbjct  253  LKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTAG  308

Query  453  LDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  511
            L L++ G++  +K GRI V    +T  P I+AIGDVI    L   A + G      +   
Sbjct  309  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK  367

Query  512  ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAA  571
                ++Y  +   ++T  E+   G +EE+ +K  G +    Y+    P+  +    T A 
Sbjct  368  HG-HVNYGAIPGVIYTFPEFASVGKTEEE-LKAEGVE----YNVGKFPMMANSRARTVAE  421

Query  572  AESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  631
            A+   VKV+ D+  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E
Sbjct  422  ADG-LVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSE  479

Query  632  SF  633
            +F
Sbjct  480  AF  481

>PYAR_20075
Length=469

 Score = 116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 128/484 (26%), Positives = 212/484 (44%), Gaps = 71/484 (15%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             S+ +     HD   +G  VS  Q      D+  ++ + +  ++ +    +   +   V 
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSDVQ-----MDFGGMMKSKEKAVKTLTAGIESLFKKNKVT  136

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMK  342
            Y    G                 K +   +V +A+          G E  + S     +K
Sbjct  137  YIKGFG-----------------KIVAANEVAVALNDN------NGNETIVDSTGALALK  173

Query  343  TKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGI  402
             K P   +V+G   + LE     K +G  V V+           + A+++   ++++ G 
Sbjct  174  -KAPEHLVVIGGGVIGLELGSVYKRLGSKVTVV-----------EYADRVCPGLDLELGK  221

Query  403  EFIRKTVPQSI-----TKLENGQL------LVKWTSEDGESCEEAFDSVLNATGRDPDIA  451
            EF +    Q +     TK+   Q+      L    +  GE+     D+VL ATGR P   
Sbjct  222  EFAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTN  281

Query  452  KLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  510
             L L++ G++  +K GRI V +H +T  P+IYAIGDVI  P L   A + G      +  
Sbjct  282  GLGLEQMGIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIA-  339

Query  511  NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRA  570
                 ++Y+ +   ++T  E    G +EE       K++   Y+    P+    ++  RA
Sbjct  340  GLHGHVNYNAIPGVIYTHPEVASVGKTEEQL-----KEEGIAYNVGKFPMMA--NSRARA  392

Query  571  AAES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  629
              E   +VKV+ D+  DK ++G H +  NAGE+     L ++ G   + +  T   HPT 
Sbjct  393  VGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTL  451

Query  630  AESF  633
            +E+F
Sbjct  452  SEAF  455

>PITG_15359
Length=496

 Score = 115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 135/482 (28%), Positives = 221/482 (46%), Gaps = 39/482 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  29   DYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  80

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAP--IFDWKQLVTNVDGYIRGINFKYKVELRSKY  280
             S+ +     HD  S+G +    + + P  +   ++ V  + G I  +  K KV     Y
Sbjct  81   HSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKV----TY  136

Query  281  VKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSD  336
            +K    + +          +  KG++ +  ++++IA G     L  +P    A   I S 
Sbjct  137  IKGHGKISA--QGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDST  194

Query  337  DIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEY  395
                +K + P   +VVGA  + LE     K +G  V V+        G D++   +  + 
Sbjct  195  GALELK-RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEFTKL  253

Query  396  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAK  452
            ++ Q G++F   T    +T  E    +VK T+E    G++     D+VL ATGR    + 
Sbjct  254  LKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSG  309

Query  453  LDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  511
            L L++ G++  +K GRI V    +T  P I+AIGDVI    L   A + G      +   
Sbjct  310  LGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK  368

Query  512  ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAA  571
                ++Y  +   ++T  E+   G +EE+       + IE Y+    P+  +    T A 
Sbjct  369  HG-HVNYGAIPGVIYTFPEFASVGKTEEE----LKAEGIE-YNVGKFPMMANSRARTIAE  422

Query  572  AESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAE  631
            A+   VKV+ D+  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E
Sbjct  423  ADG-LVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSE  480

Query  632  SF  633
            +F
Sbjct  481  AF  482

>PHYSO_527908
Length=174

 Score = 106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 1/126 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            LA+L+ QG  T      +M   GY SLR  +D+ + Y VT+ A   CG T P    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  107

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGI  832
             + + +TSG+T D PCEI++ D    S  NCH        ++DYS+CG SC L WYWLG+
Sbjct  108  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  167

Query  833  KYVEGI  838
            ++++GI
Sbjct  168  RFIKGI  173

>PHYSO_341596
Length=231

 Score = 108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 1/96 (1%)

Query  713  LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIP  772
            LA+L+ QG  T  +  SW  + GY SLR  +D ++ Y VT  A F CG T P+   QPIP
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  100

Query  773  TNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFP  808
              ++ +++GYT DGPCE+WLDDTKV  G NCH +FP
Sbjct  101  AGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFP  136

>PHYRA_73883
Length=551

 Score = 113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 132/506 (26%), Positives = 229/506 (45%), Gaps = 55/506 (11%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  97

Query  224  SSLIGEVLHHDSASFGWNVSSGQ-GSAPIFDWKQLVTNVDGYI-RGINFKYKVELRSKYV  281
            ++L      H +   G    S + G   I    + V + +  I R    +  V+L +   
Sbjct  98   AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDV----------VIAVGGRP-RELTIP-GG  329
            ++     + +   + E +     +K+ T+ D+          ++ VG RP R   IP  G
Sbjct  158  RFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGTRPARHPDIPFDG  217

Query  330  EHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQ  386
            E    SD + W K K  P + +VVGA  V +E A  +  + G DV V+  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADK  277

Query  387  DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGR  446
            +++  +  Y   Q+G  F+ +   +S+ K +NG++ V    E G++     D +L   GR
Sbjct  278  EVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHL--ESGKTV--VGDGLLYTVGR  332

Query  447  DPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  505
              ++  L+L+  G+   +K GRI V +  QT+ P+IYA GD+I  P L   +++ GRL S
Sbjct  333  QGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQGRLAS  391

Query  506  RRL-----YNNATVQMDY-----DKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
              +      NN  +  D      D+V T + +  E    G+     I   GK++ ++   
Sbjct  392  VHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  450

Query  556  NFVPLEWSLSTETRAAAESC------YVKVI-C-DRIRDKFVVGFHYLGPNAGEVTQAMG  607
               P E  ++     A          ++K+I C D ++   ++G H +G  A E+     
Sbjct  451  Q-TPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTLK---ILGVHAIGEGATEIIHIGQ  506

Query  608  LAMKLGFTYDQMVDTVGIHPTTAESF  633
            + M  G   +   + V  +PT AE++
Sbjct  507  VVMSTGGNLEYFRNAVFNYPTLAEAY  532

>PHALS_09942
Length=496

 Score = 112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 120/464 (26%), Positives = 200/464 (43%), Gaps = 39/464 (8%)

Query  181  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGW  240
            +AA  G K   ++        +   LGGTC+NVGCIP K +  S+ +     H+  ++G 
Sbjct  47   KAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGI  98

Query  241  NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLEL-W  299
            +      + P     Q++   D  ++ +    +   +   V Y    G       + +  
Sbjct  99   DAPEVTANFP-----QMMKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVAL  153

Query  300  HPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSDDIFWMKTKEPGKTLVVGAS  355
            H  KG++ +  ++++IA G     L  +P    A   + S     +K + P   +VVGA 
Sbjct  154  HDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVDSTGALELK-RIPDHLVVVGAG  212

Query  356  YVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT  414
             + LE     K +G  V V+        G D+       + ++ Q G+EF   T    +T
Sbjct  213  VIGLELGSVYKRLGAKVTVVEYLDDACTGMDKGSVKDFIKLLKKQ-GLEFKFGT---KVT  268

Query  415  KLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWV  471
              E    +VK T+E    G++     D+VL ATGR    A L L++ G++  +K GRI V
Sbjct  269  ASEINGDVVKLTTEPSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKFGRIEV  327

Query  472  KHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIE  530
                +T  P I+AIGDVI    L   A + G +    +       ++Y  +   ++T  E
Sbjct  328  DEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IACAEIIAGKHGHVNYGAIPGVIYTFPE  386

Query  531  YGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAES-CYVKVICDRIRDKFV  589
            +   G +EE+        K E    N        ++  R   ES   VKV+ D+  DK  
Sbjct  387  FASVGKTEEEL-------KAEGIEYNVGKFPMMANSRARTVGESDGMVKVLADKKTDKL-  438

Query  590  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            +G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  439  LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHAHPTLSEAF  482

>SPRG_09825
Length=492

 Score = 112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 220/488 (45%), Gaps = 51/488 (10%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSKALL  76

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             ++       HD  + G  V   +      D+ +L+ + D  ++ +    +   +   V 
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLR-----IDFAKLMASKDKSVKILTGGIEGLFKKNKVD  131

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSDDI  338
            Y    G  +  + + +     G+K ++T++++IA G     L  +P    A   I S   
Sbjct  132  YIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGA  191

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  398
              +K + P   +V+G   + LE       +G  + V+           + A+KI   M+ 
Sbjct  192  LSLK-RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDF  239

Query  399  QSGIEFIRKTVPQSI----------TKLENGQL-LVKWTSEDGESCEEAFDSVLNATGRD  447
            ++G EF +    Q +          +K+E  ++ L    +  GE+     D+VL ATGR 
Sbjct  240  ETGREFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRR  299

Query  448  PDIAKLDLDKAGVKLNEKTGRIWV--KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  505
            P    L L++ G++  +K GRI V   + +T+  NI+AIGD I+   L   A + G    
Sbjct  300  PFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCV  358

Query  506  RRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLS  565
              +       ++Y+ +   V+T  E    G +EE+      K     Y+    P+  +  
Sbjct  359  ESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEEL-----KAANVAYNVGKFPMMANSR  412

Query  566  TETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  625
              T    +  +VK++  +  DK ++G H +  NAGE+     L ++ G + + +  T   
Sbjct  413  ARTVGETDG-FVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHA  470

Query  626  HPTTAESF  633
            HPT +E+F
Sbjct  471  HPTLSEAF  478

>SDRG_06945
Length=492

 Score = 111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 222/488 (45%), Gaps = 51/488 (10%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSKALL  76

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             ++       HD  + G  V   +      D+ +L+ + D  ++ +    +   +   + 
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLR-----IDFAKLMASKDKSVKILTGGIEGLFKKNKID  131

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSDDI  338
            Y    G  +  + + +     G+K ++T++++IA G     L  +P    A   I S   
Sbjct  132  YIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGA  191

Query  339  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  398
              +K + P   +V+G   + LE       +G  + V+           + A+KI   M+ 
Sbjct  192  LSLK-RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDF  239

Query  399  QSGIEFIRKTVPQSI----------TKLENGQL-LVKWTSEDGESCEEAFDSVLNATGRD  447
            ++G EF +    Q +          +K+E  ++ L    +  GE+     D+VL ATGR 
Sbjct  240  ETGREFQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRR  299

Query  448  PDIAKLDLDKAGVKLNEKTGRIWV--KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  505
            P    L L++ G++  +K GRI V   + +T+  NI+AIGD I+   L   A + G    
Sbjct  300  PFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCV  358

Query  506  RRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLS  565
              +       ++Y+ +   V+T  E    G +EE+ +K  G      Y+    P+  +  
Sbjct  359  ESIAGGHG-HVNYNAIPGVVYTFPEVASVGKTEEE-LKAAGV----AYNVGKFPMMANSR  412

Query  566  TETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  625
              T    +  +VK++  +  DK ++G H +  NAGE+     L ++ G + + +  T   
Sbjct  413  ARTVGETDG-FVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHA  470

Query  626  HPTTAESF  633
            HPT +E+F
Sbjct  471  HPTLSEAF  478

>CCA16670
Length=520

 Score = 109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 122/490 (25%), Positives = 209/490 (43%), Gaps = 49/490 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +++        ++   +++ +   ++R        + +S  + 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDFLR-------TQFKSARID  134

Query  283  YENFLGSFIDPHTLELWHP-----RKGSKQITTRDVVIAVGGRP-RELTIP-GGEHAISS  335
            Y +    F D H + +         K +K++     ++A G RP     IP  G+    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  336  DDIF-WMKTKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKI  392
            D I  W   + P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  393  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAK  452
               M    G  F+   + +S+ K   G   V    + G+      D++L   GR  +   
Sbjct  255  THEMR-NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDG  308

Query  453  LDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  511
            L+L+ AG+  N + G + V  + QT  P+I+A+GD I AP L   +++ GRL S  ++N 
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  512  ATVQMDY--DKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEV------YHTNFVPLEWS  563
                 D    ++ T  F    YG   + E   I   GK + E+      Y          
Sbjct  368  NEANDDSIPSQLTTGNF---PYGIYTIPE---ISMVGKTEKELTSLKMNYEIGVAKYSEL  421

Query  564  LSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  623
               +   A+    +K++ D I  K   G H +G  A E+     +A+ +G T     D V
Sbjct  422  AKGQMSGASADGMLKILFDPISLKL-YGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAV  480

Query  624  GIHPTTAESF  633
              +PT AE++
Sbjct  481  FNYPTLAEAY  490

>PPTG_00938
Length=550

 Score = 109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 130/506 (26%), Positives = 226/506 (45%), Gaps = 55/506 (11%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +P K   +
Sbjct  48   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  99

Query  224  SSLIGEVLHHDSASFGWNVSSGQ-GSAPIFDWKQLVTNVDGYI-RGINFKYKVELRSKYV  281
            ++L      H +   G    S + G   I    + V N +  I R    +  V+L +   
Sbjct  100  AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVENAETDITRHQLLRNGVQLINGTA  159

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDV----------VIAVGGRP-RELTIP-GG  329
            ++     + +   + E +     +K+ ++ D+          ++ VG RP R   IP  G
Sbjct  160  RFLPGSKNMVAVLSNESYETATDAKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  219

Query  330  EHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQ  386
            E    SD++ W K K  P + ++VGA  V +E A  +  + G DV V+  R  +L   D+
Sbjct  220  ETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  279

Query  387  DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGR  446
             ++  +  Y   Q+G  F+     +S+ K   G++ V    E G++     D +L   GR
Sbjct  280  QVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEVFVHL--ESGKTV--VGDGLLYTVGR  334

Query  447  DPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  505
              ++  L+L+  G+   +K GRI V +  QT+ P+IYA GD+I  P L   +++ GRL S
Sbjct  335  QGNVEGLNLEAVGLS-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  393

Query  506  RRLYNNATVQ----------MDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
              +  +  +            D D+V T + +  E    G+     I   GK++ ++   
Sbjct  394  VHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  452

Query  556  NFVPLEWSLSTETRAAAESC------YVKVI-C-DRIRDKFVVGFHYLGPNAGEVTQAMG  607
              VP E  ++     A          ++K+I C D ++   + G H +G  A E+     
Sbjct  453  Q-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK---IFGVHAIGEGATEIIHIGQ  508

Query  608  LAMKLGFTYDQMVDTVGIHPTTAESF  633
            + M  G T +   + V  +PT AE++
Sbjct  509  VVMSTGGTLEYFRNAVFNYPTLAEAY  534

>PHYCA_504445
Length=548

 Score = 108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 130/505 (26%), Positives = 223/505 (44%), Gaps = 53/505 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ ++A  G+ V ++D            +GG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------KRDMMGGVCVHTGTVPSKTFRE  97

Query  224  SSLIGEVLHHDSASFGWNVSSGQ-GSAPIFDWKQLVTNVDGYI-RGINFKYKVEL---RS  278
            ++L      H +   G    S + G   I    + V + +  I R    +  V+L    +
Sbjct  98   AALHLTGYRHKAFYNGHGGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  279  KYVKYENFLGSFIDPHTLELW--HPRKGSKQITTR-----DVVIAVGGRP-RELTIP-GG  329
            +++   N + + +   + E      R  S  I  R       ++ VG RP R   IP  G
Sbjct  158  RFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  217

Query  330  EHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQ  386
            E    SD + W K K  P + ++VGA  V +E A  +  + G DV V+  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  277

Query  387  DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGR  446
            +++  +  Y   Q+G  F+     +S+ K   G++ V    E G++     D +L   GR
Sbjct  278  EVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHL--ESGKTV--VGDGLLYTVGR  332

Query  447  DPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  505
              ++  L+L+  G++  +K GRI V +  QT+ P+IYA GD+I  P L   +++ GRL S
Sbjct  333  QGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  391

Query  506  RRLYNNATVQM----------DYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
              +  + T+            D D+V T + +  E    G+     I   GK++ ++   
Sbjct  392  VHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  450

Query  556  NFVPLEW------SLSTETRAAAESCYVKVI-CDRIRDKFVVGFHYLGPNAGEVTQAMGL  608
              VP E        L+          ++K+I C       ++G H +G  A E+     +
Sbjct  451  Q-VPYEVGKARYEELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGEGATEIIHIGQV  507

Query  609  AMKLGFTYDQMVDTVGIHPTTAESF  633
             M  G   +   + V  +PT AE++
Sbjct  508  VMSTGGDLEYFRNAVFNYPTLAEAY  532

>H257_01186
Length=496

 Score = 106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 122/481 (25%), Positives = 208/481 (43%), Gaps = 37/481 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  223  QSSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++ L +    HH      ++      S  +     +V++    IR       V++     
Sbjct  80   EAVLHLSGFNHHGFYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGKA  139

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRP-RELTIP-GGEHAISSDDIF  339
            ++EN     ++  T+      + +     +  +IA G  P     +P  GE  + SD I 
Sbjct  140  RFENANEVSVENGTVH-----REAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGIL  194

Query  340  WMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYM  396
                 E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +   M
Sbjct  195  EASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKMEM  254

Query  397  EVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF-DSVLNATGRDPDIAKLDL  455
                G  F+     QS+T++  G         D  S + +F +++L   GR  +   L+L
Sbjct  255  R-HKGARFLLGETIQSVTRVAKG------VRVDFASGKSSFAEALLYCVGRQANTDALNL  307

Query  456  DKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNA---  512
            +  G+  N++      K  QTS P+IYA GD I AP L   +++ GRL +  ++++    
Sbjct  308  EGVGLAKNKRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQP  367

Query  513  TVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAA  572
            T Q+D       ++T  E    G +E+   K  G++    Y          L+    A  
Sbjct  368  TSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE-GRN----YAVGMAKYS-ELAKGMMAGG  421

Query  573  ESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAES  632
            +   +K++ D    + V+G H +G  A E+     +AM +        D V  +PT AE+
Sbjct  422  QKGALKILFDP-DTQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYPTLAEA  480

Query  633  F  633
            +
Sbjct  481  Y  481

>PHYRA_47253
Length=481

 Score = 106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 123/496 (25%), Positives = 217/496 (44%), Gaps = 54/496 (11%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +++ +      ++  +++V++ +  +R      +V++   + +
Sbjct  53   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  112

Query  283  YENFLGSFIDPHTLELWH-----PRKGSKQITTRD---------VVIAVGGRPRE--LTI  326
            +E+        H + +        +KG+   +T D          +IA G RP    L  
Sbjct  113  FES-------EHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVP  165

Query  327  PGGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  383
              G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V+  R  +L  
Sbjct  166  IDGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSF  225

Query  384  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNA  443
             D+++ + +   M+  +G  F+   + ++I K+E     VK   + G+    + D++L  
Sbjct  226  CDREIISNLTYEMQ-SNGARFL---LGETIKKVETADNRVKVFFDSGKVL--SADALLYT  279

Query  444  TGRDPDIAKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGR  502
             GR      L+L+  G+  N + G I V K+ QT  P+IYA GD I AP L   +++ GR
Sbjct  280  VGRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  338

Query  503  LLSRRLYN-----NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNF  557
            L S  ++        T Q++       ++T  E    G +E+    +  KD +  Y    
Sbjct  339  LASCHMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTEQ----QLTKDCVN-YEIGV  393

Query  558  VPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  617
                     +   A     +K++ D    K V G H +G  A E+     +AM +  +  
Sbjct  394  AKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLT  452

Query  618  QMVDTVGIHPTTAESF  633
               D V  +PT AE++
Sbjct  453  YFRDAVFNYPTLAEAY  468

>PHALS_12028
Length=579

 Score = 106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 132/512 (26%), Positives = 227/512 (44%), Gaps = 67/512 (13%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G IP K   +
Sbjct  36   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSKTFRE  87

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAP----IFDWKQLVTNVDGYIRGIN----FKYKVE  275
            ++L      H +        +GQG       + D  Q V  V+     I      +  V+
Sbjct  88   AAL------HLTGYRHKAFYNGQGGPSKRFGVEDILQRVKKVESAETDITRHQLLRNGVQ  141

Query  276  LRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDV----------VIAVGGRP-REL  324
            L +   ++       I   + E +     +++ ++ D+          ++ VG RP R  
Sbjct  142  LINGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARRA  201

Query  325  TIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSIL  380
             IP  GE    SD + W K K  P + +VVGA  + +E A  +  + G DV V+  R  +
Sbjct  202  DIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEI  261

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSV  440
            L   D +++  +   M  Q+G  F+   V +S+ K   G++ V    E G++     D +
Sbjct  262  LNMADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHL--ESGKTV--VGDGL  316

Query  441  LNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQ  499
            L   GR  ++  L+L+  G+ + +K G+I V +  QT+ P+IYA GD+I  P L   +++
Sbjct  317  LYTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSME  375

Query  500  AGRLLSRRL-----YNNATVQMDY-----DKVCTAVFTPIEYGCCGLSEEDSIKRFGKDK  549
             GRL S  +      N+  +  D      D+V T + +  E    G+     I   GK++
Sbjct  376  QGRLASVHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNE  434

Query  550  IEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-C-DRIRDKFVVGFHYLGPNAGE  601
             ++     VP E  ++     A          ++K+I C D ++   V+G H +G  A E
Sbjct  435  QQLTKEG-VPYEVGVARYEELAKGQMLGGVPGFLKIIFCPDTLK---VLGVHAIGEGATE  490

Query  602  VTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            +     + M    T +   + V  +PT AE++
Sbjct  491  IIHIGQVLMSTDGTLEYFRNAVFNYPTLAEAY  522

>PYAP_19280
Length=512

 Score = 105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 121/492 (25%), Positives = 215/492 (44%), Gaps = 50/492 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V V+D      +G+S  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLV-TNVDGYIRGINFKYKVELRSKYV  281
            + L +    HH      +++ +      ++  K++V + VD          K +L++  V
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARV  133

Query  282  KYENFLGSFIDPHTLELWHPR-----------KGSKQITTRDVVIAVGGRPRE--LTIPG  328
             Y      F + H + +               + + ++     +IA G RP    L    
Sbjct  134  DYIPGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPID  193

Query  329  GEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFD  385
            G+    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D
Sbjct  194  GKVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCD  253

Query  386  QDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATG  445
             ++ + +   M V+ G  F+   + +SI K+E     VK     G+    + D++L   G
Sbjct  254  NEVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVT--SADALLYTVG  307

Query  446  RDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  505
            R  +   L+++  G+  N++      K  QT   +IYA+GD I AP L   +++ GRL +
Sbjct  308  RQANTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAA  367

Query  506  RRLYNN----ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLE  561
              +++     AT Q++       ++T  E    G +E+    +   +K+  Y        
Sbjct  368  CHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQ----QLTAEKVN-YEIGIAKYS  422

Query  562  WSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  621
                 +    + +  +K++ D    K   G H +G  A E+     +A+ +G +     D
Sbjct  423  ELAKGQMGGGSHNGILKILFDPDTLKL-HGVHAIGEGATEIIHIGQVAIAMGCSLTYFRD  481

Query  622  TVGIHPTTAESF  633
             V  +PT AE++
Sbjct  482  AVFNYPTLAEAY  493

>PPTG_09121
Length=520

 Score = 105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 123/499 (25%), Positives = 214/499 (43%), Gaps = 57/499 (11%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +++ +      ++  +++V++ +  +R      +V++   + +
Sbjct  84   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  143

Query  283  YENFLGSFIDPHTLELWHPRKGSKQ-----------------ITTRDVVIAVGGRP-REL  324
            +EN        H + +       K+                 I     +IA G RP    
Sbjct  144  FEN-------EHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNP  196

Query  325  TIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  380
             IP  G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +
Sbjct  197  LIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDI  256

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSV  440
            L   D ++ + +   M+  +G  F+   + +++ K+E     VK     G+    + D++
Sbjct  257  LSFCDSEIISNLTYEMQ-SNGARFL---LGETVKKVETTDKRVKVFFNSGKVL--SADAL  310

Query  441  LNATGRDPDIAKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQ  499
            L   GR      L+L+  G+  N + G I V K+ QT  P+IYA GD I AP L   +++
Sbjct  311  LYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSME  369

Query  500  AGRLLSRRLYN-----NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYH  554
             GRL S  ++N      AT Q++       ++T  E    G +E+    +  KD +  Y 
Sbjct  370  QGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQ----QLTKDCVN-YE  424

Query  555  TNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  614
                        +   A     +K++ D    K V G H +G  A E+     +AM +  
Sbjct  425  IGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDC  483

Query  615  TYDQMVDTVGIHPTTAESF  633
            +     D V  +PT AE++
Sbjct  484  SLTYFRDAVFNYPTLAEAY  502

>CCI50816
Length=807

 Score = 106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 126/489 (26%), Positives = 210/489 (43%), Gaps = 47/489 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +  S    +  I D   ++  V+  I+      +V+ +S  V 
Sbjct  82   AVLHLSGYRHHGF----YGKSYSMKNVTIDD---ILYRVNRVIQSEVDLLRVQFKSARVD  134

Query  283  YENFLGSFIDPHTLELWHP-----RKGSKQITTRDVVIAVGGRP-RELTIP-GGEHAISS  335
            Y +    F D H + +         K +K++     ++A G RP     IP  G+    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  336  DDIF-WMKTKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKI  392
            D I  W   + P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  393  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAK  452
               M    G  F+     +S+ K   G +LV   S  G+      D++L   GR  +   
Sbjct  255  THEMR-NHGARFLLGETIESVDKSSRG-VLVGLKS--GKKVHG--DALLYVVGRQANTDG  308

Query  453  LDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN-  510
            L+L+ AG+  N + G + V  + QT  P+I+A+GD I AP L   +++ GRL S  ++N 
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  511  ------NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSL  564
                  +   Q+        ++T  E    G +E    K+    +I  Y           
Sbjct  368  DESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTE----KQLTSQQIN-YEIGVAKYSELA  422

Query  565  STETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  624
              +   A+    +K++ D    K + G H +G  A E+     +A+ +G T     D V 
Sbjct  423  KGQMSGASADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVF  481

Query  625  IHPTTAESF  633
             +PT AE++
Sbjct  482  NYPTLAEAY  490

>PYAP_18131
Length=226

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 72/119 (61%), Gaps = 7/119 (6%)

Query  743  LDDESLYKVTEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGR  801
            +DD++ YKV    A FECG T P    QPIP N   +++G+T DG   +W+D+T+V   +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  802  --NCHTEFPHG--QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
              NCH     G   +++D+S C G C + WYWLG++ +   +SWQVYK C+ +  + TA
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PHYCA_14368
Length=219

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 76/168 (45%), Gaps = 46/168 (27%)

Query  684  LDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAML  743
            LD+     QIVL P P +  +  D +   LA+L+ QG  T  +  SW  +  Y SLR  +
Sbjct  21   LDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM  80

Query  744  DDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNC  803
            D+ + Y VT+ A F CG T P+                                      
Sbjct  81   DN-AKYTVTDGADFSCGFTDPK--------------------------------------  101

Query  804  HTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
                    + VDYSSC G+C L WYWLGI++++  YSWQVYK C+ LS
Sbjct  102  -------DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  142

>PYIR_14132
Length=513

 Score = 104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 129/504 (26%), Positives = 218/504 (43%), Gaps = 51/504 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSKTFRE  62

Query  224  SSLIGEVLHHDSASFGW-NVSSGQGSAPIFDWKQLVTNVDGYI-RGINFKYKVELRSKYV  281
            ++L      H S   G  N +   G   I    + V + +  I R    +  +EL +   
Sbjct  63   ATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNIELINGTA  122

Query  282  KYENFLGSFI------DPHTLELWHPRKGSKQITTR-----DVVIAVGGRP-RELTIP-G  328
            ++    G  +      D +T      R  S  I  R       +IAVG RP R   IP  
Sbjct  123  RFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRPDIPFD  182

Query  329  GEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFD  385
            G+    SD + W   K  P + +VVGA  + +E A  +  + G +V ++  R  +L   D
Sbjct  183  GQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  242

Query  386  QDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATG  445
            ++++  +   M  Q+G  F  +   +S+ K +NG+++V   S  G++     D +L   G
Sbjct  243  REVSEALCYSMR-QTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLG  297

Query  446  RDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLL  504
            R  +   L+L   G++ + K G I V  + QT  P+IYA GD I  P L   +++ GRL 
Sbjct  298  RQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLA  356

Query  505  SRRLYNNATVQMDYDKVCTA-----VFTPIEYGCC---GLSEEDSIKRFGKDKIEVYHTN  556
            S  +  +       +    +     + T +  G     G+     I   GK++ ++   N
Sbjct  357  SVHMRTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTSQN  416

Query  557  FVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLGPNAGEVTQAMGLA  609
             +P E  ++     A          ++K+I C +     V+G H +G  A E+     + 
Sbjct  417  -IPYEVGVARYEELAKGQMLGGVPGFLKIIFCPKTLQ--VLGVHAIGEGATEIIHIGQVV  473

Query  610  MKLGFTYDQMVDTVGIHPTTAESF  633
            M  G T +   + V  +PT AE++
Sbjct  474  MSTGGTIEYFRNAVFNYPTLAEAY  497

>PYAR_16840
Length=536

 Score = 104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 124/510 (24%), Positives = 216/510 (42%), Gaps = 69/510 (14%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLV-TNVDGYIRGINFKYKVELRSKYV  281
            + L +    HH      +++ +      ++  K++V + VD          K +L++  +
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARI  140

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQ-------ITTRDVVIAVGGRPRE--LTIPGGEHA  332
             Y   L  F + H + +        Q       +     +IA G RP    L    G+  
Sbjct  141  DYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVI  200

Query  333  ISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-----VRSILLRGFD  385
            + SD I     +E P   +VVGA  + +E A  L  + G+ V V+     VR++L     
Sbjct  201  LDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---S  257

Query  386  QDMA------------------NKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTS  427
            +DM+                  ++I   ++ +  ++  R  + ++I K+E     VK   
Sbjct  258  RDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFL  317

Query  428  EDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDV  487
              G+    + D++L   GR      L+L+  G+  N++      K  QT  P+IYA+GD 
Sbjct  318  TSGKVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKPHIYAVGDC  375

Query  488  IDAPELTPVAIQAGRLLSRRLYNN---ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKR  544
            I AP L   +++ GRL +  ++      T Q++       ++T  E    G +E+    +
Sbjct  376  IGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQ----Q  431

Query  545  FGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVV-GFHYLGPNAGEVT  603
               +K+  Y          L+    +      +K++ D   D   V G H +G  A E+ 
Sbjct  432  LTSEKVN-YEIGLAKYS-ELAKGQMSGGAFGMLKILFD--PDTLRVHGVHAIGEGATEII  487

Query  604  QAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
                +A+ +G +     D V  +PT AE++
Sbjct  488  HIGQVAIAMGCSLTYFRDAVFNYPTLAEAY  517

>PYU1_G005699
Length=550

 Score = 104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 134/504 (27%), Positives = 217/504 (43%), Gaps = 54/504 (11%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ ++A  G+ V ++D             GG CV+ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFRE  101

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVD----GYIRGINFKYKVELRSK  279
            ++L      H   SF    SS      I D  Q V  V+       R    +  VEL + 
Sbjct  102  ATLHLTAYRHR--SFYDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELING  159

Query  280  YVKY-----ENFLGSFI-DPHTLELWHPRKGSKQITTR-----DVVIAVGGRP-RELTIP  327
              ++     +N +     D +T      R  S  I  R       +IAVG RP R   IP
Sbjct  160  TARFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIP  219

Query  328  -GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  383
              G+    SD + W   K  P + +VVGA  + +E A  +  + G +V ++  R  +L  
Sbjct  220  FDGQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDM  279

Query  384  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNA  443
             D++++  +   M  Q+G  F  +   +S+ K+ NG+++V   S  G++     D +L  
Sbjct  280  ADREVSEALCYSMR-QTGARFFVEETIKSVEKV-NGEVIVHLNS--GKTL--VGDGLLYT  333

Query  444  TGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGR  502
             GR  +   L+L   G++  +K G I V    QT+ P+IYA GD I  P L   +++ GR
Sbjct  334  LGRQGNTDGLNLPAVGLE-ADKRGLIQVDENFQTAVPHIYAAGDCIGFPALASTSMEQGR  392

Query  503  LLSRRLYNNATVQMDYDKVCTA---VFTPIEYGCC---GLSEEDSIKRFGKDKIEVYHTN  556
            L S  +          D   T    + T +  G     G+     I   GK++ ++   N
Sbjct  393  LASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNEQQLTKEN  452

Query  557  FVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLGPNAGEVTQAMGLA  609
             VP E  L+     A          ++K+I C +     ++G H +G  A E+     + 
Sbjct  453  -VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPKTLQ--LLGVHAIGEGATEIIHIGQVV  509

Query  610  MKLGFTYDQMVDTVGIHPTTAESF  633
            M  G T +   + V  +PT AE++
Sbjct  510  MSTGGTIEYFRNAVFNYPTLAEAY  533

>H310_00561
Length=497

 Score = 102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 122/484 (25%), Positives = 213/484 (44%), Gaps = 43/484 (9%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  223  QSSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++ L +    HH    +G + S  +        + ++  V+  +       + +L++ +V
Sbjct  81   EAVLHLSGFNHH--GFYGKSYSRER-----ITLRDILHRVNVVVSSEMDVIRAQLKAAHV  133

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTR--DVVIAVGGRP-RELTIP-GGEHAISSDD  337
            +       F + + + +     GS+    R    +IA G  P     +P  GE  + SD 
Sbjct  134  QIIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDG  193

Query  338  IF-WMKTKEPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGE  394
            I    K + P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +  
Sbjct  194  ILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALKM  253

Query  395  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAF-DSVLNATGRDPDIAKL  453
             M    G  F+     QS+ ++  G         D  S + +F +++L   GR  +   L
Sbjct  254  EMR-HKGARFLLGETIQSVKRVRKG------VRVDFASGKSSFAEALLYCVGRQANTDTL  306

Query  454  DLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY---  509
            +L+  G+  N K G + V  + QT+ P+I+A GD I AP L   +++ GRL +  ++   
Sbjct  307  NLEGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHE  365

Query  510  NNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETR  569
            +  T Q+D       ++T  E    G +E+   K  G++     +   V     L+    
Sbjct  366  DQPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE-GRN-----YAVGVAKYSELAKGMM  419

Query  570  AAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTT  629
            A  +   +K++ D      V+G H +G  A E+     +AM +        D V  +PT 
Sbjct  420  AGGQKGALKLLFDP-DSHSVLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTL  478

Query  630  AESF  633
            AE++
Sbjct  479  AEAY  482

>PYIW_24688
Length=259

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 134/281 (48%), Gaps = 35/281 (12%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YD + IGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCV+ GC+PKK+M  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLV---VERGRKYGGAGLGGTCVHYGCVPKKIMFN  63

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPI--FDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++    V H + A+     ++G        FDW  + T  D YI  +N  Y+  L +  V
Sbjct  64   AAT--HVEHLNRAADYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQV  121

Query  282  KYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWM  341
                 +   +  + +E+          T + +++AVGG+P               D F+ 
Sbjct  122  DLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------DGFFK  161

Query  342  KTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMANKIGEYME  397
               +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD   +D+ N+ GE   
Sbjct  162  LEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE---  218

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFD  438
             ++GI F+R +  + I K  +G L +       E     FD
Sbjct  219  -KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFD  258

>PYU1_G011605
Length=524

 Score = 101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 120/487 (25%), Positives = 207/487 (43%), Gaps = 37/487 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  223  QSSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++ L +    HH      +++ +      ++  K++V +    I+      +VE    + 
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGFA  151

Query  282  KYEN--FLGSFIDPHTLELWHPRKGSKQIT---TRDVVIAVGGRP-RELTIP-GGEHAIS  334
            ++EN   +    DP T E     + +  ++       +IA G RP     +P  G+    
Sbjct  152  RFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVIFD  211

Query  335  SDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANK  391
            SD I     ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + 
Sbjct  212  SDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEIISN  271

Query  392  IGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIA  451
            +   M    G  F+       + K  NG + V   S    S     D++L   GR     
Sbjct  272  LTYEMR-SKGARFLLGETINRVEKTGNG-VTVYLNSGKVTSA----DAMLYTVGRQASTD  325

Query  452  KLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  511
             L+L+   +  N +      K  QT  P+IYA+GD I AP L   +++ GRL +  +++ 
Sbjct  326  GLNLEAVNLSRNPRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWDQ  385

Query  512  ----ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEV-YHTNFVPLEWSLST  566
                 T Q++       ++T  E    G +E+   K     +I +  ++     + S ST
Sbjct  386  EEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGVNFEIGIAKYSELAKGQMSGST  445

Query  567  ETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  626
                      +K++ D    K   G H +G  A E+     +A+ +G +     D V  +
Sbjct  446  ------AGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVFNY  498

Query  627  PTTAESF  633
            PT AE++
Sbjct  499  PTLAEAY  505

>PHALS_10055
Length=516

 Score = 101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 120/496 (24%), Positives = 216/496 (44%), Gaps = 53/496 (11%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDL+VIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  223  QSSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++ L +    HH      +++ +      ++  +++V++ +  +R      +V++   + 
Sbjct  83   EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  142

Query  282  KYENFLGSFIDPHTLELWHP--RKGSKQITTRDV-----------VIAVGGRPRE--LTI  326
            ++EN        H + +      +  K+I+   V           +IA G RP    L  
Sbjct  143  RFEN-------EHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIP  195

Query  327  PGGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRG  383
              G+  I SD I        P   +V+GA  + +E A  +  + G+ V V+  R  +L  
Sbjct  196  IDGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPF  255

Query  384  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNA  443
             D ++ + +   M+  +G  F+   + +++ K+E  +  VK     G+    + D++L  
Sbjct  256  CDLEIISNLTYEMQ-SNGARFL---LGETVKKVETTKNQVKVFFNSGKVL--SADALLYT  309

Query  444  TGRDPDIAKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGR  502
             GR      L+L+  G+  N + G I V K+ QT  P+IYA GD I AP L   +++ GR
Sbjct  310  VGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGR  368

Query  503  LLSRRLYN-----NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNF  557
            L S  ++       AT Q++       ++T  E    G +E+    +  K+ I  Y    
Sbjct  369  LASCHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQ----QLTKNCIN-YEIGI  423

Query  558  VPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  617
                     +   A     +K++ D      ++G H +G  A E      +AM +G +  
Sbjct  424  AKYSELAKGQMMGAMAGGTLKILFDP-ETLSLLGVHAIGEGATETIHIGQVAMAMGCSLT  482

Query  618  QMVDTVGIHPTTAESF  633
               D V  +PT AE++
Sbjct  483  YFRDAVFNYPTLAEAY  498

>PYVX_20512
Length=528

 Score = 100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 121/498 (24%), Positives = 206/498 (41%), Gaps = 54/498 (11%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  223  QSSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYV  281
            ++ L +    HH      +++ +      ++  +++V +    I       K +L++  V
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKNITIDDILYRVQRVVASEVDVI-------KAQLKAARV  141

Query  282  KYENFLGSFIDPHTLELWHPRKGS----------------KQITTRDVVIAVGGRPRE--  323
             Y     SF  PH L +      S                 ++     +IA G RP    
Sbjct  142  DYIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNP  201

Query  324  LTIPGGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  380
            L    G+    SD I   +  + P   +VVGA  + +E A  +  + G+ V V+  R  +
Sbjct  202  LVPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDI  261

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSV  440
            L   D ++ + +   M    G  F+     +SI K E G   VK     G+      D++
Sbjct  262  LSFCDTEIISNLMYEMR-SKGARFLLGETIKSIEKSERG---VKVFFNSGKVATA--DAL  315

Query  441  LNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQA  500
            L   GR      L+L+  G+  N +      K+ QT   +IYA GD I AP L   +++ 
Sbjct  316  LYTVGRQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQ  375

Query  501  GRLLSRRLYNN-----ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555
            GRL +  ++++     +T Q+D       ++T  E    G +E+   K     ++ +   
Sbjct  376  GRLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGVNYEVGIAKY  435

Query  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615
            +    E +    T A A      + C    + F  G H +G  A E+     +A+ +G +
Sbjct  436  S----ELAKGQMTGAIAGGMLKILFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMGCS  489

Query  616  YDQMVDTVGIHPTTAESF  633
                 + V  +PT AE++
Sbjct  490  LTYFRNAVFNYPTLAEAY  507

>H257_16541
Length=494

 Score = 100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 199/447 (45%), Gaps = 47/447 (11%)

Query  206  LGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYI  265
            LGGTC+NVGCIP K +   + +     H+  S G  V +        D+ QL+ + D  +
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGIKVDNVS-----IDFDQLMKSKDKTV  116

Query  266  RGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGR-----  320
            + +    +   +   V Y    G  +    + +     G++ + T++++IA G       
Sbjct  117  KILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLP  176

Query  321  PRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSIL  380
            P  +   GG+  I S     +K + P   +VVG   + LE       +G  + V+     
Sbjct  177  PVPVDNEGGK-IIDSTGALALK-RVPKHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  229

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT-----KLENGQL---LVKWTSE---D  429
                  + A+KI   M+ +   EF +    Q +T     K+   ++   +V  T E    
Sbjct  230  ------EYADKICPTMDHEVTKEFQKLLTKQGMTFKLGQKVTASKVDGDVVTLTVEPAAG  283

Query  430  GESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVK--HEQTSTPNIYAIGDV  487
            GE+     D VL ATGR P  A L L++ G++  +K GRI V   + QT+   I+AIGDV
Sbjct  284  GEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAIGDV  342

Query  488  IDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGK  547
            I+   L   A + G  +   +       ++YD +   ++T  E    G +EE+      K
Sbjct  343  IEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEEL-----K  396

Query  548  DKIEVYHTNFVPLEWSLSTETRAAAES-CYVKVICDRIRDKFVVGFHYLGPNAGEVTQAM  606
                 Y+    P+    ++  RA  E+  +VKV+  +  DK ++G H +  NAGE+    
Sbjct  397  TANVAYNVGKFPMMA--NSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEG  453

Query  607  GLAMKLGFTYDQMVDTVGIHPTTAESF  633
             L ++ G + + +  T   HPT +E+F
Sbjct  454  VLGIEYGASAEDIGRTCHAHPTLSEAF  480

>H310_02523
Length=494

 Score = 100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 123/473 (26%), Positives = 207/473 (44%), Gaps = 57/473 (12%)

Query  181  EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGW  240
            +AA  G K   ++      +GT   LGGTC+NVGCIP K +   + +     HD  S G 
Sbjct  45   KAAQLGLKTACVE-----ARGT---LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGI  96

Query  241  NVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWH  300
             V +        D+ QL+ + +  ++ +    +   +   V Y    G  +    L +  
Sbjct  97   KVDNVS-----IDFNQLMKSKEKTVKILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVAL  151

Query  301  PRKGSKQITTRDVVIAVGGR-----PRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGAS  355
               G++ + T++++IA G       P  +   GG+  + S     +K + P   +VVG  
Sbjct  152  NGGGNQTLHTKNILIATGSEVTPLPPVPVDNEGGK-IVDSTGALSLK-RIPNHLVVVGGG  209

Query  356  YVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITK  415
             + LE       +G  + V+           + A+KI   M+ +   EF +    Q +T 
Sbjct  210  VIGLEMGSVYGRLGSKITVV-----------EYADKICPTMDHELTKEFQKLLTKQGMT-  257

Query  416  LENGQLL---------VKWTSE---DGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLN  463
             + GQ +         V  T E    G++     D VL ATGR P  A L L+  G++  
Sbjct  258  FKLGQKVTASKVDGDTVTLTVEPAAGGDATTIEADCVLVATGRRPYTAGLGLEDMGIQ-T  316

Query  464  EKTGRIWVK--HEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKV  521
            ++ GRI V   + QT+   IYAIGDVI+   L   A + G  +   +       ++YD +
Sbjct  317  DRFGRIKVNLSNFQTNVDGIYAIGDVIEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAI  375

Query  522  CTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAES-CYVKVI  580
               ++T  E    G +EE+      K     Y+    P+    ++  RA  E+  +VKV+
Sbjct  376  PGVIYTFPEVASVGKTEEEL-----KAANVAYNVGKFPMMA--NSRARAVGETDGFVKVL  428

Query  581  CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
              +  DK ++G H +  NAGE+     L ++ G + + +  T   HPT +E+F
Sbjct  429  AAKDDDK-ILGIHIIASNAGEMISEGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>PYIW_20257
Length=503

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 130/500 (26%), Positives = 207/500 (41%), Gaps = 92/500 (18%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTVPSKTFRE  101

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            ++L      H +A    +   GQ S P                           +K    
Sbjct  102  ATL------HLTAYRHRSFYEGQ-STP---------------------------AKRFGI  127

Query  284  ENFLGSFIDPHTLELWHPRKGSKQITTRD----VVIAVGGRP-RELTIP-GGEHAISSDD  337
            E+ L        ++  H R G +    R      +IAVG RP R   IP  GE    SD 
Sbjct  128  EDIL------QRVKKLHDRHGRQTPLERRHLQAFLIAVGTRPARRPDIPFDGETIFDSDQ  181

Query  338  IFWMKTKE-PGKTLVVGASYVALECAGFLK---GMGYDVKVMVRSILLRGFDQDMANK-I  392
            + W   K  P + +VVGA  + +E A  +    GM   +    R IL      DMA++ +
Sbjct  182  LLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREIL------DMADREV  235

Query  393  GE---YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPD  449
             E   Y   Q+G  F  +   +S+ K +NG+++V   S  G++     D +L   GR  +
Sbjct  236  SEALCYSMRQTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLGRQGN  291

Query  450  IAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  508
               L+L+  G+K  +K G I V  + QT+ P+IYA GD I  P L   +++ GRL S  +
Sbjct  292  TEGLNLEAIGLK-ADKRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHM  350

Query  509  YNNATVQMDYDKVCTA-----VFTPIEYGCC---GLSEEDSIKRFGKDKIEVYHTNFVPL  560
                      D    +     + T +  G     G+     I   GK++ ++  +  +P 
Sbjct  351  RTAKPTNKKGDSETESTDPAFMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLT-SQCIPY  409

Query  561  EWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  613
            E  ++     A          ++K+I C       V+G H +G  A E+     + M  G
Sbjct  410  EVGVARYEELAKGQMLGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIHIGQVVMSTG  467

Query  614  FTYDQMVDTVGIHPTTAESF  633
             T +   + V  +PT AE++
Sbjct  468  GTIEYFRNAVFNYPTLAEAY  487

>SDRG_14446
Length=495

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 117/480 (24%), Positives = 204/480 (43%), Gaps = 37/480 (8%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            +YDLVVIG G   + C+ E+   G+ V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            +S L      H      +  S  + +  + D   ++  V+  +       + +L++  V 
Sbjct  80   ESVLHLSGFRHQGF---YGKSYARDNITLND---ILGRVNTVVSKEMDVIQAQLKAARVD  133

Query  283  YENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRE--LTIPGGEHAISSDDIFW  340
                L  F + + + +        ++  +  ++A G RP    L    G+  + SD I  
Sbjct  134  LVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILN  193

Query  341  M-KTKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYME  397
               TK P   +VVGA  + +E A  L  + G +V V+  R+ +L   D ++ + +   M 
Sbjct  194  HGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMR  253

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDK  457
               G  F+     +S+   +NG   VK     G++     +++L   GR  +   L+L+ 
Sbjct  254  -HKGARFLLGESIKSVEHFKNG---VKVEFNSGKAM--FAEALLYCVGRQANTDGLNLEA  307

Query  458  AGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN---AT  513
             G+  N + G I V  + QTS P+IYA GD I AP L   +++ GRL +  ++++    T
Sbjct  308  VGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTT  366

Query  514  VQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAE  573
             Q++       ++T  E    G +E+   K         Y             +     E
Sbjct  367  SQLESGNYPYGIYTIPEISMVGKTEQQLTKEGAN-----YAVGLAKFSELAKGQMSGDIE  421

Query  574  SCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
               +K++ D +  +  +G H +G  A E+     +AM +        D V  +PT AE +
Sbjct  422  GI-LKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAEGY  479

>PHYKE_9807
Length=557

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 128/514 (25%), Positives = 218/514 (42%), Gaps = 72/514 (14%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL-MH  222
            +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G   ++  MH
Sbjct  56   FDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTTFREAAMH  107

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             +       ++        +        + D  Q V  V+     I    + +L+   V+
Sbjct  108  LTGYRHRAFYNGHGGISKRIG-------VEDILQRVKKVEAAETDIT---RHQLQRNGVQ  157

Query  283  YENFLGSFI--DPHTL-----ELWHPRKGSKQITTRDV----------VIAVGGRP-REL  324
              +    F+  D H L     E +     +K+ T  D+          ++ VG RP R  
Sbjct  158  LISGTARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVGTRPARHP  217

Query  325  TIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  380
             IP  GE    SD + W K K  P + ++VG   V +E A  +  + G DV V+  R  +
Sbjct  218  DIPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRKEI  277

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSV  440
            L   D++++  +  Y   Q+G  F+     + + K   G++LV+  S  G++     D +
Sbjct  278  LNMADKEVSEALC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVRLDS--GKTV--VGDGL  332

Query  441  LNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQ  499
            L   GR  ++  L L+  G+   +K GRI V +  QT  P+IYA GD+I  P L   +++
Sbjct  333  LYTVGRQGNVEGLHLESVGIH-PDKRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTSME  391

Query  500  AGRLLSRRLYNNATVQM-------------DYDKVCTAVFTPIEYGCCGLSEEDSIKRFG  546
             GRL S  +   + V               D D++ T + +  E    G+     I   G
Sbjct  392  QGRLASVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSG-EVFPFGIYTVPEISMVG  450

Query  547  KDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLGPNA  599
            K++ ++     VP E  ++     A          ++K+I C       ++G H +G  A
Sbjct  451  KNEQQLTQEQ-VPYEVGMARYEELARGQMLGGVPGFLKIIFCPNTLQ--ILGVHAIGEGA  507

Query  600  GEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
             E+     + M  G T +   + V  +PT AE++
Sbjct  508  TEIIHIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>PYIW_19795
Length=519

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 118/492 (24%), Positives = 206/492 (42%), Gaps = 50/492 (10%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +++ +      ++  K++V +    I       K +L++  V+
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVI-------KAQLKAARVE  141

Query  283  YENFLGSFIDPHTLELWHPRKGSK-----------QITTRDVVIAVGGRPRE--LTIPGG  329
            Y   L  F   H + +      ++           ++     +IA G RP    L    G
Sbjct  142  YIPGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDG  201

Query  330  EHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQ  386
            +    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D 
Sbjct  202  KVIFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDN  261

Query  387  DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGR  446
            ++ + +   M    G  F+     + + K E+G + V + S    +     D++L   GR
Sbjct  262  EIISNLTYEMR-SKGARFLLGETIKQVEKTEDG-VTVHFNSGKTATA----DALLYTVGR  315

Query  447  DPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  506
                  L+L+   +  N +         QT+  +IYA GD I AP L   +++ GRL + 
Sbjct  316  QASTDGLNLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAAC  375

Query  507  RLYNN----ATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVY-HTNFVPLE  561
             +++      T Q++       ++T  E    G +E+   K     +I +  ++     +
Sbjct  376  HMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGANYEIGIAKYSELAKGQ  435

Query  562  WSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVD  621
             S ST          +K++ D    K  +G H +G  A E+     +AM +G +     D
Sbjct  436  MSGST------AGGMLKILFDPTTLKL-LGVHAIGEGATEIIHIGQVAMAMGCSVTYFRD  488

Query  622  TVGIHPTTAESF  633
             V  +PT AE++
Sbjct  489  AVFNYPTLAEAY  500

>SDRG_05060
Length=559

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 129/516 (25%), Positives = 226/516 (44%), Gaps = 73/516 (14%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  50   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  101

Query  224  SSLIGEVLHHDSASF---GWNVSSGQGSA--PIFDWKQLVTNVD-GYIRGINFKYKVELR  277
            + L   +  H    F    ++ +SG+  +   I D  Q V + +    R    +  + L 
Sbjct  102  AVL--HLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLI  159

Query  278  SKYVKY-----ENFLGSFIDPHTLELWHPRKGS-----KQITTRD-VVIAVGGRP-RELT  325
            +   ++     +  +    +    E    ++ S     K++ T D  +I+VG RP R   
Sbjct  160  NGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPN  219

Query  326  IP-GGEHAISSDDIFW-MKTKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILL  381
            +   GE    SD + W   T  P + +VVGA  + +E A  +  + G  V V+  R  +L
Sbjct  220  MDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEIL  279

Query  382  RGFDQDMANKI-------GEYMEVQSGIEFIRKTVPQS--ITKLENGQLLVKWTSEDGES  432
               D+++++ +       G     +  I+F+ K + +   +  L++G+++V         
Sbjct  280  EMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--------  331

Query  433  CEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAP  491
                 D++L   GR  ++  LDL+  G++ N + G + V +  QTS P+IYA GD I  P
Sbjct  332  -----DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYP  385

Query  492  ELTPVAIQAGRLLSRRLYNNATV---QMDYDKVCTAVF-TPIEYGCC---GLSEEDSIKR  544
             L  V+++ GRL S  +  +      + D D   T+ F T +  G     G+     I  
Sbjct  386  ALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISM  445

Query  545  FGKDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLGP  597
             GK + ++   N VP E  ++     A          ++K+I C       ++G H +G 
Sbjct  446  VGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGE  502

Query  598  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
             A E+     + M  G T +   + V  +PT AE++
Sbjct  503  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>PYVX_23499
Length=519

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 129/509 (25%), Positives = 213/509 (42%), Gaps = 59/509 (12%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+V+G G  G  C+ ++A  G+ V ++D            LGG CV+ G +P K   +
Sbjct  15   FDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  66

Query  224  SSLIGEVLHH----DSASFG----------WNVSSGQGSAPIFDWKQLVTNVDGYIRGIN  269
            ++L      H    DSAS              V   +G+       QL+ N    I G  
Sbjct  67   ATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNVELIHGTA  126

Query  270  FKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRD-VVIAVGGRP-RELTIP  327
                 E R+      N    +  P   +        K++ T D  +I VG RP R   IP
Sbjct  127  RFLPDEKRNMVAVLSN--AKYDTPTDAKRHTSADICKRVLTADKFLICVGTRPARREDIP  184

Query  328  -GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  383
              G+    SD + W   K  P + +VVGA  + +E A  +  + G +V V+  R  +L  
Sbjct  185  FDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDGRKEILDM  244

Query  384  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNA  443
             D++++  +   M  Q+G  F  +   + + K ENG+++    S  G+      D +L  
Sbjct  245  ADKEVSESLCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHLNS--GKVI--VGDGLLYT  299

Query  444  TGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGR  502
             GR  +   L+L   G++  +K G + V  + QT  P+IYA GD I  P L   +++ GR
Sbjct  300  LGRQGNTDGLNLQAVGLE-TDKRGFLNVNDDFQTEVPHIYAAGDCIGYPALASTSMEQGR  358

Query  503  LLSRRLYNNATVQMDYDKVCTAV----------FTPIEYGCCGLSEEDSIKRFGKDKIEV  552
            L S  +   +      ++    +              E    G+     I   GK++ ++
Sbjct  359  LASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISMVGKNEQQL  418

Query  553  YHTNFVPLEWSLSTETRAAAESC------YVKVI-C-DRIRDKFVVGFHYLGPNAGEVTQ  604
               N VP E  L+     A          ++K+I C D ++   V+G H +G  A E+  
Sbjct  419  TKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPDTLK---VLGVHAIGEGATEIIH  474

Query  605  AMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
               + M  G T +   + V  +PT AE++
Sbjct  475  IGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>SPRG_12054
Length=558

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 129/516 (25%), Positives = 226/516 (44%), Gaps = 73/516 (14%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  100

Query  224  SSLIGEVLHHDSASF---GWNVSSGQGSA--PIFDWKQLVTNVD-GYIRGINFKYKVELR  277
            + L   +  H    F    ++ +SG+  +   I D  Q V + +    R    +  + L 
Sbjct  101  AVL--HLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLI  158

Query  278  SKYVKY-----ENFLGSFIDPHTLELWHPRKGS-----KQITTRD-VVIAVGGRP-RELT  325
            +   ++     +  +    +    E    ++ S     K++ T D  +I+VG RP R   
Sbjct  159  NGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPN  218

Query  326  IP-GGEHAISSDDIFW-MKTKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILL  381
            +   GE    SD + W   T  P + +VVGA  + +E A  +  + G  V V+  R  +L
Sbjct  219  MDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEIL  278

Query  382  RGFDQDMANKI-------GEYMEVQSGIEFIRKTVPQS--ITKLENGQLLVKWTSEDGES  432
               D+++++ +       G     +  I+F+ K + +   +  L++G+++V         
Sbjct  279  EMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--------  330

Query  433  CEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAP  491
                 D++L   GR  ++  LDL+  G++ N + G + V +  QTS P+IYA GD I  P
Sbjct  331  -----DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYP  384

Query  492  ELTPVAIQAGRLLSRRLYNNATV---QMDYDKVCTAVF-TPIEYGCC---GLSEEDSIKR  544
             L  V+++ GRL S  +  +      + D D   T+ F T +  G     G+     I  
Sbjct  385  ALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISM  444

Query  545  FGKDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLGP  597
             GK + ++   N VP E  ++     A          ++K+I C       ++G H +G 
Sbjct  445  VGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGE  501

Query  598  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
             A E+     + M  G T +   + V  +PT AE++
Sbjct  502  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  537

>HYAP_04149
Length=564

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 129/517 (25%), Positives = 224/517 (43%), Gaps = 68/517 (13%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ ++A  G  V ++D            LGG CV+ G +P K   +
Sbjct  53   FDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKTFRE  104

Query  224  SSLIGEVLHHDSASFGWNVSSG-QGSAPIFDWKQLVTNVDGYIRGIN----FKYKVELRS  278
            ++L   +  +   +F +N  +G      + D  Q V  V+     I      +  V+L +
Sbjct  105  AAL--HLTGYRHRAF-YNGQAGPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQLIT  161

Query  279  KYVKYENFLGSFIDPHTLELWHPRKGSKQ----------ITTRDVVIAVGGRP-RELTIP  327
               ++       I   + E +     +K+          +T  + ++ VG RP R   IP
Sbjct  162  GTARFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTADNFLVCVGTRPARRADIP  221

Query  328  -GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  383
              GE    SD + W K K  P + +VVGA  V +E A  +  + G DV V+  R  +L  
Sbjct  222  FDGETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEM  281

Query  384  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNA  443
             D++++  +  Y   Q+G  F+   V +S+ K   G++ V    E G++     D +L  
Sbjct  282  ADKEVSEALC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHL--ESGKTV--VGDGLLYT  336

Query  444  TGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYA---------IGDVIDAPEL  493
             GR  ++  L+L+  G+   +K GRI V +  QT+ P++YA          GD+I  P L
Sbjct  337  VGRQGNVEGLNLEAVGLA-PDKRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPAL  395

Query  494  TPVAIQAGRLLSRRLYNNATVQM----------DYDKVCTAVFTPIEYGCCGLSEEDSIK  543
               +++ GRL S  +  + +             D D+V T + +  E    G+     I 
Sbjct  396  ASTSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEIS  454

Query  544  RFGKDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVGFHYLG  596
              GK++ ++     VP E  ++     A          ++K+I C +     ++G H +G
Sbjct  455  MVGKNEQQLTREQ-VPYEVGIARYEELAKGQMLGGVPGFLKIIFCPKTLK--LLGVHAIG  511

Query  597  PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
              A E+     + M    T +   + V  +PT AE++
Sbjct  512  EGATEIIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAY  548

>PYAP_19148
Length=535

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 130/522 (25%), Positives = 214/522 (41%), Gaps = 77/522 (15%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ + A  G+ V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            + L   +  H   SF    S  +    I D  Q V  V+     I    + +L    ++ 
Sbjct  63   AIL--HLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDIT---RHQLLRNGIEL  117

Query  284  ENFLGSFI-DP---------------------HTLELWHPRKGSKQ-------ITTRDVV  314
             N    F+ DP                     HT      R G+         +T    +
Sbjct  118  INGTARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKFL  177

Query  315  IAVGGRP-RELTIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GY  370
            +AVG RP R   IP  G+    SD I W      P + +VVGA  + +E A  +  + G 
Sbjct  178  VAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGS  237

Query  371  DVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSED  429
            +V V+  R  +L   D+++A  + +Y   Q+G  F       ++ K  NG+++VK  S  
Sbjct  238  EVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLNS--  294

Query  430  GESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVI  488
            G++     D +L   GR  +   L+L   G++ + K G + V    +TS P+IYA GD I
Sbjct  295  GKTI--VGDGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHIYAAGDCI  351

Query  489  DAPELTPVAIQAGRLLS----------RRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSE  538
              P L   +++ GRL S          ++  +N      Y +          +G   + E
Sbjct  352  GYPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE  411

Query  539  EDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVVG  591
               I   GK + ++   N +P E  ++     A          ++K++ C +     V+G
Sbjct  412  ---ISMVGKSEQQLTREN-IPYEVGVARYEELAKGQMLGGVPGFLKIVFCPKSLQ--VLG  465

Query  592  FHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
             H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  466  VHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>PHYSO_342364
Length=194

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 15/126 (12%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN-NSFQTSGYTLDGPCEIWL  792
              Y  LR +LD+ ++Y         CG T+P    QPIPTN  +  + G    GPCEIWL
Sbjct  73   HNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWL  126

Query  793  DDTKVASGRNCHTEFPHG------QHQVDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVY  844
            DD KV +  +C++++ H       +  VDYS C   G C + +YWLG + +     WQ Y
Sbjct  127  DDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTY  186

Query  845  KNCVGL  850
            KNC+ L
Sbjct  187  KNCIPL  192

>PHYRA_74651
Length=344

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 70/133 (53%), Gaps = 16/133 (12%)

Query  729  SWMQQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDG  786
            S  +  GYS +R +LD D SLY        +CG T P  T   P  T ++  + G    G
Sbjct  71   SLKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATFSRGMVHAG  124

Query  787  PCEIWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSC-GGSCHLSWYWLGIKYVEGI  838
            PCEIWLDDTKV S  NC   +  G  +       VDYSSC  G C L +YWL  + ++  
Sbjct  125  PCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSS  184

Query  839  YSWQVYKNCVGLS  851
              WQVYKNCV L+
Sbjct  185  TVWQVYKNCVPLT  197

>PITG_18935
Length=480

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 128/480 (27%), Positives = 216/480 (45%), Gaps = 51/480 (11%)

Query  163  DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  222
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  29   DYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALL  80

Query  223  QSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
             S+ +     HD  S+G +    + + P     Q++ + +  ++ +    ++  +   V 
Sbjct  81   HSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIELLFKKNKVT  135

Query  283  YENFLGSFIDPHTLEL-WHPRKGSKQITTRDVVIAVGGRPREL-TIPGGEHA---ISSDD  337
            Y    G       + +  +  KG++ +  ++++IA G     L  +P    A   I S  
Sbjct  136  YIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTG  195

Query  338  IFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYME  397
               +K + P   +VVGA    +E   FL                 G D++   +  + ++
Sbjct  196  ALELK-RVPEHLVVVGAGVTVVE---FLDAA------------CPGSDKEAVKEFTKLLK  239

Query  398  VQSGIEFIRKTVPQSITKLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAKLD  454
             Q G++F   T    +T  E    +VK T+E    G++     D+VL ATGR    + L 
Sbjct  240  KQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSGLG  295

Query  455  LDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNAT  513
            L++ G++  +K GRI V    +T  P I+AIGDVI    L   A + G      +     
Sbjct  296  LEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG  354

Query  514  VQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAE  573
              ++Y  +   ++T  E+   G +EE+       + IE Y+    P+  +    T A A+
Sbjct  355  -HVNYGAIPGVIYTFPEFASVGKTEEE----LKAEGIE-YNVGKFPMMANSRARTIAEAD  408

Query  574  SCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
               VKV+ D+  DK  +G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  409  G-LVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  466

>PYIW_25190
Length=206

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 63/186 (34%), Positives = 93/186 (50%), Gaps = 5/186 (3%)

Query  453  LDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLSRRLYN-  510
            L L+  GVKLN+    +    E TS   IYAIGD  I   ELTPVAI AGR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  511  NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRA  570
                 + Y ++ T VF+    G  G +E  +I++FG   ++ Y + FV L  +++     
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  571  AAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  630
               +  +K++     +  V   H  G  A E+ Q  G+AMK+  T     + V IHPT +
Sbjct  122  GKTA--MKLVTVGEDEVVVGV-HVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAS  178

Query  631  ESFTTL  636
            E   T+
Sbjct  179  EELVTM  184

>PHYRA_73607
Length=343

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 68/128 (53%), Gaps = 16/128 (13%)

Query  734  QGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCEIW  791
             GYS +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCEIW
Sbjct  76   NGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVGPCEIW  129

Query  792  LDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGIYSWQV  843
            LDDTKV S  NC   +  G          VDYSSC  S C L +YWL  + V+    WQV
Sbjct  130  LDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMVWQV  189

Query  844  YKNCVGLS  851
            YKNCV L+
Sbjct  190  YKNCVPLT  197

>PYIR_16435
Length=304

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 14/122 (11%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEI  790
            +++GYS+LR+ ++D+            CG T+P    + IP++N+ + S   +  GPCE+
Sbjct  72   KEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPCEL  122

Query  791  WLDDTKVASGRNCHTEFPHG--QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            WLDD +V    NC   F       ++D+SSC GSC L W+WLG++  +    WQVYKNCV
Sbjct  123  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCV  180

Query  849  GL  850
             L
Sbjct  181  PL  182

>PHYCA_555180
Length=521

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 122/504 (24%), Positives = 211/504 (42%), Gaps = 65/504 (13%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +++ +      ++  +++V++ +  +R      +V++   + +
Sbjct  83   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  142

Query  283  YEN----------------------FLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGR  320
            +EN                        GS  +  +L   H  K          +IA G R
Sbjct  143  FENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK---------FLIACGTR  193

Query  321  PRE--LTIPGGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV  376
            P    L    G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+ 
Sbjct  194  PAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVD  253

Query  377  -RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  435
             R  +L   D+++ + +   M+  +G  F+   + +++ K+E     VK   + G+    
Sbjct  254  GRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVEVTDR-VKVFFDSGKVLSA  308

Query  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELT  494
              D++L   GR      L+L+  G+  N + G I V K+ QT  P+IYA GD I AP L 
Sbjct  309  --DALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALA  365

Query  495  PVAIQAGRLLSRRLYN-----NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDK  549
              +++ GRL S  ++N       T Q++       ++T  E    G +E+   K      
Sbjct  366  STSMEQGRLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKACIN--  423

Query  550  IEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLA  609
               Y             +   A     +K++ D    K V G H +G  A E+     +A
Sbjct  424  ---YEIGVAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVA  479

Query  610  MKLGFTYDQMVDTVGIHPTTAESF  633
            M +  +     D V  +PT AE++
Sbjct  480  MAMDCSLTYFRDAVFNYPTLAEAY  503

>CCI39993
Length=550

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 125/512 (24%), Positives = 209/512 (41%), Gaps = 69/512 (13%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDL+VIG G  G  C+ ++A  G+ V ++D  +          GG CV+ G +P K   +
Sbjct  45   YDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKTFRE  96

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            + L   +  H   +F   +SS +    I D    V  V+     I    + +L    V+ 
Sbjct  97   AIL--HLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVENAETDIT---RHQLVRNNVEL  151

Query  284  ENFLGSFI-DPHTLELWHPRKGSKQ-----------------ITTRDVVIAVGGRP--RE  323
             N    F+ DP    L++     KQ                 +T    +IAVG RP  R+
Sbjct  152  INGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTADKFLIAVGTRPARRD  211

Query  324  LTIPGGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  380
              +  G+    SD I W   K  P + +VVGA  + +E A  +  + G  V V+  R  +
Sbjct  212  DIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEI  271

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSV  440
            L   D+++   +  Y   Q+G  F  +   + +      ++++   S  G++     D +
Sbjct  272  LEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVIIHLNS--GKTI--VGDGL  326

Query  441  LNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPVAIQ  499
            L   GR  +   LDL   G++  +K G I V    QTS P+IYA GD    P L   +++
Sbjct  327  LYTVGRQGNTEGLDLSAIGLQ-TDKRGLIKVNENFQTSVPHIYAAGDCTGFPALASTSME  385

Query  500  AGRLLSRRLYNNATV-----------QMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKD  548
             GRL S  +  +              Q    ++ +  F P      G+     I   GK+
Sbjct  386  QGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFPF-----GIYTVPEISMVGKN  440

Query  549  KIEV------YHTNFVPLEWSLSTETRAAAESCYVKVI-CDRIRDKFVVGFHYLGPNAGE  601
            + ++      Y       E  L+          ++K+I C    +  ++G H +G  A E
Sbjct  441  EYQLTKEGIAYEVGVARYE-ELAKGQMLGGVPGFLKIIFCPTTLN--ILGVHAIGEGATE  497

Query  602  VTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            +     + M  G T +   + V  +PT AE++
Sbjct  498  IIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>H310_07641
Length=548

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 132/515 (26%), Positives = 216/515 (42%), Gaps = 71/515 (14%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  41   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  92

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            + L   +  H    F  N  +   +      ++++  V           + +L    +  
Sbjct  93   AVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNGIIL  150

Query  284  ENFLGSFI-------------DPHTLELWHPRKGSKQITTR-----DVVIAVGGRP-REL  324
             N    F+             D +T +    R     I  R      V+IAVG RP R  
Sbjct  151  INGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARHP  210

Query  325  TIP-GGEHAISSDDIFWMKTK-EPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  380
             +   G     SD + W      P + +VVGA  + +E A  +  + G  V V+  R  +
Sbjct  211  DLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEI  270

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLE---NGQLLVKWTSEDGESCEEAF  437
            L   D+++++ +  YM  Q G  F+ +   +SI K+E   + +++V  TS  G+      
Sbjct  271  LDMADKEVSDALCYYMR-QRGSRFLTE---ESILKVETKDDSEVVVHLTS--GKVI--MG  322

Query  438  DSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPV  496
            D++L   GR  ++A LDL+  G+  N K G + V +  QT+ P+IYA GD I  P L   
Sbjct  323  DALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALAST  381

Query  497  AIQAGRLLS---------RRLYNNATV--------QMDYDKVCT-AVFTPIEYGCCGLSE  538
            +++ GRL S          +L  +A V        +M   +V    ++T  E    G SE
Sbjct  382  SMEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSE  441

Query  539  EDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPN  598
            +    +  K+ I  Y       E  L+          ++K+I      K  +G H +G  
Sbjct  442  Q----QLSKENIP-YEVGIARYE-ELAKGQMLGGMPGFLKLIFCPTTLKL-LGVHAIGEG  494

Query  599  AGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            A E+     + M  G T +   + V  +PT AE++
Sbjct  495  ATEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>H310_06362
Length=197

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 71/135 (53%), Gaps = 27/135 (20%)

Query  735  GYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGY--TLDG  786
            G+ +LRAMLD             +CG T      +PIPT+      N     G+  +  G
Sbjct  51   GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  787  PCEIWLDDTKVASGRNCHTEFPH---GQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQV  843
            PCEIWLD+T+V    NC   FP     Q  VD+SSC GSC + +YWL +   E +  WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH--EDL--WQV  157

Query  844  YKNC---VGLSKNPT  855
            YKNC   VGL+ +PT
Sbjct  158  YKNCAPLVGLAASPT  172

>PPTG_04622
Length=273

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 68/133 (51%), Gaps = 16/133 (12%)

Query  729  SWMQQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDG  786
            S  +  GYS +RA+LD D  LY         CG T P  T   P  T ++  + G    G
Sbjct  71   SLKESNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  787  PCEIWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGI  838
            PCEIWLDDT V S  +C T +  G          VDYSSC  G C L +YWL  + V+  
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  839  YSWQVYKNCVGLS  851
              WQVYK+CV L+
Sbjct  185  MVWQVYKDCVPLT  197

>PHYSO_489418
Length=471

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 121/463 (26%), Positives = 207/463 (45%), Gaps = 45/463 (10%)

Query  206  LGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQ-GSAPIFDWKQLVTNVDGY  264
            +GG CV+ G +P K   +++L      H +   G    S + G   I    + V + +  
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  265  I-RGINFKYKVEL---RSKYVKYENFLGSFIDPHTLELWHPRKGS------KQITTRD-V  313
            I R    +  V+L    ++++   N + + +   + E     K        K++ T D  
Sbjct  62   ITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  314  VIAVGGRP-RELTIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-G  369
            ++ VG RP R   IP  GE    SD + W K K  P + +VVGA  V +E A  +  + G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPG  181

Query  370  YDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE  428
             DV V+  R  +L   D++++  +  Y   Q+G  F+     +S+ K   G++ V    E
Sbjct  182  TDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKGEVFVHL--E  238

Query  429  DGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDV  487
             G++     D +L   GR  ++  L+L+  G+ + +K GRI V +  QT+ P+IYA GD+
Sbjct  239  SGKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIYAAGDI  295

Query  488  IDAPELTPVAIQAGRLLSRRL-----YNNATVQMDY-----DKVCTAVFTPIEYGCCGLS  537
            I  P L   +++ GRL S  +      NN  +  D      D+V T + +  E    G+ 
Sbjct  296  IGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSG-EVFPFGIY  354

Query  538  EEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-CDRIRDKFVV  590
                I   GK++ ++     VP E  ++     A          ++K+I C       ++
Sbjct  355  TVPEISMVGKNEQQLTKEQ-VPYEVGMARYEELARGQMLGGLPGFLKIIFCPETLK--IL  411

Query  591  GFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  412  GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PHYRA_73584
Length=287

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 69/130 (53%), Gaps = 16/130 (12%)

Query  732  QQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  789
            +  GYS +R +LD D +LY         CG T+P  T   P  T ++  + G    GPCE
Sbjct  71   KSNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHAGPCE  124

Query  790  IWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGIYSW  841
            IWLDDT V S  +C T +  G  +       VDYSSC  S C L +YWL  + V+    W
Sbjct  125  IWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTVW  184

Query  842  QVYKNCVGLS  851
            QVYK+CV L+
Sbjct  185  QVYKDCVPLT  194

>H257_07450
Length=567

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 102/369 (28%), Positives = 161/369 (44%), Gaps = 46/369 (12%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K   +
Sbjct  39   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  90

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKY  283
            + L   +  H    F  N  +   +      ++++  V           + +L    +  
Sbjct  91   AVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNGIIL  148

Query  284  ENFLGSFI-------------DPHTLELWHPRKGSKQITTR-----DVVIAVGGRP--RE  323
             N    F+             D +T +    R     I  R      V+IAVG RP  R 
Sbjct  149  INGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARRP  208

Query  324  LTIPGGEHAISSDDIFWMKTK-EPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  380
                 G     SD + W      P + +VVGA  + +E A  +  + G  V V+  R  +
Sbjct  209  DLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEI  268

Query  381  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLE---NGQLLVKWTSEDGESCEEAF  437
            L   D+++++ +  YM  + G  F+ +   +SI K+E   N ++LV  TS  G+      
Sbjct  269  LDMADKEVSDALCYYMR-KRGSRFLTE---ESIVKVETKDNSEVLVYLTS--GKVI--VG  320

Query  438  DSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPELTPV  496
            D++L   GR  ++A LDL+  G+  N K G + V +  QT  P+IYA GD I  P L   
Sbjct  321  DALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALAST  379

Query  497  AIQAGRLLS  505
            +++ GRL S
Sbjct  380  SMEQGRLAS  388

>PPTG_13000
Length=387

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 96/345 (28%), Positives = 155/345 (45%), Gaps = 25/345 (7%)

Query  299  WHPRKGSKQITTRDVVIAVGGRPRELT-IPGGEHA---ISSDDIFWMKTKEPGKTLVVGA  354
             +  KG++ +  ++++IA G     L  +P    A   I S     +K + P   +VVGA
Sbjct  44   LNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELK-RVPEHLVVVGA  102

Query  355  SYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSI  413
              + LE     K +G  V V+        G D++   +  + ++ Q G++F   T    +
Sbjct  103  GVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KV  158

Query  414  TKLENGQLLVKWTSE---DGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIW  470
            T  E    +VK T+E    G++     D+VL ATGR    A L L++ G++  +K GRI 
Sbjct  159  TSSEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIE  217

Query  471  VKHE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPI  529
            V    +T  P I+AIGDVI    L   A + G      +       ++Y  V   ++T  
Sbjct  218  VDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAVPGVIYTFP  276

Query  530  EYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAES-CYVKVICDRIRDKF  588
            E+   G +EE+        K E    N        ++  R  AES   VKV+ D+  DK 
Sbjct  277  EFASVGKTEEEL-------KAEGIEYNVGKFPMMANSRARTVAESDGLVKVLADKKTDKL  329

Query  589  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            + G H +  NAGE+     + ++ G   + +  T   HPT +E+F
Sbjct  330  L-GVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYSO_533903
Length=208

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 68/127 (54%), Gaps = 16/127 (13%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN-NSFQTSGYTLDGPCEIWL  792
              +  L+ MLDD SLY        +CG T P    QPIPT+  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  793  DDTKVASGRNCHTEFPHG------QHQVDYSSC--GGSCHLSWYWLGIKYVEGIYS-WQV  843
            DD KV    +C++E+ H       +  +DYSSC  GG   + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  844  YKNCVGL  850
            YK+C+ L
Sbjct  188  YKDCIPL  194

>PHYKE_2864
Length=486

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 116/489 (24%), Positives = 196/489 (40%), Gaps = 73/489 (15%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  224  SSL-IGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVK  282
            + L +    HH      +++ +      ++  +++V++    +R      +V++   + +
Sbjct  86   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFAR  145

Query  283  YENFLGSFIDPHTLELWHPRKGS--------KQITTRDVVIAVGGRPRE--LTIPGGEHA  332
            +EN     I     E       S         ++     +IA G RP    L    G+  
Sbjct  146  FENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPIDGKVI  205

Query  333  ISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMVRSILLRGFDQDMAN  390
            I SD I      + P   +VVGA  + +E A  +  + G+ V V      + G       
Sbjct  206  IDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTV------VDGRPDTTDK  259

Query  391  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDI  450
            ++  +                      +G++L             + D++L   GR    
Sbjct  260  RVKVF--------------------FNSGKVL-------------SADALLYTVGRQAST  286

Query  451  AKLDLDKAGVKLNEKTGRIWV-KHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  509
              L+L+  G+  N + G I V K+ QT  P+IYA GD I AP L   +++ GRL S  ++
Sbjct  287  DGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMW  345

Query  510  N-----NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSL  564
            N      AT Q++       ++T  E    G +E+    +  KD +  Y           
Sbjct  346  NPDEELAATSQLESGNYPYGIYTIPEISMVGQTEQ----QLTKDCVN-YEIGIAKYSELA  400

Query  565  STETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  624
              +   A     +K++ D    K V G H +G  A E+     +AM +G +     D V 
Sbjct  401  KGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVF  459

Query  625  IHPTTAESF  633
             +PT AE++
Sbjct  460  NYPTLAEAY  468

>PYAP_18711
Length=210

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 13/121 (11%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEI  790
            +++G  +LRA L+ +           ECG T+P  + +PIP++   +  S     GPCE+
Sbjct  66   KKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEV  116

Query  791  WLDDTKVASGRNCHTEFPHG-QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVG  849
            W D+T V S  +C   F    Q ++DYS C G+C L +YWLG++  +G   WQ YKNCV 
Sbjct  117  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  850  L  850
            +
Sbjct  175  I  175

>PHYCA_534473
Length=1050

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 69/133 (52%), Gaps = 16/133 (12%)

Query  729  SWMQQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDG  786
            S  +  GYS +R +LD D  LY         CG T P  T   P  T ++  + G    G
Sbjct  843  SLKESNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATFSRGMVHAG  896

Query  787  PCEIWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGI  838
            PCEIWLDDTKV S  +C T +  G  +       VDYSSC  S C L +YWL  + V+  
Sbjct  897  PCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  956

Query  839  YSWQVYKNCVGLS  851
              WQVYK+CV L+
Sbjct  957  IVWQVYKDCVPLT  969

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQ-PIPTNNSFQTSGYTLDGPCEIWLDDTK  796
            +R M+D D  LY        +CG T P+ + + P  T ++  + G    GPCEIWLDD  
Sbjct  548  IRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEIWLDDEM  601

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G          VDYSSC  G C   +YWL ++  +    WQVYKNC+
Sbjct  602  VLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQVYKNCI  661

Query  849  GLS  851
             L+
Sbjct  662  PLT  664

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 16/109 (15%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R +LD D  LY        +CG T+P    +  PT+ +   S G    GPCEIWLDD  
Sbjct  285  IRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  338

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEG  837
            V S  +C + +  G  +       VDYSSC  G C   +YWL ++ ++G
Sbjct  339  VLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDG  387

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query  733  QQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIW  791
            +  Y  +R ++D   +Y        +CG T P+      PT+ +   S G    GPCEIW
Sbjct  73   KNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  126

Query  792  LDDTKVASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEG  837
            LDD  V    +C   +  G  +       VDYSSC  G C L +YWL ++ ++G
Sbjct  127  LDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG  180

>PYAR_16664
Length=577

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 104/411 (25%), Positives = 173/411 (42%), Gaps = 62/411 (15%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            +DL+VIG G  G  C+ + A  G+ V ++D            +GG C++ G +P K   +
Sbjct  64   FDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTGTVPSKTFRE  115

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGIN----FKYKVELRSK  279
            + L   +  H   SF    S  +    I D  Q V  V+     I      +  +EL + 
Sbjct  116  AIL--HLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRNGIELING  173

Query  280  YVKYE------------------NFLGSFIDPHTLEL--------WHPRKGSKQITTRDV  313
              ++                   N    F+   ++++        +     +K+ T+ D+
Sbjct  174  TARFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAVLSNDSYDTPTDTKRHTSADI  233

Query  314  ----------VIAVGGRP-RELTIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALE  360
                      +IAVG RP R   IP  G+    SD I W      P + +VVGA  + +E
Sbjct  234  CKRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGME  293

Query  361  CAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLEN  418
             A  +  + G +V V+  R  +L   D+++A  + +Y   QSG  F      +S+ K  N
Sbjct  294  YASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVEKAAN  352

Query  419  GQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTS  477
            G+++VK  S  G++     D +L   GR      L+L   G++  +K G + V    +TS
Sbjct  353  GEVIVKLNS--GKTI--IGDGLLYTVGRQGSTDGLNLAAVGLE-TDKRGLLQVDDNFRTS  407

Query  478  TPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTP  528
             P+IYA GD I  P L   +++ GRL S  + +   +    D     +  P
Sbjct  408  VPHIYAAGDCIGYPALASTSMEQGRLASVHMRSAKPINKKRDTDANQLSDP  458

>PITG_04948
Length=232

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 66/123 (54%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R +LD D SLY        +CG T+P    +  PT+ +   S G    GPCEIWLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G  +       VDYSSC  G C L +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  192

Query  849  GLS  851
             LS
Sbjct  193  PLS  195

>PHYSO_484051
Length=285

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 67/130 (52%), Gaps = 16/130 (12%)

Query  732  QQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDG-PCE  789
            +  GYS +R +LD D SLY        +CG T+P    +  PT      S   +   PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  790  IWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGIYSW  841
            IWLDDT V S  +C T +  G  +       VDYSSC  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  842  QVYKNCVGLS  851
            QVYK+CV L+
Sbjct  188  QVYKDCVPLT  197

>CCA14030
Length=560

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 128/518 (25%), Positives = 212/518 (41%), Gaps = 81/518 (16%)

Query  164  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  223
            YDL+V+G G  G  C+ ++A  G+ V ++D  +          GG CV+ G +P K   +
Sbjct  55   YDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTVPSKTFRE  106

Query  224  SSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGIN----FKYKVELRSK  279
            + L   +  H   +F   +SS +    I D    V  V+     I      +  VEL + 
Sbjct  107  AIL--HLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNNVELING  164

Query  280  YVKY-----ENFLG----SFIDPHTLELWHPRKGSKQ--ITTRDVVIAVGGRP--RELTI  326
              ++     +N +     S  +  T    H R    Q  +T    +IAVG RP  R+  +
Sbjct  165  TARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRPARRDDVV  224

Query  327  PGGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  383
              G+    SD I W   K  P + +VVGA  + +E A  +  + G  V V+  R  +L  
Sbjct  225  FDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEILEM  284

Query  384  FDQDMANKIGEYMEVQSGIEF-IRKTVP--------QSITKLENGQLLVKWTSEDGESCE  434
             D+++   +  Y   Q+G  F + +T+         + IT L +G+ +V           
Sbjct  285  ADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVITHLNSGKTVVG----------  333

Query  435  EAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDVIDAPEL  493
               D +L   GR  +   LDL   G++  +K G I V    QTS P+IYA GD    P L
Sbjct  334  ---DGLLYTVGRQGNTEGLDLSAIGLE-TDKRGLIKVNENFQTSVPHIYAAGDCTGFPAL  389

Query  494  TPVAIQAGRLLSRRLYNNATV-----------QMDYDKVCTAVFTPIEYGCCGLSEEDSI  542
               +++ GRL S  +  +              Q    ++ +  F P      G+     I
Sbjct  390  ASTSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFPF-----GIYTVPEI  444

Query  543  KRFGKDKIEV------YHTNFVPLEWSLSTETRAAAESCYVKVI-CDRIRDKFVVGFHYL  595
               GK++ ++      Y       E  L+          ++K+I C    +  ++G H +
Sbjct  445  SMVGKNEHQLTKEGIAYEVGVARYE-ELAKGQMLGGVPGFLKIIFCPTTLN--ILGVHAI  501

Query  596  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
            G  A E+     + M  G T +   + V  +PT AE++
Sbjct  502  GEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>PHYKE_2937
Length=366

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 68/130 (52%), Gaps = 16/130 (12%)

Query  732  QQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  789
               GYS +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  78   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  131

Query  790  IWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGIYSW  841
            IWLDDT V S  +C T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  132  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  191

Query  842  QVYKNCVGLS  851
            QVYK+CV L+
Sbjct  192  QVYKDCVPLT  201

>PYAP_24689
Length=252

 Score = 84.3 bits (207),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 70/135 (52%), Gaps = 13/135 (10%)

Query  721  INTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-T  779
            I T  +  +  ++ G  +LRA L+ +            CG T+P  + +PIP +   +  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  780  SGYTLDGPCEIWLDDTKVASGRNCHTEFPHG-QHQVDYSSCGGSCHLSWYWLGIKYVEGI  838
            S     GPCEIW D+T+V    +C+  F    Q ++DYS C G C L +YWLG++  +G 
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGG  166

Query  839  YSWQVYKNCVGLSKN  853
              WQ YKNCV L  +
Sbjct  167  KRWQSYKNCVPLGND  181

>PPTG_04647
Length=327

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 67/130 (52%), Gaps = 16/130 (12%)

Query  732  QQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  789
               GYS +R +LD D  LY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  73   SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  126

Query  790  IWLDDTKVASGRNCHTEFPHGQ-------HQVDYSSCGGS-CHLSWYWLGIKYVEGIYSW  841
            IWLDDT V S  NC T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  127  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  186

Query  842  QVYKNCVGLS  851
            QVYK+CV L+
Sbjct  187  QVYKDCVPLT  196

>PYVX_14662
Length=540

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 17/133 (13%)

Query  728  QSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDG  786
            +S   ++G + +R++LDD S+Y        +CG T P    Q IPT+     S G    G
Sbjct  68   KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATFSRGMVHVG  121

Query  787  PCEIWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSC--GGSCHLSWYWLGIKYVEG  837
            PCEIWLDDT V    +C++ +  G  Q       VDYSSC  GG   + +YWL  + V+G
Sbjct  122  PCEIWLDDTMVLHDDDCYSTY-GGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDG  180

Query  838  IYSWQVYKNCVGL  850
               WQVYKNC+ L
Sbjct  181  DTVWQVYKNCIPL  193

>PHYRA_73606
Length=366

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 68/130 (52%), Gaps = 16/130 (12%)

Query  732  QQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  789
               GYS +R +LD D SLY        +CG T+P  T   P  T ++  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  790  IWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGIYSW  841
            IWLDDT V S  +C T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  187

Query  842  QVYKNCVGLS  851
            QVYK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PHYCA_130365
Length=266

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 64/125 (51%), Gaps = 15/125 (12%)

Query  736  YSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDD  794
            Y  +R+M+D  S+Y        +CG T P       PT+ +   S G    GPCEIWLDD
Sbjct  75   YKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWLDD  128

Query  795  TKVASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKN  846
              V    +C + +  G          VDYSSC  G C L +YWLG++ ++G   WQ YKN
Sbjct  129  KMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAYKN  188

Query  847  CVGLS  851
            C+ L+
Sbjct  189  CIPLT  193

>PITG_01778
Length=470

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 116/464 (25%), Positives = 203/464 (44%), Gaps = 47/464 (10%)

Query  206  LGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQ-GSAPIFDWKQLVTNVDGY  264
            LGG CV+ G +P K   +++L      H +   G    S + G   I    + V + +  
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  265  I-RGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDV----------  313
            I R    +  V+L +   ++     + +   + E +     +K+ T+ D+          
Sbjct  62   ITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  314  VIAVGGRP-RELTIP-GGEHAISSDDIFWMKTKE-PGKTLVVGASYVALECAGFLKGM-G  369
            ++ VG RP R   IP  GE    SD + W   K  P + ++VGA  V +E A  +  + G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIPG  181

Query  370  YDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSE  428
             DV V+  R  +L   D+ ++  +  Y   Q+G  F+     +S+ K   G++      E
Sbjct  182  TDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKSPKGEVFAHL--E  238

Query  429  DGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHE-QTSTPNIYAIGDV  487
             G++     D +L   GR  ++  L+L+  G+   +K GRI V +  QT+ P+IYA GD+
Sbjct  239  SGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAVPHIYAAGDI  295

Query  488  IDAPELTPVAIQAGRLLSRRLYNNATVQ----------MDYDKVCTAVFTPIEYGCCGLS  537
            I  P L   +++ GRL S  +  +  +            D D+V T + +  E    G+ 
Sbjct  296  IGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG-EVFPFGIY  354

Query  538  EEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESC------YVKVI-C-DRIRDKFV  589
                I   GK++ ++     VP E  ++     A          ++K+I C D ++   +
Sbjct  355  TVPEISMVGKNEQQLTKEQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK---I  410

Query  590  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESF  633
             G H +G  A E+     + M  G T +   + V  +PT AE++
Sbjct  411  FGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>H257_13550
Length=266

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 69/138 (50%), Gaps = 27/138 (20%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------NSFQTSGYTLD  785
            Q  G+ +LRAMLD +           +CG +      +PIP++      N     G+   
Sbjct  103  QATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPS  153

Query  786  --GPCEIWLDDTKVASGRNCHTEFPH---GQHQVDYSSCGGSCHLSWYWLGIKYVEGIYS  840
              GPCEIWLD+T+V    +C T FP        VD++SC GSC + +YW+ +        
Sbjct  154  HTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALHQ----DL  209

Query  841  WQVYKNC---VGLSKNPT  855
            WQVYKNC   VGLS  PT
Sbjct  210  WQVYKNCAPLVGLSATPT  227

>PITG_05271
Length=278

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 15/124 (12%)

Query  736  YSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEIWLDD  794
            +  L+ ++DD S+Y        +CG T P  + QPIP +     S   +  GPCEIWLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  795  TKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVYKN  846
            TKV    +C +++ +          VDYSSC  GG   + +YWL  + V+G   WQ YK+
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  847  CVGL  850
            C+ L
Sbjct  189  CIPL  192

>PHYKE_10578
Length=239

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 58/107 (54%), Gaps = 17/107 (16%)

Query  758  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQH  812
            +CG T    + QP+P++          +G+T  GPCE+++DD  V  G NC  E+P G  
Sbjct  85   KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPD  144

Query  813  Q--------VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            +        +DYSSC G C LS+YWLG +  +    WQ Y NCV L+
Sbjct  145  ESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLT  187

>PHYCA_534296
Length=309

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (54%), Gaps = 15/126 (12%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEIWL  792
              +  L+ ++DD S+Y        +CG T+P    QPIPT+     S   +  GPCEIWL
Sbjct  47   NNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEIWL  100

Query  793  DDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVY  844
            DDTKV    +C++++ +          VDYSSC  GG   + +YWL  + V+G   WQ Y
Sbjct  101  DDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  160

Query  845  KNCVGL  850
            K+C+ L
Sbjct  161  KDCIPL  166

>PHYKE_6001
Length=289

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 66/128 (52%), Gaps = 15/128 (12%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEI  790
            +   Y  L+ ++DD S+Y        +CG T P    QPIP++     S      GPCEI
Sbjct  71   KANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEI  124

Query  791  WLDDTKVASGRNCHTEFPHGQ------HQVDYSSC-GGSC-HLSWYWLGIKYVEGIYSWQ  842
            WLDD  V S  +C+ ++ +          VDYSSC GG C  + +YWL  + V+G   WQ
Sbjct  125  WLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQ  184

Query  843  VYKNCVGL  850
             YKNC+ L
Sbjct  185  SYKNCIPL  192

>PPTG_04619
Length=276

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 65/123 (53%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R +LD D SLY        +CG T+P    +  PT+ +   S G    GPCEIWLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G  +       VDYSSC  G C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  849  GLS  851
             LS
Sbjct  193  PLS  195

>PHYKE_2809
Length=291

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 64/123 (52%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R MLD D  LY        +CG T P+   +  PT+ +   S G    GPCEIWLDD  
Sbjct  66   IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G  +       VDYSSC  G C   +YWL ++ ++G   WQVYKNCV
Sbjct  120  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  179

Query  849  GLS  851
             LS
Sbjct  180  PLS  182

>PHYSO_340333
Length=284

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEIWL  792
              +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCEIWL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  793  DDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVY  844
            DD KV    +C +++ +          VDYSSC  GG   + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  845  KNCVGL  850
            K+C+ L
Sbjct  187  KDCIPL  192

>PHYCA_531163
Length=314

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 67/130 (52%), Gaps = 16/130 (12%)

Query  732  QQQGYSSLRAMLD-DESLYKVTEEAIFECGLTSP-RTETQPIPTNNSFQTSGYTLDGPCE  789
               GYS +R +LD D SLY        +CG T+   T   P  T ++  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVGPCE  127

Query  790  IWLDDTKVASGRNCHTEFPHGQHQ-------VDYSSCGGS-CHLSWYWLGIKYVEGIYSW  841
            IWLDDT V S  +C T +  G          VDYSSC  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  187

Query  842  QVYKNCVGLS  851
            QVYK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PYU1_G007476
Length=195

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 63/127 (50%), Gaps = 17/127 (13%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNN----SFQTSGYTLDGP  787
            +Q+GY +LR+ L+++            CG T P T  + IP +     +    G+   GP
Sbjct  71   KQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGP  121

Query  788  CEIWLDDTKVASGRNCHTEFP--HGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYK  845
            CE+WLD+  +    NC   FP       VD+SSC G+C L  YWLG +  +    WQ YK
Sbjct  122  CELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQRWQTYK  179

Query  846  NCVGLSK  852
             CV + K
Sbjct  180  YCVPVKK  186

>PHYRA_86016
Length=236

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 17/106 (16%)

Query  758  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEIWLDDTKVASGRNCHTEFPHG--  810
            +CG T    + QPIPT+   +       G+T  GPCEI++DDT V  G +C  E+P G  
Sbjct  21   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  80

Query  811  ------QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
                  +  VDYSSC G C L+ YWL  +  +    WQ Y NCV L
Sbjct  81   GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PHYSO_340332
Length=295

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEIWL  792
              +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCEIWL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  793  DDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVY  844
            DD KV    +C +++ +          VDYSSC  GG   + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  845  KNCVGL  850
            K+C+ L
Sbjct  187  KDCIPL  192

>PHYRA_77971
Length=230

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 54/107 (50%), Gaps = 17/107 (16%)

Query  758  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQH  812
            +CG T    + QP+PTN           GYT  GPCE+++DD  V    NC  ++P G +
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  813  Q--------VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
                     VDYSSC G C  S YWLG +  +    WQ Y NCV LS
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLS  188

>PHYRA_85794
Length=230

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 54/107 (50%), Gaps = 17/107 (16%)

Query  758  ECGLTSPRTETQPIPTNNSF-----QTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQH  812
            +CG T    + QP+PTN           GYT  GPCE+++DD  V    NC  ++P G +
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  813  Q--------VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
                     VDYSSC G C  S YWLG +  +    WQ Y NCV LS
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLS  188

>PHYRA_86752
Length=300

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 17/106 (16%)

Query  758  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEIWLDDTKVASGRNCHTEFPHG--  810
            +CG T    + QPIPT+   +       G+T  GPCEI++DDT V  G +C  E+P G  
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  811  ------QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
                  +  VDYSSC G C L+ YWL  +  +    WQ Y NCV L
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  186

>PYAP_19707
Length=241

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 8/104 (8%)

Query  748  LYKVTEEAIFECGLTSPRTETQPIPTNN--SFQTSGYTLDGPCEIWLDDTKVASGRNCHT  805
            +  + E A  +CG T      QPIPT+   +F  S   + GPCE+WLD+TKVAS + C  
Sbjct  58   IKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWK  116

Query  806  EFPHGQHQVDYSSC-GGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            EFP+ + +VD++ C  GSC L W W+          W+ + NCV
Sbjct  117  EFPNKRIKVDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCV  156

>PHYRA_78175
Length=319

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 64/125 (51%), Gaps = 13/125 (10%)

Query  736  YSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  789
            YSSL+  + D+ L  V +E   ECG T+P    QP+P      +     G+T   +GPCE
Sbjct  78   YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  136

Query  790  IWLDDTKVASGRNCHTEFPHGQHQVDY--SSCGGSCHLSWYWLGIKYVEGIYSWQVYKNC  847
            +W DDT+V    NC   FP    ++ Y   +C GS  LS YW+ +       SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALHSA----SWQVYINC  192

Query  848  VGLSK  852
              L K
Sbjct  193  AALEK  197

>PHYSO_485524
Length=278

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R +LD D  LY         CG T+P    +  PT+ +   S G    GPCEIWLDD  
Sbjct  79   IRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G  +       VDYSSC  G C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  849  GLS  851
             LS
Sbjct  193  PLS  195

>PYU1_G014690
Length=295

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 18/124 (15%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEI  790
            +++G+ +LR+ ++D+            CG T P    + IP++N    S   +  GPCEI
Sbjct  68   KEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEI  118

Query  791  WLDDTKVASGRNCHTEFPHGQH----QVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKN  846
            WLDD +V    +C   F  G       +D+SSC  +C L ++WLG++  +    WQVYKN
Sbjct  119  WLDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKN  174

Query  847  CVGL  850
            CV L
Sbjct  175  CVPL  178

>PPTG_04618
Length=326

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 15/128 (12%)

Query  733  QQGYSSLRAMLDDESLYKVTEEAIFECGLTSPR-TETQPIPTNNSFQTSGYTLDGPCEIW  791
            +  Y  +R+++D   +Y        +CG T P+ T ++P     +  + G    GPCEIW
Sbjct  73   KNNYKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  792  LDDTKVASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQV  843
            LDD  V    +C + +  G  +       VDYSSC  G C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  186

Query  844  YKNCVGLS  851
            YKNC+ L+
Sbjct  187  YKNCIPLT  194

>PHYSO_483955
Length=320

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 15/125 (12%)

Query  736  YSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDD  794
            Y  +R+++D   +Y        +CG T P+ +    PT+ +   S G    GPCEIWLDD
Sbjct  76   YKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWLDD  129

Query  795  TKVASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKN  846
              V    +C + +  G  +       VDYSSC  G C L +YWL ++ ++G   WQ YKN
Sbjct  130  KMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKN  189

Query  847  CVGLS  851
            C+ L+
Sbjct  190  CIPLT  194

>PHYSO_533747
Length=206

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 16/126 (13%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN-NSFQTSGYTLDGPCEIWL  792
              +  L+ MLDD SLY        +CG T P    QPIPT+  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  793  DDTKVASGRNCHTEFPHG------QHQVDYSSC--GGSCHLSWYWLGIKYVEGIYS-WQV  843
            DD KV    +C++E+ H       +  +DYSSC  GG   + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  844  YKNCVG  849
            Y   +G
Sbjct  188  YSTLLG  193

>PYU1_G005323
Length=251

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 13/120 (11%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEIWL  792
            +GY  L++ L+D+            CG + P  + +PIP++   +  S     GPCE+W 
Sbjct  67   KGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWF  117

Query  793  DDTKVASGRNCHTEFPHG-QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            DD +     +C   F      +VD+S+C GSC L +YWLG++  +G   WQ YKNC+ L+
Sbjct  118  DDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLT  175

>PPTG_03139
Length=320

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 13/125 (10%)

Query  736  YSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--DGPCE  789
            YSSL+  + D+ +  V+++   ECG T+P    QP+P      +     G+T   +GPCE
Sbjct  78   YSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCE  136

Query  790  IWLDDTKVASGRNCHTEFPHGQHQV--DYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNC  847
            +W DDT+V    NC   FP    ++  D+ +C GS  LS YW+ +       SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALHSP----SWQVYINC  192

Query  848  VGLSK  852
              L K
Sbjct  193  AALEK  197

>PHYRA_78689
Length=296

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEIWL  792
              +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  GPCEIWL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWL  126

Query  793  DDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIYSWQVY  844
            DDTKV    +C +++ +          VDYSSC  GG   + +YWL  + ++    WQ Y
Sbjct  127  DDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSY  186

Query  845  KNCVGL  850
            K+C+ L
Sbjct  187  KDCIPL  192

>PITG_04949
Length=337

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 66/128 (52%), Gaps = 15/128 (12%)

Query  733  QQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIW  791
            +  +  +R+++D   ++        ECG T P+ +    P++ +   S G    GPCEIW
Sbjct  73   KNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  792  LDDTKVASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQV  843
            LDD  V    +C + +  G  Q       VDYSSC  G C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQA  186

Query  844  YKNCVGLS  851
            YKNC+ L+
Sbjct  187  YKNCIPLT  194

>PHYCA_12942
Length=353

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 56/101 (55%), Gaps = 12/101 (12%)

Query  758  ECGLTSPRTETQPIPTNNSFQTSG-----YTLDGPCEIWLDDTKVASGRNCHTEFPHG--  810
            +CG T      QPIP++   + +G     +T  GPCEI++DD  V  G NC  EF  G  
Sbjct  83   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDT  142

Query  811  -QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
               ++DYSSC G+C L+ YWLG +  +    WQ Y NCV L
Sbjct  143  SDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PHYRA_83499
Length=473

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (53%), Gaps = 17/112 (15%)

Query  758  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEIWLDDTKVASGRNCHTEFPHG--  810
            +CG T    + QPIPT+   +       G+T  GPCEI++DDT V  G +C  E+P G  
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  811  ------QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
                  +  VDYSSC G C L+ YWL  +  +    WQ Y NCV L  + +A
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSA  192

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 39/72 (54%), Gaps = 12/72 (17%)

Query  781  GYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQ--------VDYSSCGGSCHLSWYWLGI  832
            G  + GPCEI+LDDT +  G NC  E+  G           +DYSSC G+C L+ YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  833  KYVEGIYSWQVY  844
            +  +    WQ Y
Sbjct  406  QNEQ----WQAY  413

>PHYSO_533682
Length=278

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 66/131 (50%), Gaps = 15/131 (11%)

Query  729  SWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGP  787
            S+     +  L+ ++DD S+Y        +CG T P    QPIPT+     S G    GP
Sbjct  68   SFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGP  121

Query  788  CEIWLDDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIY  839
            CEIWLDD KV S  +C++++ +          VDYSSC  GG   +  Y LG + +    
Sbjct  122  CEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKT  181

Query  840  SWQVYKNCVGL  850
             WQ YKNC+ L
Sbjct  182  VWQSYKNCIPL  192

>PYIR_16443
Length=275

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 15/120 (13%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTL-DGPCEI  790
            +Q+G+ +LR+ ++D+            CG T+P    + IP+++  + S   +  GPCEI
Sbjct  69   KQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEI  119

Query  791  WLDDTKVASGRNCHTEFPHG--QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVY-KNC  847
            WLDD +V    NC   F       ++D+SSC GSC L W+WLG++  +    WQVY K+C
Sbjct  120  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PHALS_03179
Length=372

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 69/128 (54%), Gaps = 11/128 (9%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIF--ECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEI  790
            + Y SL+A  + + L  + E      ECG + P+ + QPIP +     S   +  GPCE+
Sbjct  105  KAYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEM  164

Query  791  WLDDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGIYSWQ  842
            WLD+ KV    +C+ ++ +   +      VDYSSC  GG   + +YWL  + ++GI  WQ
Sbjct  165  WLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQ  224

Query  843  VYKNCVGL  850
             YKNC+ L
Sbjct  225  SYKNCIPL  232

>PHYSO_438103
Length=238

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 15/132 (11%)

Query  728  QSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-G  786
            +S      +  L+ ++DD S+Y        +CG T P    QPIPT+     S   +  G
Sbjct  66   KSLKSANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  119

Query  787  PCEIWLDDTKVASGRNCHTEFPHGQHQ------VDYSSC--GGSCHLSWYWLGIKYVEGI  838
            PCEIWLD+TKV    +C +++ +          VDYSSC  GG   + +YWL  + ++  
Sbjct  120  PCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSK  179

Query  839  YSWQVYKNCVGL  850
              WQ YK+C+ L
Sbjct  180  TVWQSYKDCIPL  191

>PHYCA_98479
Length=276

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 55/106 (52%), Gaps = 17/106 (16%)

Query  758  ECGLTSPRTETQPIPTNNSFQ-----TSGYTLDGPCEIWLDDTKVASGRNCHTEFPHG--  810
            ECG T      QP+PT+   +       G+T  GPCEI++DDT V  G NC  E+P G  
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  811  ------QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850
                     VDYSSC G C L+ YWLG +  +    WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>SDRG_07565
Length=278

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 69/144 (48%), Gaps = 25/144 (17%)

Query  722  NTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN------N  775
            N +    ++  Q  + +LR ML+ +            CG + P    + IP++      N
Sbjct  119  NVAAFTTAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWLN  169

Query  776  SFQTSGY--TLDGPCEIWLDDTKVASGRNCHTEFPH---GQHQVDYSSCGGS-CHLSWYW  829
                 G+  +  GPCE+WLDD +V    +C T FP        VDYSSCGGS C L +YW
Sbjct  170  PDTGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYW  229

Query  830  LGIKYVEGIYSWQVYKNCVGLSKN  853
            L +   +    WQVYKNCV L  N
Sbjct  230  LALHQPQ----WQVYKNCVPLQGN  249

>PHYCA_19611
Length=531

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 66/130 (51%), Gaps = 13/130 (10%)

Query  731  MQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTN----NSFQTSGYTL--  784
            M    Y+SL+  ++D+ +  V +E   ECG T+P+   QP+P      +     G+T   
Sbjct  280  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  338

Query  785  DGPCEIWLDDTKVASGRNCHTEFPH--GQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQ  842
            +GPCE+W DDT+V    NC   FP    +   D  +C GS  L+ YW+ +       SWQ
Sbjct  339  EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALHSP----SWQ  394

Query  843  VYKNCVGLSK  852
            VY NC  L K
Sbjct  395  VYINCAALEK  404

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 47/110 (43%), Gaps = 17/110 (15%)

Query  745  DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCH  804
            + S YK  +E I + G T  R         N FQ    T +GP  +      +    NC 
Sbjct  48   EASKYKSLKEVINDLGKTKLR---------NRFQRR--TSNGPTVVAKALPPLTKDDNCA  96

Query  805  TEFPHGQHQVDYS--SCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSK  852
              +P    +V Y   +C G+  L++YWL +       +WQVY NC  L K
Sbjct  97   ANYPTAPAKVPYDRDACLGASRLTFYWLALHSS----TWQVYTNCAALEK  142

>PHYSO_246676
Length=187

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 70/160 (44%), Gaps = 39/160 (24%)

Query  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751
            QIVL P P +  +    +   LA+L+ QG  T  +  +W ++ GY +LR  +D ++ Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDV  70

Query  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811
            T  A F CG T P+   QPIP  N  +++GYT D                          
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHD--------------------------  104

Query  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
                     G  H S    G+K     YSW+VYK C+ LS
Sbjct  105  ---------GLVHASLVLDGMK---NSYSWKVYKACIPLS  132

>PYIR_16444
Length=182

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (56%), Gaps = 14/120 (12%)

Query  732  QQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLD-GPCEI  790
            +Q+G+ +LR+ ++++            CG T+ +   +PIP++     S   +  GPCE+
Sbjct  69   KQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCEL  119

Query  791  WLDDTKVASGRNCHTEFPHG--QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            WLD+ +V    NC   F       ++D+SSC G+C L ++WLG++  +    WQVYKNCV
Sbjct  120  WLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCV  177

>PYIW_19151
Length=248

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 84/174 (48%), Gaps = 31/174 (18%)

Query  687  GLGE-GQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDD  745
            G+G  G  V+  PP +  D  D +  A A                 +++G+S+LR+ L+D
Sbjct  36   GVGHPGTFVIEYPPPWTGDWKDPKNFAAA----------------AKEKGFSTLRSYLED  79

Query  746  ESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTKVASGRNCH  804
            +            CG T P+   + IP + + + S      GPCE+++DDT+V    +C 
Sbjct  80   KGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCELYIDDTRVYQNDDCE  130

Query  805  TEFPH--GQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856
            + F        VD+S C G C + +YWLG++   G   WQVYK+CV +S +  A
Sbjct  131  SAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ-ASGT-RWQVYKSCVPVSSSAVA  182

>PYAP_18709
Length=235

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 13/120 (11%)

Query  734  QGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQ-TSGYTLDGPCEIWL  792
            +G+  LR+ L+D+            CG + P    +PIP++ + +  S     GPCE+WL
Sbjct  67   KGFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWL  117

Query  793  DDTKVASGRNCHTEFPHG-QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851
            D+T+     +C   F      ++D+ +C GSC L +YWLG++  +G   WQ YKNC+ L+
Sbjct  118  DNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PHYSO_459106
Length=223

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 60/123 (49%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R M+D D  LY        +CG T P+ + Q  PT      S G    GPCEIWLDD  
Sbjct  79   IRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEIWLDDKM  132

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G          VDYSSC  G C   +YWL ++  +    WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQVYKNCI  192

Query  849  GLS  851
             L+
Sbjct  193  PLT  195

>PHYKE_3913
Length=321

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  739  LRAMLD-DESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTS-GYTLDGPCEIWLDDTK  796
            +R + D D SLY         CG T+P    +  PT+ +   S G    GPCEIWLDD  
Sbjct  106  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  797  VASGRNCHTEFPHGQHQ-------VDYSSCG-GSCHLSWYWLGIKYVEGIYSWQVYKNCV  848
            V    +C + +  G  +       VDYSSC  G C   +YW+ ++ ++G   WQVYKNCV
Sbjct  160  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  219

Query  849  GLS  851
             L+
Sbjct  220  PLT  222

Lambda      K        H        a         alpha
   0.318    0.135    0.418    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 70231327884

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40