Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_18450147522031819188e-127
PPTG_17122147522041818052e-109
PHYCA_129425147522041817531e-101
PHYSO_284086147522041817452e-100
PHYKE_8389147522041827131e-95
PHYRA_81106147522021826827e-91
PHYKE_8388568762051826453e-85
PPTG_17121568762021806332e-83
PHYRA_81107568762021806314e-83
PHYSO_477820568762021806262e-82
PHYCA_511409568762041806246e-82
PHYRA_82864231281931686202e-81
PHYCA_14369109792481686155e-80
PYVX_18176568762011796072e-79
PPTG_15264231281941716011e-78
PPTG_17366239131941716011e-78
PHYSO_341599109791851685982e-78
PHYKE_3446231281991686002e-78
PHYCA_102624720131951725993e-78
PHYRA_85631109792281745981e-77
PHYCA_102852242061951715923e-77
PPTG_10635528561991685923e-77
PHYCA_102550457052681685975e-77
PYVX_18174854042041805872e-76
PHYKE_7718109792201755874e-76
PHYRA_84190720132061745831e-75
PHYSO_536424606911971685821e-75
PHYSO_507031586531971685821e-75
PPTG_10636109792461695842e-75
PPTG_10634720132081635742e-74
PPTG_10643457052501835712e-73
PYU1_G001741854041991705481e-70
PYVX_18173449665001655731e-70
PPTG_10048213141901685437e-70
PHALS_00498109791991695412e-69
PYU1_G001742932042131855352e-68
PYIR_25089854042621705262e-66
PYIR_26626147522121685188e-66
PYU1_G001744568762131855101e-64
PYU1_G001740147522061624988e-63
PHYSO_499978231281741434871e-61
PHYSO_501575820771741434871e-61
PHALS_03284309411881694802e-60
PHYSO_254168462841701484635e-58
PPTG_0882086622501714671e-57
PPTG_14255469372681654602e-56
PITG_1049986623231444619e-56
PYU1_G001739932032661654569e-56
PHYSO_343376532371721174471e-55
PHYCA_510817445761881684454e-55
PHYSO_417649445761851684369e-54
PHYKE_9185445762811684361e-52
PYAR_24096932032271644312e-52
PPTG_14254445761881654272e-52
PYAP_22278932042891744327e-52
PITG_13520109791711344227e-52
PHYCA_53693413059831654571e-51
PYAP_22273932032681834282e-51
PYAP_22279854042231724242e-51
PYIW_18791854041941664101e-49
PYIR_26546866052391673973e-47
PHYSO_262732469371881673882e-46
PHYSO_341596528562311263852e-45
PHYCA_14368528562191663772e-44
PHYSO_527908600641741543654e-43
PYU1_G001738534612261613391e-38
PHYRA_81105534612011633353e-38
PPTG_17123147532011623328e-38
PHYSO_246676457051871683291e-37
PYVX_18175147521471773233e-37
PHYSO_353401534611461423225e-37
HYAP_07096534612511603297e-37
PHYCA_537323449662001633259e-37
PITG_18452147538561603363e-35
PHYSO_340369526762001613128e-35
PYIW_18788932032441633052e-33
PYAP_18131991722261182946e-32
PYVX_18179534611471752755e-30
PHYSO_342364529831941402649e-28
PYU1_G007476539131951362641e-27
PYIR_1643542333041242595e-26
PHYRA_78626578954731632621e-25
PHYRA_78625541464341632621e-25
PYIR_1644442341821322446e-25
PYAP_246891014392521502471e-24
PHYSO_438103557212381762443e-24
PYIR_16443823992751232453e-24
PHYRA_7868968382961762454e-24
PHYRA_74651699693441322475e-24
PHYCA_12727044782791532411e-23
PYIW_19151831912481292391e-23
PHYSO_533903604652081402343e-23
PYU1_G01469042342951242384e-23
PHYCA_13036542352661302374e-23
PHYSO_340333526712841762375e-23
PYAP_18711943562101412335e-23
PYIW_18792932041251002266e-23
PHYSO_34033244782951762377e-23
PHYSO_533682604462781392368e-23
PPTG_1422144782751392341e-22
PHYKE_600144782891802342e-22
PYU1_G005324845341911412282e-22
PYU1_G005326463491911412282e-22
PYU1_G00532842331911412282e-22
PYAP_18709943552351152293e-22
PITG_0527144782781432296e-22
PPTG_0461842353261272318e-22
PYIW_27477823991801122238e-22
PHYCA_534296526713091392309e-22
PITG_0494842342321302251e-21
PHYRA_73607194343431342301e-21
PITG_0494942353371262292e-21
PHALS_0317644782071442222e-21
PPTG_04622696962731372252e-21
PYU1_G005325943562071352212e-21
PYAR_14260845342121212204e-21
PHYSO_48395542353201262264e-21
PYAR_14256943551991402194e-21
PHYKE_6002526711971652194e-21
PPTG_0461942342761302228e-21
PYU1_G005323943552511362208e-21
PHYKE_771752856568442288e-21
PHYRA_85794726192301442199e-21
PHYRA_77971705552301442199e-21
PHYSO_48552442342781302201e-20
CCI4738117292111282162e-20
PHYRA_7358242353261352222e-20
PHYCA_531163194343141342202e-20
PHALS_03177526712591382182e-20
PYU1_G007364851643161292203e-20
PHYKE_10578778802391802163e-20
PHALS_03179308833721422195e-20
PHYRA_7358442332871352165e-20
PHYCA_12942213313531702188e-20
PHALS_0539242353671262171e-19
PHYRA_7358342346301302191e-19
PHYKE_2809752822911282141e-19
PYIR_19612831912601402121e-19
PPTG_04647194343271312152e-19
SDRG_165351259803131432142e-19
H310_0636217301971392082e-19
PHYRA_7914038074241382162e-19
PHYRA_73606571983661322152e-19
PYIW_1552617302561372102e-19
PHYSO_484051571982851312122e-19
PHYKE_2937571983661302133e-19
PPTG_07509718142991542114e-19
PHYRA_83494464352241362074e-19
PPTG_0750738072991542114e-19
PHYCA_534473423310501322146e-19
PHYKE_391342343211032106e-19
PYIW_254631650392161412066e-19
PHYSO_533747604512061372047e-19
PHYRA_86016727462361222068e-19
PPTG_0462042333421302108e-19
PHYSO_459106194342231302058e-19
PHYRA_86752732363001512081e-18
PYAP_1871342341841392021e-18
PHYRA_83500718143941382101e-18
PYIR_23585845342401282041e-18
PYAR_2411397811921722012e-18
SDRG_075651244122781642052e-18
PYIW_242891643031961232002e-18
PYVX_14662510865401392092e-18
CCA1717917291851281993e-18
PITG_1193697753331402063e-18
PYIR_2048117292771242043e-18
SDRG_081291363312181582013e-18
PITG_0494742332981292044e-18
PYAP_18221944962261451996e-18
PHALS_0539442342881262018e-18
SDRG_154261258855231412041e-17
H257_1355017302661391982e-17
PHYCA_1865738072951461992e-17
SPRG_19916161733051421992e-17
PYU1_G005872161732971401992e-17
PYU1_G005871944962841401982e-17
SDRG_081371363342821581973e-17
PYIW_242881643022011231923e-17
PHYCA_97965401872881581964e-17
PYU1_G00586817292671241954e-17
PHYCA_12943369712871581964e-17
PHYCA_120062539132121381925e-17
PYAP_222571003612471271936e-17
PHYRA_7358169693293891957e-17
PHYRA_83499204334731431987e-17
PHYSO_255056463492691011938e-17
PYAP_24691101441145861869e-17
PHALS_04411944962621311921e-16
PHYRA_8075044782751701931e-16
PHYSO_324715696932741781931e-16
PHYCA_98479819502761301931e-16
PYAR_206171040482541281921e-16
PHYRA_84947539132651791921e-16
SPRG_2216117303001421931e-16
PITG_0820268381911271881e-16
PHYCA_122958161732601211911e-16
PYU1_G005985820772001481881e-16
PPTG_18166242064451461951e-16
PHYKE_2539161732581251912e-16
PPTG_0316097913791431932e-16
PHYSO_255975464241871281862e-16
PHYCA_69583463492241041882e-16
SPRG_077991259833451311923e-16
PHYKE_81047713586591783e-16
HYAP_14170161732661311893e-16
PHYRA_8615172836170741843e-16
SPRG_077961259803221301913e-16
PHYRA_8794174106157741834e-16
PPTG_07516464352941421894e-16
PHYRA_84732161732651211884e-16
PPTG_0752038142941421894e-16
PPTG_10186161732701201885e-16
SDRG_165341259793201461896e-16
PPTG_0313997753201321896e-16
PYU1_G00151997822651251867e-16
PYU1_G005873510322141431831e-15
PYIW_187905687686781741e-15
PITG_20312159812701241851e-15
PHYKE_1029517292921421851e-15
PYVX_16138786195591521891e-15
PITG_20631161732701251851e-15
PYVX_20783375052761741851e-15
PYIR_24743851643571291872e-15
PYIR_24421899032131521822e-15
PYAP_18226840622261431822e-15
PYIW_15528840623111501852e-15
PYAP_18138991732681111832e-15
PHYSO_476077161732681351832e-15
PHYSO_472009159812681351832e-15
PYVX_22511188573031281842e-15
SDRG_009481259833521171853e-15
PPTG_03153597733141391843e-15
PHYCA_103479510323141651834e-15
PYVX_24563161732541311814e-15
HYAP_1192397766061451854e-15
PPTG_04617696934961091845e-15
PPTG_0114817292951251825e-15
PPTG_07521450302811301815e-15
PYAR_16493841752561181805e-15
PYVX_21297798802631121805e-15
PHYKE_391242332521051805e-15
PHYCA_112615308831961271776e-15
PHYKE_6077188563221401826e-15
SPRG_199171339462411441796e-15
PHYSO_26284417292761241807e-15
PHYCA_19598375713901431827e-15
SDRG_1731716173122781718e-15
PHYCA_1961197755311401838e-15
PITG_1981815643147591739e-15
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_18450

Length=203
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_18450                                                            358        8e-127
PPTG_17122                                                            314        2e-109
PHYCA_129425                                                          294        1e-101
PHYSO_284086                                                          291        2e-100
PHYKE_8389                                                            279        1e-95 
PHYRA_81106                                                           267        7e-91 
PHYKE_8388                                                            253        3e-85 
PPTG_17121                                                            248        2e-83 
PHYRA_81107                                                           247        4e-83 
PHYSO_477820                                                          245        2e-82 
PHYCA_511409                                                          244        6e-82 
PHYRA_82864                                                           243        2e-81 
PHYCA_14369                                                           241        5e-80 
PYVX_18176                                                            238        2e-79 
PPTG_15264                                                            236        1e-78 
PPTG_17366                                                            236        1e-78 
PHYSO_341599                                                          234        2e-78 
PHYKE_3446                                                            235        2e-78 
PHYCA_102624                                                          235        3e-78 
PHYRA_85631                                                           234        1e-77 
PHYCA_102852                                                          232        3e-77 
PPTG_10635                                                            232        3e-77 
PHYCA_102550                                                          234        5e-77 
PYVX_18174                                                            230        2e-76 
PHYKE_7718                                                            230        4e-76 
PHYRA_84190                                                           229        1e-75 
PHYSO_536424                                                          228        1e-75 
PHYSO_507031                                                          228        1e-75 
PPTG_10636                                                            229        2e-75 
PPTG_10634                                                            225        2e-74 
PPTG_10643                                                            224        2e-73 
PYU1_G001741                                                          215        1e-70 
PYVX_18173                                                            225        1e-70 
PPTG_10048                                                            213        7e-70 
PHALS_00498                                                           213        2e-69 
PYU1_G001742                                                          210        2e-68 
PYIR_25089                                                            207        2e-66 
PYIR_26626                                                            204        8e-66 
PYU1_G001744                                                          201        1e-64 
PYU1_G001740                                                          196        8e-63 
PHYSO_499978                                                          192        1e-61 
PHYSO_501575                                                          192        1e-61 
PHALS_03284                                                           189        2e-60 
PHYSO_254168                                                          182        5e-58 
PPTG_08820                                                            184        1e-57 
PPTG_14255                                                            181        2e-56 
PITG_10499                                                            182        9e-56 
PYU1_G001739                                                          180        9e-56 
PHYSO_343376                                                          176        1e-55 
PHYCA_510817                                                          176        4e-55 
PHYSO_417649                                                          172        9e-54 
PHYKE_9185                                                            172        1e-52 
PYAR_24096                                                            170        2e-52 
PPTG_14254                                                            169        2e-52 
PYAP_22278                                                            171        7e-52 
PITG_13520                                                            167        7e-52 
PHYCA_536934                                                          180        1e-51 
PYAP_22273                                                            169        2e-51 
PYAP_22279                                                            167        2e-51 
PYIW_18791                                                            162        1e-49 
PYIR_26546                                                            157        3e-47 
PHYSO_262732                                                          154        2e-46 
PHYSO_341596                                                          152        2e-45 
PHYCA_14368                                                           149        2e-44 
PHYSO_527908                                                          145        4e-43 
PYU1_G001738                                                          135        1e-38 
PHYRA_81105                                                           133        3e-38 
PPTG_17123                                                            132        8e-38 
PHYSO_246676                                                          131        1e-37 
PYVX_18175                                                            129        3e-37 
PHYSO_353401                                                          128        5e-37 
HYAP_07096                                                            131        7e-37 
PHYCA_537323                                                          129        9e-37 
PITG_18452                                                            134        3e-35 
PHYSO_340369                                                          124        8e-35 
PYIW_18788                                                            122        2e-33 
PYAP_18131                                                            117        6e-32 
PYVX_18179                                                            110        5e-30 
PHYSO_342364                                                          106        9e-28 
PYU1_G007476                                                          106        1e-27 
PYIR_16435                                                            104        5e-26 
PHYRA_78626                                                           105        1e-25 
PHYRA_78625                                                           105        1e-25 
PYIR_16444                                                            98.6       6e-25 
PYAP_24689                                                            99.8       1e-24 
PHYSO_438103                                                          98.6       3e-24 
PYIR_16443                                                            99.0       3e-24 
PHYRA_78689                                                           99.0       4e-24 
PHYRA_74651                                                           99.8       5e-24 
PHYCA_127270                                                          97.4       1e-23 
PYIW_19151                                                            96.7       1e-23 
PHYSO_533903                                                          94.7       3e-23 
PYU1_G014690                                                          96.3       4e-23 
PHYCA_130365                                                          95.9       4e-23 
PHYSO_340333                                                          95.9       5e-23 
PYAP_18711                                                            94.4       5e-23 
PYIW_18792                                                            91.7       6e-23 
PHYSO_340332                                                          95.9       7e-23 
PHYSO_533682                                                          95.5       8e-23 
PPTG_14221                                                            94.7       1e-22 
PHYKE_6001                                                            94.7       2e-22 
PYU1_G005324                                                          92.4       2e-22 
PYU1_G005326                                                          92.4       2e-22 
PYU1_G005328                                                          92.4       2e-22 
PYAP_18709                                                            92.8       3e-22 
PITG_05271                                                            92.8       6e-22 
PPTG_04618                                                            93.6       8e-22 
PYIW_27477                                                            90.5       8e-22 
PHYCA_534296                                                          93.2       9e-22 
PITG_04948                                                            91.3       1e-21 
PHYRA_73607                                                           93.2       1e-21 
PITG_04949                                                            92.8       2e-21 
PHALS_03176                                                           90.1       2e-21 
PPTG_04622                                                            91.3       2e-21 
PYU1_G005325                                                          89.7       2e-21 
PYAR_14260                                                            89.4       4e-21 
PHYSO_483955                                                          91.7       4e-21 
PYAR_14256                                                            89.0       4e-21 
PHYKE_6002                                                            89.0       4e-21 
PPTG_04619                                                            90.1       8e-21 
PYU1_G005323                                                          89.4       8e-21 
PHYKE_7717                                                            92.4       8e-21 
PHYRA_85794                                                           89.0       9e-21 
PHYRA_77971                                                           89.0       9e-21 
PHYSO_485524                                                          89.4       1e-20 
CCI47381                                                              87.8       2e-20 
PHYRA_73582                                                           90.1       2e-20 
PHYCA_531163                                                          89.4       2e-20 
PHALS_03177                                                           88.6       2e-20 
PYU1_G007364                                                          89.4       3e-20 
PHYKE_10578                                                           87.8       3e-20 
PHALS_03179                                                           89.0       5e-20 
PHYRA_73584                                                           87.8       5e-20 
PHYCA_12942                                                           88.6       8e-20 
PHALS_05392                                                           88.2       1e-19 
PHYRA_73583                                                           89.0       1e-19 
PHYKE_2809                                                            87.0       1e-19 
PYIR_19612                                                            86.3       1e-19 
PPTG_04647                                                            87.4       2e-19 
SDRG_16535                                                            87.0       2e-19 
H310_06362                                                            84.7       2e-19 
PHYRA_79140                                                           87.8       2e-19 
PHYRA_73606                                                           87.4       2e-19 
PYIW_15526                                                            85.5       2e-19 
PHYSO_484051                                                          86.3       2e-19 
PHYKE_2937                                                            86.7       3e-19 
PPTG_07509                                                            85.9       4e-19 
PHYRA_83494                                                           84.3       4e-19 
PPTG_07507                                                            85.9       4e-19 
PHYCA_534473                                                          87.0       6e-19 
PHYKE_3913                                                            85.5       6e-19 
PYIW_25463                                                            84.0       6e-19 
PHYSO_533747                                                          83.2       7e-19 
PHYRA_86016                                                           84.0       8e-19 
PPTG_04620                                                            85.5       8e-19 
PHYSO_459106                                                          83.6       8e-19 
PHYRA_86752                                                           84.7       1e-18 
PYAP_18713                                                            82.4       1e-18 
PHYRA_83500                                                           85.5       1e-18 
PYIR_23585                                                            83.2       1e-18 
PYAR_24113                                                            82.0       2e-18 
SDRG_07565                                                            83.6       2e-18 
PYIW_24289                                                            81.6       2e-18 
PYVX_14662                                                            85.1       2e-18 
CCA17179                                                              81.3       3e-18 
PITG_11936                                                            84.0       3e-18 
PYIR_20481                                                            83.2       3e-18 
SDRG_08129                                                            82.0       3e-18 
PITG_04947                                                            83.2       4e-18 
PYAP_18221                                                            81.3       6e-18 
PHALS_05394                                                           82.0       8e-18 
SDRG_15426                                                            83.2       1e-17 
H257_13550                                                            80.9       2e-17 
PHYCA_18657                                                           81.3       2e-17 
SPRG_19916                                                            81.3       2e-17 
PYU1_G005872                                                          81.3       2e-17 
PYU1_G005871                                                          80.9       2e-17 
SDRG_08137                                                            80.5       3e-17 
PYIW_24288                                                            78.6       3e-17 
PHYCA_97965                                                           80.1       4e-17 
PYU1_G005868                                                          79.7       4e-17 
PHYCA_12943                                                           80.1       4e-17 
PHYCA_120062                                                          78.6       5e-17 
PYAP_22257                                                            79.0       6e-17 
PHYRA_73581                                                           79.7       7e-17 
PHYRA_83499                                                           80.9       7e-17 
PHYSO_255056                                                          79.0       8e-17 
PYAP_24691                                                            76.3       9e-17 
PHALS_04411                                                           78.6       1e-16 
PHYRA_80750                                                           79.0       1e-16 
PHYSO_324715                                                          79.0       1e-16 
PHYCA_98479                                                           79.0       1e-16 
PYAR_20617                                                            78.6       1e-16 
PHYRA_84947                                                           78.6       1e-16 
SPRG_22161                                                            79.0       1e-16 
PITG_08202                                                            77.0       1e-16 
PHYCA_122958                                                          78.2       1e-16 
PYU1_G005985                                                          77.0       1e-16 
PPTG_18166                                                            79.7       1e-16 
PHYKE_2539                                                            78.2       2e-16 
PPTG_03160                                                            79.0       2e-16 
PHYSO_255975                                                          76.3       2e-16 
PHYCA_69583                                                           77.0       2e-16 
SPRG_07799                                                            78.6       3e-16 
PHYKE_8104                                                            73.2       3e-16 
HYAP_14170                                                            77.4       3e-16 
PHYRA_86151                                                           75.5       3e-16 
SPRG_07796                                                            78.2       3e-16 
PHYRA_87941                                                           75.1       4e-16 
PPTG_07516                                                            77.4       4e-16 
PHYRA_84732                                                           77.0       4e-16 
PPTG_07520                                                            77.4       4e-16 
PPTG_10186                                                            77.0       5e-16 
SDRG_16534                                                            77.4       6e-16 
PPTG_03139                                                            77.4       6e-16 
PYU1_G001519                                                          76.3       7e-16 
PYU1_G005873                                                          75.1       1e-15 
PYIW_18790                                                            71.6       1e-15 
PITG_20312                                                            75.9       1e-15 
PHYKE_10295                                                           75.9       1e-15 
PYVX_16138                                                            77.4       1e-15 
PITG_20631                                                            75.9       1e-15 
PYVX_20783                                                            75.9       1e-15 
PYIR_24743                                                            76.6       2e-15 
PYIR_24421                                                            74.7       2e-15 
PYAP_18226                                                            74.7       2e-15 
PYIW_15528                                                            75.9       2e-15 
PYAP_18138                                                            75.1       2e-15 
PHYSO_476077                                                          75.1       2e-15 
PHYSO_472009                                                          75.1       2e-15 
PYVX_22511                                                            75.5       2e-15 
SDRG_00948                                                            75.9       3e-15 
PPTG_03153                                                            75.5       3e-15 
PHYCA_103479                                                          75.1       4e-15 
PYVX_24563                                                            74.3       4e-15 
HYAP_11923                                                            75.9       4e-15 
PPTG_04617                                                            75.5       5e-15 
PPTG_01148                                                            74.7       5e-15 
PPTG_07521                                                            74.3       5e-15 
PYAR_16493                                                            73.9       5e-15 
PYVX_21297                                                            73.9       5e-15 
PHYKE_3912                                                            73.9       5e-15 
PHYCA_112615                                                          72.8       6e-15 
PHYKE_6077                                                            74.7       6e-15 
SPRG_19917                                                            73.6       6e-15 
PHYSO_262844                                                          73.9       7e-15 
PHYCA_19598                                                           74.7       7e-15 
SDRG_17317                                                            70.5       8e-15 
PHYCA_19611                                                           75.1       8e-15 
PITG_19818                                                            71.2       9e-15 
PHALS_02044                                                           72.8       9e-15 
SPRG_07795                                                            73.9       1e-14 
PHYKE_1913                                                            73.6       1e-14 
H257_11271                                                            74.3       1e-14 
PHYCA_132255                                                          70.1       1e-14 
PITG_01966                                                            73.6       1e-14 
PHYRA_77293                                                           73.2       2e-14 
PHALS_05110                                                           71.2       2e-14 
PHYRA_86241                                                           71.2       2e-14 
PHYSO_318683                                                          73.6       2e-14 
PHALS_10635                                                           72.8       2e-14 
H310_05432                                                            72.8       2e-14 
PPTG_04801                                                            72.4       2e-14 
SPRG_07826                                                            73.2       2e-14 
PHYRA_78172                                                           73.2       2e-14 
PYAR_25093                                                            70.9       3e-14 
PHYCA_123316                                                          72.8       3e-14 
SDRG_17318                                                            71.6       3e-14 
PHYKE_5749                                                            72.4       3e-14 
PYIR_25571                                                            72.0       3e-14 
PYAR_18165                                                            71.6       3e-14 
PPTG_04803                                                            71.6       4e-14 
PYU1_G001525                                                          72.4       4e-14 
PYAP_18584                                                            70.9       4e-14 
SPRG_07797                                                            72.0       5e-14 
PYAR_15391                                                            69.7       5e-14 
PHYRA_78176                                                           71.6       6e-14 
PHYRA_78175                                                           71.6       7e-14 
PYU1_G005866                                                          69.7       7e-14 
SPRG_07627                                                            72.0       7e-14 
PYAP_22462                                                            69.7       9e-14 
PHYCA_19612                                                           72.0       9e-14 
PHYSO_524101                                                          70.9       1e-13 
PHYSO_329293                                                          70.9       1e-13 
PYU1_G001514                                                          71.6       1e-13 
SPRG_07825                                                            71.2       1e-13 
PHYRA_93650                                                           69.7       1e-13 
PHYSO_488921                                                          70.5       1e-13 
PHYKE_6078                                                            70.9       1e-13 
SPRG_04679                                                            69.7       1e-13 
PITG_11937                                                            70.5       1e-13 
H257_11264                                                            70.1       2e-13 
PHYCA_14560                                                           70.5       2e-13 
PYAP_19707                                                            69.3       2e-13 
SDRG_08782                                                            70.9       2e-13 
PHYRA_78161                                                           70.5       2e-13 
PYU1_G007254                                                          68.2       2e-13 
H257_11265                                                            69.7       3e-13 
PYVX_19277                                                            70.1       3e-13 
PYIR_20483                                                            69.7       3e-13 
PHYKE_6076                                                            69.3       3e-13 
PPTG_20376                                                            67.8       3e-13 
SDRG_00972                                                            69.7       4e-13 
PYIR_15187                                                            67.8       4e-13 
PHYRA_86751                                                           67.0       4e-13 
PYIR_25334                                                            68.9       4e-13 
PYAR_21940                                                            68.6       5e-13 
PYAR_24818                                                            67.4       5e-13 
PPTG_01153                                                            68.9       5e-13 
PYAP_16338                                                            68.6       5e-13 
PHYKE_6079                                                            68.9       6e-13 
PPTG_10073                                                            67.0       6e-13 
PYVX_21643                                                            68.6       6e-13 
PPTG_03140                                                            69.3       6e-13 
PYU1_G005867                                                          67.4       6e-13 
PYIR_14463                                                            69.3       6e-13 
PYIW_18065                                                            68.9       6e-13 
PYIR_22549                                                            68.2       7e-13 
PYU1_G007242                                                          68.2       7e-13 
PYAP_23672                                                            68.2       8e-13 
PPTG_03156                                                            69.3       8e-13 
PHYKE_7445                                                            68.9       8e-13 
PYIW_25573                                                            68.2       9e-13 
PHYKE_6066                                                            68.2       9e-13 
H310_05433                                                            68.2       1e-12 
PYU1_G005869                                                          67.4       1e-12 
SDRG_17448                                                            67.4       1e-12 
PPTG_03138                                                            67.4       2e-12 
PHYCA_562062                                                          66.6       2e-12 
PHYSO_374518                                                          63.9       2e-12 
PYU1_G006405                                                          67.0       2e-12 
PYAP_16347                                                            65.5       3e-12 
PHYKE_10296                                                           67.8       3e-12 
PYIR_22134                                                            67.0       3e-12 
PYAP_16994                                                            66.6       3e-12 
HYAP_01683                                                            67.0       3e-12 
PHYRA_77290                                                           67.0       3e-12 
PHYRA_77292                                                           65.5       3e-12 
PHALS_02041                                                           66.2       3e-12 
PYVX_22510                                                            67.4       4e-12 
PHYCA_18729                                                           67.0       4e-12 
PYVX_21174                                                            62.4       4e-12 
PPTG_07511                                                            64.7       5e-12 
PHYKE_2379                                                            65.9       5e-12 
PYIW_16208                                                            65.5       6e-12 
PHYSO_256017                                                          63.5       6e-12 
PYVX_20789                                                            65.9       6e-12 
PYAP_20077                                                            65.1       7e-12 
PHYSO_375794                                                          62.8       7e-12 
PHYSO_246481                                                          65.9       7e-12 
PYAP_14265                                                            65.5       8e-12 
PHYRA_78174                                                           65.5       8e-12 
PYVX_16673                                                            66.2       9e-12 
PPTG_03143                                                            65.9       9e-12 
PYIW_16810                                                            63.9       1e-11 
PYIW_21964                                                            64.7       1e-11 
PHYCA_12944                                                           63.2       1e-11 
PYU1_G001520                                                          65.5       1e-11 
PYIR_16375                                                            64.3       1e-11 
PYIW_24287                                                            65.1       1e-11 
PYVX_22508                                                            64.7       2e-11 
PHYCA_19608                                                           64.3       2e-11 
PPTG_18176                                                            63.9       2e-11 
PHALS_08575                                                           64.3       2e-11 
PHYSO_318693                                                          64.7       2e-11 
PYIR_25999                                                            64.7       2e-11 
PYAR_22058                                                            62.8       2e-11 
H257_11258                                                            64.7       2e-11 
PYAP_19712                                                            63.9       2e-11 
PYIW_14247                                                            63.2       4e-11 
PPTG_09880                                                            62.4       4e-11 
PHYRA_77291                                                           62.8       5e-11 
PYU1_G005862                                                          61.6       6e-11 
PHYRA_86201                                                           62.8       6e-11 
PYAR_17166                                                            60.1       7e-11 
PYVX_24274                                                            62.4       7e-11 
PYIR_23689                                                            62.0       7e-11 
PYIW_18794                                                            62.4       7e-11 
PHYCA_15126                                                           63.2       8e-11 
PYU1_G001524                                                          62.8       8e-11 
PYIR_20482                                                            60.5       9e-11 
PYAR_14261                                                            60.5       9e-11 
H257_11306                                                            62.8       1e-10 
PYIR_23622                                                            62.0       1e-10 
PHALS_01293                                                           62.8       1e-10 
PHYRA_80632                                                           62.8       1e-10 
PYAR_17163                                                            59.3       1e-10 
PPTG_03148                                                            62.0       1e-10 
PYU1_G001527                                                          62.0       1e-10 
PYU1_G001523                                                          62.0       1e-10 
PHYSO_488139                                                          61.6       1e-10 
PYAR_15784                                                            60.5       2e-10 
PHYSO_525076                                                          62.0       2e-10 
PHYSO_257305                                                          60.5       2e-10 
PHYKE_2454                                                            62.0       2e-10 
PHYRA_78177                                                           61.6       2e-10 
PYAP_16337                                                            61.2       2e-10 
PITG_11942                                                            61.2       2e-10 
PHYSO_374025                                                          61.2       2e-10 
PHYRA_78164                                                           61.2       2e-10 
PYU1_G001526                                                          61.2       3e-10 
PYU1_G001475                                                          60.8       3e-10 
PHYRA_78169                                                           60.8       5e-10 
PYU1_G006404                                                          60.1       5e-10 
PYIW_21963                                                            60.1       8e-10 
PYVX_23997                                                            58.5       9e-10 
PYIR_22634                                                            59.3       1e-09 
PYAP_23455                                                            60.1       1e-09 
PYU1_G006672                                                          55.1       1e-09 
PHYKE_9023                                                            59.3       1e-09 
PHYSO_426658                                                          58.5       1e-09 
PYU1_G005878                                                          55.5       1e-09 
PPTG_01147                                                            58.9       1e-09 
PPTG_06256                                                            59.3       1e-09 
PITG_08892                                                            59.3       1e-09 
PYIR_22136                                                            59.3       1e-09 
PYIR_25001                                                            58.2       1e-09 
PYIR_22133                                                            59.7       2e-09 
PHYCA_14559                                                           58.5       2e-09 
PYIW_19601                                                            58.5       2e-09 
PYU1_G001516                                                          58.9       2e-09 
PHYKE_6069                                                            58.5       2e-09 
PYU1_G001528                                                          58.5       2e-09 
PYU1_G006403                                                          58.2       2e-09 
PYAP_23673                                                            58.5       2e-09 
H310_05438                                                            58.5       3e-09 
PPTG_01152                                                            58.2       3e-09 
PYAP_18983                                                            57.0       3e-09 
PPTG_06249                                                            58.2       3e-09 
PHYKE_7443                                                            58.2       3e-09 
PPTG_03161                                                            58.5       3e-09 
PHYCA_552912                                                          58.5       4e-09 
PYU1_G007250                                                          56.6       4e-09 
PPTG_03144                                                            58.2       4e-09 
PYAR_21271                                                            57.4       4e-09 
PHYCA_558591                                                          55.1       5e-09 
PYIR_20304                                                            56.6       5e-09 
PHYCA_6388                                                            57.4       5e-09 
PYAP_24338                                                            57.4       5e-09 
PYAP_25026                                                            57.0       6e-09 
PITG_04404                                                            56.6       6e-09 
PYVX_22512                                                            56.6       6e-09 
PHYSO_454780                                                          55.8       6e-09 
PHYKE_7446                                                            57.0       9e-09 
PYU1_G001518                                                          57.0       1e-08 
PHYKE_9024                                                            56.6       1e-08 
PYIW_23030                                                            56.2       1e-08 
PYIR_24867                                                            57.0       1e-08 
PHYRA_78162                                                           57.0       1e-08 
PITG_01969                                                            55.8       2e-08 
PHYSO_337515                                                          56.2       2e-08 
PHYCA_10471                                                           55.8       2e-08 
PHYKE_8390                                                            53.5       2e-08 
PPTG_03145                                                            55.8       2e-08 
PHYCA_15124                                                           55.8       2e-08 
PHYRA_95184                                                           56.2       2e-08 
PHALS_02295                                                           55.5       2e-08 
PYIW_14252                                                            55.1       3e-08 
PYAR_24939                                                            53.9       3e-08 
PHYCA_10470                                                           55.1       3e-08 
PYAP_18982                                                            53.9       4e-08 
PYU1_G001517                                                          55.1       4e-08 
PYAR_13902                                                            53.1       5e-08 
PYVX_21438                                                            54.7       5e-08 
PPTG_13879                                                            54.7       5e-08 
PHYRA_75781                                                           54.3       6e-08 
PHYSO_339832                                                          54.3       6e-08 
PHYRA_80631                                                           54.7       6e-08 
PHYRA_78168                                                           54.3       7e-08 
PHALS_01460                                                           53.9       8e-08 
PYIR_22135                                                            54.3       9e-08 
PHYCA_15125                                                           53.9       9e-08 
PHYCA_19606                                                           53.9       9e-08 
PITG_11957                                                            53.9       1e-07 
PYVX_21644                                                            53.1       1e-07 
PITG_21641                                                            53.9       1e-07 
PHYSO_489485                                                          52.0       1e-07 
PHALS_02037                                                           53.5       1e-07 
PYAR_25949                                                            52.4       1e-07 
PPTG_00483                                                            53.1       1e-07 
PYIR_26867                                                            52.0       2e-07 
PYIR_17978                                                            53.1       2e-07 
PYAR_15390                                                            52.0       2e-07 
PHYCA_538650                                                          53.1       2e-07 
PITG_11946                                                            52.4       2e-07 
PYIR_16437                                                            52.8       2e-07 
PYAP_20161                                                            52.4       2e-07 
PYU1_G003057                                                          52.0       2e-07 
PITG_11944                                                            52.8       2e-07 
PPTG_06253                                                            52.4       3e-07 
PHYRA_78165                                                           52.4       3e-07 
PHYCA_122138                                                          51.6       4e-07 
PYAR_17307                                                            52.0       4e-07 
PHYSO_525121                                                          51.6       4e-07 
PHYSO_342361                                                          50.4       4e-07 
PITG_08895                                                            50.8       5e-07 
PHYSO_341657                                                          51.6       6e-07 
PHALS_05395                                                           50.4       6e-07 
PYAP_18307                                                            51.2       7e-07 
PHYRA_78167                                                           51.2       8e-07 

>PITG_18450
Length=203

 Score = 358 bits (918),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEY  82
            PTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEY
Sbjct  23   PTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEY  82

Query  83   TVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142
            TVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK
Sbjct  83   TVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142

Query  143  TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFDPT  202
            TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFDPT
Sbjct  143  TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFDPT  202

Query  203  A  203
            A
Sbjct  203  A  203

>PPTG_17122
Length=204

 Score = 314 bits (805),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 166/181 (92%), Gaps = 3/181 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PT+ AHQVVLLP+PTYTTD+KDTKYAPL FLE QGYETVEDFNGWRRNNGYKTLRDFM+ 
Sbjct  23   PTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              YTV DGADYYCGFTNVNAAPQP PDG MRSTGYTHDGPCEVWLD+ RVLQSDNCHETI
Sbjct  83   AKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETI  142

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVF  199
             GKTYNLDYSSC GTCTLRWYWLGVR+LKNAYSWQIYKACIPLSASARRLE AAN+SV  
Sbjct  143  SGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANESVAL  202

Query  200  D  200
            +
Sbjct  203  E  203

>PHYCA_129425
Length=204

 Score = 294 bits (753),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 160/181 (88%), Gaps = 3/181 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQVVLLP+PTYTTD+KDTKYAPL FLE QG++TVEDFNGWRR+NGYKTLR FM+ 
Sbjct  23   PTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              YTV DGADYYCGFTN  AAPQP PDG MRSTGYTHDGPCEVWLDSTRVLQSDNCHET 
Sbjct  83   AKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVF  199
             GKTYNLDYSSCKG+C LRWYWLG RFLKN +SWQ+YKACIPLS+SARRLE AAN+S   
Sbjct  143  PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202

Query  200  D  200
            +
Sbjct  203  E  203

>PHYSO_284086
Length=204

 Score = 291 bits (745),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 157/181 (87%), Gaps = 3/181 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQVVLLP+PTYTTDDK TKYAPL FLE QGYETVEDFN WRR+ GYKTLR FM+ 
Sbjct  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              YTVADGADYYCGFT++    QP PDG MRSTGYTHDGPCEVWLD+TRVLQSDNCHET 
Sbjct  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVF  199
             GKTY+LDYSSCKG+CTLRWYWLGVRFLKN YSWQ+YKAC+PLS SARRLE AAN+S   
Sbjct  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESAAL  202

Query  200  D  200
            +
Sbjct  203  E  203

>PHYKE_8389
Length=204

 Score = 279 bits (713),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 156/182 (86%), Gaps = 4/182 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQVVLLP+PTYTTDDKDTKYAPL FLE QG+ETV+DFN WRRNNGYKTLR FM+ 
Sbjct  22   PTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG  81

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV DGADY+CGFTN +AAPQ  P G AMRSTGYTHDGPCEVWLD+TRVL  DNCHE 
Sbjct  82   AKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198
            I GK Y +DYSSC GTCTLRWYWLGVRFLKN YSWQ+YKAC+PLSASARRL+ AAN+S  
Sbjct  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAA  201

Query  199  FD  200
             +
Sbjct  202  IE  203

>PHYRA_81106
Length=202

 Score = 267 bits (682),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 151/182 (83%), Gaps = 7/182 (4%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P   AHQVVLLP+PTYTTD KDTKYAPL FLE QG+ETV DFN WRR+NGYKTLR FM+ 
Sbjct  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTVADGADYYCGFTN +A PQ  PDG AMRSTGYTHDGPCEVWLD+TRVL  DNCHE 
Sbjct  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198
            I GK Y +DYSSC GTCTL WYW+GVR+LKNAYSWQ+YKAC+PLSASARRL    N+S V
Sbjct  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199

Query  199  FD  200
             D
Sbjct  200  ID  201

>PHYKE_8388
Length=205

 Score = 253 bits (645),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 148/182 (81%), Gaps = 4/182 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P A AHQVVLLPSPTYTTDDK TKYAPL FLE QG+ T EDF  WR +NGY +LR F + 
Sbjct  23   PIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDD  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPD-GAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV+DGAD+ CGFT++N A QP PD  AMRSTGYTHDGPCEVWLD T V+Q +NCH++
Sbjct  83   ASYTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDS  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198
            I GK Y +DYSSC  TCTL W+W+GVR+LKN YSWQ+YKAC+PLSASARRLE A N+SV+
Sbjct  143  ISGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASARRLEGAVNESVI  202

Query  199  FD  200
            F+
Sbjct  203  FE  204

>PPTG_17121
Length=202

 Score = 248 bits (633),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 144/180 (80%), Gaps = 4/180 (2%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQVVLL +PTYTTDDKDTKYAPL FLE QG+ T EDF  WR++NGY +LR F +   
Sbjct  22   ANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS  81

Query  82   YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140
            YTV+DGAD  CGFTN+N   QP PDG AMRSTGYTHDGPCEVWLD T V+Q DNCHE I 
Sbjct  82   YTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  141

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200
            GK Y +DYSSC  TCTL W+WLGVR+LKN YSWQIYKAC+PLS SARRLE AAN+S + D
Sbjct  142  GKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAIID  201

>PHYRA_81107
Length=202

 Score = 247 bits (631),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 142/180 (79%), Gaps = 4/180 (2%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDF---ME  81
            A AHQVVLLP+PTYTTDDK TKYAPL FLE QG+ T EDF  WR  NGY +LR F     
Sbjct  22   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGAS  81

Query  82   YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140
            YTV+DGAD+ CGFT++N   Q  PDG AMRSTGYTHDGPCEVWLD T V+Q DNCHE I 
Sbjct  82   YTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVIS  141

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200
            GK Y +DYSSC  TCTL W+W+GVR+L NAYSWQ+YKAC+PLSASARRLE AAN+S + D
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASARRLEGAANESAILD  201

>PHYSO_477820
Length=202

 Score = 245 bits (626),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 141/180 (78%), Gaps = 4/180 (2%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQVVLLP+PTYTTDDK TKYAPL FLE QG+ T EDF  WR +NGY +LR F +   
Sbjct  22   AGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS  81

Query  82   YTVADGADYYCGFTNVNAAPQPNPD-GAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140
            YTVADGAD+ CGFTN N   QP PD  AMRSTGYTHDGPCEVWLD T V+Q DNCHE+I 
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200
            GK Y +DYSSC  TCTL W+WLGVR+LKN YSWQIYKAC+PLS SARRLE A N+S   D
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGATNESARLD  201

>PHYCA_511409
Length=204

 Score = 244 bits (624),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 143/180 (79%), Gaps = 4/180 (2%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQVVLLP+PTYTTDDK TKYAPL FLE QG+ T EDF  WR++NGY +LR F +   
Sbjct  24   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGAS  83

Query  82   YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140
            YTV+DGAD+ CGFTN N   Q  PD  AMRSTGYTHDGPCEVWLD T V+Q DNCHE I 
Sbjct  84   YTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  143

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200
            GK Y +DYSSC  TCTL W+WLGVR+LKN YSWQIYKAC+PLSASARRLE AAN+S + D
Sbjct  144  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIAD  203

>PHYRA_82864
Length=193

 Score = 243 bits (620),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 3/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQVVLLP P +TTD+KDTKY PL FLEGQG+ T  DFN WRR+NGYKTLRDFM+ 
Sbjct  23   PTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              YTV +GADY+CG+T+ N  PQP P G MRSTGYTHDGPCEVWLD+TRVLQ DNCHE  
Sbjct  83   AKYTVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQF  142

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
              K Y +DYSSCKGTCTL WYW+GVRFLKN+YSWQ+YK CI L++  R
Sbjct  143  PDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQR  190

>PHYCA_14369
Length=248

 Score = 241 bits (615),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 134/168 (80%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLLP P +TT+DKDTKY PL FLE QG++T +DF  WR  NGYK+LRDFM+ 
Sbjct  23   PTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV +GAD+ CGFT+    PQP P G AMRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  83   AKYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              GK Y +DYSSCKGTCTLRWYWLGVRFLKNAYSWQ+YKACIPL+ S 
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  190

>PYVX_18176
Length=201

 Score = 238 bits (607),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 137/179 (77%), Gaps = 3/179 (2%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQ V+LP+PT+ TDDKD  YAPL FLE QG+ T EDF  WR +NGY +LR FM+   
Sbjct  22   ADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS  81

Query  82   YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
            YTV DGAD  CG+TN +   Q  PDG MRSTGYTH GPCEVWLD T VLQ DNCH++I G
Sbjct  82   YTVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISG  141

Query  142  KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200
            KTY+LDYSSC  TCTL W+W+GVR+L N YSWQ+YK C+PLSASARRLE AAN S V D
Sbjct  142  KTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAVVD  200

>PPTG_15264
Length=194

 Score = 236 bits (601),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 6/171 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YT  83
            AHQ+VL P P +TTD+KD KY PL FLEGQG++T EDFN WRR+NGYKTLRDFM+   YT
Sbjct  24   AHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKYT  83

Query  84   VADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142
            V +GADY+CG+T+    PQP P  GAMRSTGYTHDGPCEVWLD  RVL+  NCHE+I GK
Sbjct  84   VTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGK  143

Query  143  TYNLDYSSC--KGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEV  191
             Y +DYSSC  KG C LRWYWLGVRFLKN+YSWQ+YK CIPL+ + +RL V
Sbjct  144  DYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLRV  194

>PPTG_17366
Length=194

 Score = 236 bits (601),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 6/171 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YT  83
            AHQ+VL P P +TTD+KD KY PL FLEGQG++T EDFN WRR+NGYKTLRDFM+   YT
Sbjct  24   AHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKYT  83

Query  84   VADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142
            V +GADY+CG+T+    PQP P  GAMRSTGYTHDGPCEVWLD  RVL+  NCHE+I GK
Sbjct  84   VTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGK  143

Query  143  TYNLDYSSC--KGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEV  191
             Y +DYSSC  KG C LRWYWLGVRFLKN+YSWQ+YK CIPL+ + +RL V
Sbjct  144  DYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLRV  194

>PHYSO_341599
Length=185

 Score = 234 bits (598),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLLP P +TT+DK+TKY PL FLE QG++T EDF  WR+ NGYK+LRDFM+ 
Sbjct  6    PTADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR  65

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P+G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              GK Y +DYSSCKGTCTLRWYWLGVRFLKN YSWQ+YKACIPL++ +
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGS  173

>PHYKE_3446
Length=199

 Score = 235 bits (600),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 135/168 (80%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P   AHQ+VLLP P + TD K+ KY PL FLE QG+ T ED N WRR+NGYKTLR FM+ 
Sbjct  23   PITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDM  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V +GADY+CG+T+ N   QP P+G AMRSTGYTHDGPCEVW+D+TRVL+S NCHET
Sbjct  83   AKYQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHET  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            I GK Y +DYS+C+GTC LRWYWLGVRFLKN+YSWQ+YKACIPL++ +
Sbjct  143  ITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  190

>PHYCA_102624
Length=195

 Score = 235 bits (599),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 134/172 (78%), Gaps = 4/172 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTATAHQVVLLP P + TD++DT++ PLTFLEG G++T  DF  WR+ NGYK+LRDFM+ 
Sbjct  23   PTATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V++GAD+ CGFT+ N  PQP P G AMRSTGYTHDGPCEVW+D T V++ DNCHE 
Sbjct  83   AKYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLE  190
              GK Y +DYS CKG CTL WYWLGVRFLKN YSWQ+YK CIPL++  R L 
Sbjct  143  FPGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQRSLR  194

>PHYRA_85631
Length=228

 Score = 234 bits (598),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 133/174 (76%), Gaps = 4/174 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQVVLLP P +TTDDKDTKY PL FLE +G+ T EDF  WR  NGYK+LRDFM+ 
Sbjct  23   PTADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y VADGAD+ CGFT+    PQP P G AMRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  83   AKYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVA  192
              GK Y +DYSSCKGTCTLRWYWLG+RFLKN YSWQ+YK CIPL+  +   E A
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESA  196

>PHYCA_102852
Length=195

 Score = 232 bits (592),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 133/171 (78%), Gaps = 4/171 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLLP P +TT+DKDTKY PL FLE +G+ T EDF  WR  NGYK+LRDFM+ 
Sbjct  23   PTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V +GAD+ CGFT+ N  PQP P G AMRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  83   AKYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRL  189
              GK Y +DYSSCKGTCTL W+WLGVRFLKN YSWQ+YKACIPL+A  R L
Sbjct  143  FPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTAGQRNL  193

>PPTG_10635
Length=199

 Score = 232 bits (592),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 131/168 (78%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P A AHQ+VLLP P +TT+DKDTKY PL FLE QG++T EDF  WR  NGYK+LRDFM+ 
Sbjct  6    PMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR  65

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P G AMRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  66   AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              GK Y +DYSSCKG+CTLRWYWLGVRFLKN+YSWQ+YKACIPL+  A
Sbjct  126  FPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGA  173

>PHYCA_102550
Length=268

 Score = 234 bits (597),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 133/168 (79%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTATAHQVVLLP+P + TD++DT++ PL FLE QG++T +DF  WR  NGYK+LRDFM+ 
Sbjct  23   PTATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV +GAD+ CG+T+ N  PQP P G AMRSTGYTHDGPCEVW+D T V++ DNCHE 
Sbjct  83   AKYTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              GK Y +DYS CKG CTL WYWLGVRFLKN+YSWQ+YK CIPL+ S 
Sbjct  143  FPGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PYVX_18174
Length=204

 Score = 230 bits (587),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 136/180 (76%), Gaps = 5/180 (3%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQ V+LP PT+TT D+D  YAPL FLE QG+ETVEDFN WRR+NGYKTLR FM+   
Sbjct  25   ADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS  84

Query  82   YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
            YTV DGAD  CGFT ++  PQP P    RSTGYTHDGPCE+WLDSTRV  +DNCHE I G
Sbjct  85   YTVTDGADQTCGFTEIDGTPQPIP-ANFRSTGYTHDGPCEIWLDSTRVYANDNCHEAISG  143

Query  142  KTYNLDYSSCK-GTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  200
            K   +DYS    GTCTL WYW+GVR+L NAYSWQ+YK C+PLS SAR LE AAN S + +
Sbjct  144  KDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARMLEGAANASAIIE  203

>PHYKE_7718
Length=220

 Score = 230 bits (587),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 136/175 (78%), Gaps = 4/175 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P A AHQ+VLLP PT+TTDDKDTKY PL FLEG+G+   EDF  WR  NGYK+LRDFM+ 
Sbjct  27   PIADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN  86

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y+V  GAD  CGFT+ N  PQP P+G AMRSTGYTHDGPCEVW+D T  + +DNCHE 
Sbjct  87   AKYSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEA  146

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAA  193
              GK Y +DYS+CKGTCTLRWYWLGVRFLKN+YSWQ+YKACIPL+ S     VA+
Sbjct  147  FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSGGGAPVAS  201

>PHYRA_84190
Length=206

 Score = 229 bits (583),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 132/174 (76%), Gaps = 4/174 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLLP P +TTDDKDTKY PL FLE +G+ T EDF  WR  NGYK+LRDFM+ 
Sbjct  6    PTADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN  65

Query  82   --YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y+V +GAD+ CGFT+    PQP P D AMRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  66   AKYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  125

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVA  192
              GK Y +DYSSCKGTCTLRWYW+GVRFLK  YSWQ+YK CIPL+  +   E A
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESA  179

>PHYSO_536424
Length=197

 Score = 228 bits (582),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 130/168 (77%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P  T HQ+VLLP P +TT+DK+TKY PL FLE +G+ T EDF  WR+ NGYK+LRDFM+ 
Sbjct  18   PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P+G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  78   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              GK Y +DYSSCKGTCTLRWYWLGVRFLKN YSWQ+YKACIPL++ +
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGS  185

>PHYSO_507031
Length=197

 Score = 228 bits (582),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 130/168 (77%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P  T HQ+VLLP P +TT+DK+TKY PL FLE +G+ T EDF  WR+ NGYK+LRDFM+ 
Sbjct  18   PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P+G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  78   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              GK Y +DYSSCKGTCTLRWYWLGVRFLKN YSWQ+YKACIPL++ +
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGS  185

>PPTG_10636
Length=246

 Score = 229 bits (584),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 129/169 (76%), Gaps = 4/169 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P A AHQ+VLLP P +TT+DKDTKY PL FLE QG++T EDF  WR  N YK+LRDFM+ 
Sbjct  23   PMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P G AMRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  83   AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
              GK Y +DYSSCKGTCTLRWYWLG+RFLKN YSWQ+YKACIPLS S  
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGE  191

>PPTG_10634
Length=208

 Score = 225 bits (574),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 127/163 (78%), Gaps = 4/163 (2%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81
            T  AHQ+VLLP P +TT+DK+TKY PL FLE +G+ T EDF  WR+ NGYK+LRDF++  
Sbjct  24   TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  83

Query  82   -YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
             Y V DGAD+ CGFT+    PQP P G AMRSTGYTHDGPCEVWLD T VL  DNCHE  
Sbjct  84   KYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
             GK Y +DYSSCKGTCTL WYWLGVRFLKN YSWQ+YKACIPL
Sbjct  144  PGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_10643
Length=250

 Score = 224 bits (571),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 131/183 (72%), Gaps = 4/183 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PT  AHQ+VLLP P +TT+DKDTKY PL FLE QG++  EDF  W + NGYK+LRDFM+ 
Sbjct  23   PTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFTN    PQP P  G MRSTGYTHDGPCEV+LD T VLQ DNCHE 
Sbjct  83   AKYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198
              GK   +DYSSCKGTCTLRWYWLG+RFLKNAYSWQ+YK CIPL  S    + A   S  
Sbjct  143  FPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSGGVSQTAPVTSGT  202

Query  199  FDP  201
              P
Sbjct  203  GKP  205

>PYU1_G001741
Length=199

 Score = 215 bits (548),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 127/170 (75%), Gaps = 5/170 (3%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81
            TA AHQ V+LP+PT+T   +  ++ PL FLE QG+ET  DFN + +  GYKTLR FM+  
Sbjct  23   TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDK  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              YTVA GAD+ CG+T ++   Q  P G +RSTGYTHDGPCEVWLDSTRV++ +NCH   
Sbjct  83   KAYTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEF  142

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRL  189
             G T+ +DYSSCKG+CTLRWYW+G+RFLK  YSWQ+YK C+P+  S+RRL
Sbjct  143  TGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPI-GSSRRL  191

>PYVX_18173
Length=500

 Score = 225 bits (573),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 130/165 (79%), Gaps = 4/165 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P A AHQ+V+LP+PTYT + KD ++ PL FLEGQ + T +DF G+   NG+ +LR FM+ 
Sbjct  230  PQAMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD  289

Query  82   ---YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
               Y+V   AD+ CGFT+ +AAPQP PDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE 
Sbjct  290  DSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEV  349

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
            I GKTY+LDYS+C G+CTL WYWLGVR+LK  YSWQ+YKAC+P+S
Sbjct  350  ISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 130 bits (328),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 94/163 (58%), Gaps = 5/163 (3%)

Query  29   QVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84
            QVVL P P +  D  D + +P+ +LE QG  T  +   W    GY TLR  M+    Y+V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143
             +   + CG T  N   QP P +G+  ++GYT DGPCE+W+D+T  L   NCH       
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            + +DYS C  +C + W+WLG+++    YSWQ++K CI LSASA
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

>PPTG_10048
Length=190

 Score = 213 bits (543),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 128/168 (76%), Gaps = 4/168 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P   AHQVVL P+P + TD++DT++ PL FLE QG++T EDF  WR  NGYKTLRDFME 
Sbjct  20   PLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH  79

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGA-MRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV +GAD+ CG+TN    PQP P G  MRSTGYTH+GPCE+W+  T+V Q+DNCH +
Sbjct  80   AKYTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVS  139

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            + GK Y +DYS CKG C L WYWLGVRFLKN+YSWQ+YK CIPL+ ++
Sbjct  140  LPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PHALS_00498
Length=199

 Score = 213 bits (541),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 125/169 (74%), Gaps = 4/169 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P   AHQ+VLLP P + T+DKDT+Y PL FLE Q ++T  D   + + N +KTLRDFM+ 
Sbjct  23   PNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDN  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV  GAD  CGFT+ N  PQP P + AMRSTGYTHDGPCEVWL++TRVL + NCHE 
Sbjct  83   AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
              GK Y +DYSSCK  C LRWYWLGVRFLK  YSWQ+YKACIPLS SA+
Sbjct  143  FPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  191

>PYU1_G001742
Length=213

 Score = 210 bits (535),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 130/185 (70%), Gaps = 8/185 (4%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81
            +A AHQ V+LP+PT+T   +  ++ PL FLE QGY+T  DFN + +  GYKTLR FM+  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDP  83

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              Y VA GAD+ CG+T ++   QP P G +RSTGYTHDGPCEVWLDSTRV++ +NCH   
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEF  143

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLE---VAANKS  196
             G T+ +DYSSCKG+CTLRWYW+G+RFLK  YSWQ+YK C+P+    R LE      N +
Sbjct  144  PGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNST  202

Query  197  VVFDP  201
             ++ P
Sbjct  203  ELYQP  207

>PYIR_25089
Length=262

 Score = 207 bits (526),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 123/170 (72%), Gaps = 6/170 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            AHQ V+LP+PT+T   +  ++ PL FLE QG++T  DF+ + +  GYKTLR FM+    Y
Sbjct  27   AHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAY  86

Query  83   TVADGADYYCGFTNVNAAPQPNPDGA-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
             VADGAD+ CG+T +   PQP P  + +RSTGYTHDGPCEVWLD TRVL+  NCH    G
Sbjct  87   KVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPG  146

Query  142  KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEV  191
             T+ +DYSSCKG+C LRWYW+G+RFLK  YSWQ+YK C+P++ S R L+ 
Sbjct  147  TTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS-RSLDT  195

>PYIR_26626
Length=212

 Score = 204 bits (518),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 6/168 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            AHQ V+LP+PT+T  DK+  + PL FLE QGY+T  DFNG+ ++ GYKTLR FM+    Y
Sbjct  27   AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  86

Query  83   TV-ADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
             V A GA++ CG+TN+N   QP P G +RSTGYTHDGPCEVWLD+T+V+   NC++   G
Sbjct  87   KVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  146

Query  142  KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRL  189
            KT+++ Y+SCKG+CTLRWYW+G+RFLKN +SWQ+YK C+P+  S RRL
Sbjct  147  KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI-GSGRRL  193

>PYU1_G001744
Length=213

 Score = 201 bits (510),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 128/185 (69%), Gaps = 8/185 (4%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81
            +A AHQ V+LP+PT+T   +  ++ PL FLE QG++T  DFN + +  GYK+LR FM+  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDK  83

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
              Y VA GAD+ CG+T ++   QP P G +RSTGYTHDGPCEVWLD+T V++ +NCH   
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEF  143

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLE---VAANKS  196
             G T+ + Y+SCKG+CTLRWYW+G+RFLK  YSWQ+YK C+P+    R LE      N +
Sbjct  144  PGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNST  202

Query  197  VVFDP  201
             ++ P
Sbjct  203  ELYQP  207

>PYU1_G001740
Length=206

 Score = 196 bits (498),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 121/162 (75%), Gaps = 5/162 (3%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQ+V+LP+PT+T   KD +++PL FLE QGY+T  DFN + ++ GYK+LR FM+   
Sbjct  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKK  84

Query  82   -YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140
             Y V   AD+ CG+TN N A QP P    R+TGYTHDGPCEVWLD+T+VL   NCH+   
Sbjct  85   AYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            GKT+ + Y++CKG+CTLRWYW+G+RFLK  +SWQ+YK C+PL
Sbjct  144  GKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PHYSO_499978
Length=174

 Score = 192 bits (487),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 112/143 (78%), Gaps = 4/143 (3%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VL P P +TT+DK+TKY PL FLE QG+ T +DF  WR  NGYKTLRDFM+ 
Sbjct  23   PTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV  GAD+ CG+T+    PQP PDG AMRSTGYTHDGPCEVW+D+TRVLQ DNCHE 
Sbjct  83   GKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYW  161
            I  K Y +DYS+CKGTCTLRWYW
Sbjct  143  IADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 192 bits (487),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 112/143 (78%), Gaps = 4/143 (3%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VL P P +TT+DK+TKY PL FLE QG+ T +DF  WR  NGYKTLRDFM+ 
Sbjct  23   PTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV  GAD+ CG+T+    PQP PDG AMRSTGYTHDGPCEVW+D+TRVLQ DNCHE 
Sbjct  83   GKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEK  142

Query  139  IIGKTYNLDYSSCKGTCTLRWYW  161
            I  K Y +DYS+CKGTCTLRWYW
Sbjct  143  IADKGYTIDYSACKGTCTLRWYW  165

>PHALS_03284
Length=188

 Score = 189 bits (480),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 116/169 (69%), Gaps = 4/169 (2%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            P   AHQ++LLP P + T+DKDTKY PL FLE Q + T  DF G+ + N Y +LRDF++ 
Sbjct  9    PNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKR  68

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDGA-MRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV +GAD  CGFT+ N  PQP P G  MR TGYTHDG CE+WLD T+VL   NCH  
Sbjct  69   ANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHND  128

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
              GK   +DYSSCK  C + WYWL VR LKN YSWQ+YKACIPL+ S +
Sbjct  129  FPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  177

>PHYSO_254168
Length=170

 Score = 182 bits (463),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 107/148 (72%), Gaps = 19/148 (13%)

Query  49   PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNP  105
            PL FLEGQG+ T E F+  RR+NGYKTLRDFM+   YTV  GADY+CG+TN    PQP P
Sbjct  37   PLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTNPKGTPQPIP  96

Query  106  DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSC--KGTCTLRWYWLG  163
                RSTGYTHDGPCE+WLD  RVL+          ++  +DYSSC  KG CT+ WYWLG
Sbjct  97   ----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGGCTMHWYWLG  142

Query  164  VRFLKNAYSWQIYKACIPLSASARRLEV  191
            VRFLKN+YSWQ+YK CIPL+A+ +RL +
Sbjct  143  VRFLKNSYSWQVYKECIPLTAAPKRLRM  170

>PPTG_08820
Length=250

 Score = 184 bits (467),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 114/171 (67%), Gaps = 10/171 (6%)

Query  24   TATAHQVVLLPSPtyttddkdtkyA--PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
            T  AHQ++L P P +     D      PL FLE QG+    DFNGWR  +GYK LRDFM+
Sbjct  24   TVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  83

Query  82   Y-----TVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNC  135
                  +V  GAD  CG T +   P+P P DG M+STGYTHDGPC V+LD   VL+ DNC
Sbjct  84   RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNC  143

Query  136  HETIIGKTYNLDYSSC--KGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSA  184
            HE + GK+Y +DYSSC  KG CTL W+WLG+RF+K+ +SWQ+YK C+PL+A
Sbjct  144  HEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  194

>PPTG_14255
Length=268

 Score = 181 bits (460),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 115/165 (70%), Gaps = 9/165 (5%)

Query  27   AHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
            AHQVV +PSPT+T  +  +        PL+FLE +GY T E+F  ++ +NGYK+LRDFM+
Sbjct  21   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  80

Query  82   ---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  137
               Y+V DGAD  CG+T+    PQ  P DG MR++GYTHDGPCE+++  T  L   NCHE
Sbjct  81   NAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHE  140

Query  138  TIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            +I  +T+ LDYS+C  +C L WYWLGVR+LK  YSWQ+YK CIPL
Sbjct  141  SITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PITG_10499
Length=323

 Score = 182 bits (461),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 105/144 (73%), Gaps = 8/144 (6%)

Query  49   PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEY-----TVADGADYYCGFTNVNAAPQP  103
            PL FLE QG+   EDFNGWR  NGYK LRDFM+      +V  GAD  CG T +   P+P
Sbjct  21   PLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGLTELKGPPRP  80

Query  104  NP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSC--KGTCTLRWY  160
             P DGAMRSTGYTHDGPC ++LD   V++ DNCHE+I G+TY +D+SSC  KG CTL W+
Sbjct  81   IPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQKKGGCTLYWF  140

Query  161  WLGVRFLKNAYSWQIYKACIPLSA  184
            WLG+RF+K+ +SWQ+YK CI L+A
Sbjct  141  WLGIRFVKSRWSWQVYKECISLTA  164

>PYU1_G001739
Length=266

 Score = 180 bits (456),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 110/165 (67%), Gaps = 5/165 (3%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            AHQ+++ P P +  D KD ++ PL FLE QG  T  D  G+ +  GY  LR  M+    Y
Sbjct  23   AHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLY  82

Query  83   TVADGADYYCGFTNVNAAPQPNPD-GAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
             V   A + CG+T+     QP P  G +RSTGYTHDGPCEVWLD  +V+  DNCH+   G
Sbjct  83   EVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG  142

Query  142  KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            KT+ LDYSSCKG+CTLRWYWLGVR+LK  YSWQIYK C+ LS +A
Sbjct  143  KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  187

>PHYSO_343376
Length=172

 Score = 176 bits (447),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 91/117 (78%), Gaps = 4/117 (3%)

Query  49   PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNP  105
            PL FLE QG+ T +DF  WR  NGYKTLRDFM+   YTV  GAD+ CG+T+    PQP P
Sbjct  47   PLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFSCGWTDPKGTPQPIP  106

Query  106  DG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYW  161
            DG AMRSTGYTHDGPCEVW+D+TRVLQ DNCHE I  K Y +DYS+CKGTCTLRWYW
Sbjct  107  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PHYCA_510817
Length=188

 Score = 176 bits (445),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 115/168 (68%), Gaps = 9/168 (5%)

Query  24   TATAHQVVLLPSPt-----yttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRD  78
            +  AHQVV +PSPT      T+ ++   + PL+FLE +G++T E+F  ++ +NGYK+LRD
Sbjct  19   STEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  78

Query  79   FME---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            FME   Y V+DGAD  CG+++    PQ  P DG MR++GYTHDGPCE+W+     L   N
Sbjct  79   FMEKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLN  138

Query  135  CHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            CHE+I  +T+ LDYS C  +C L WYWLGVR LK  YSWQ+YK CIPL
Sbjct  139  CHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PHYSO_417649
Length=185

 Score = 172 bits (436),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 112/168 (67%), Gaps = 9/168 (5%)

Query  24   TATAHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRD  78
            +  AHQVV +PSPT+T  +           PL+FLE +G++T E+F  ++ +NGYK+LRD
Sbjct  17   SVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  76

Query  79   FME---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            FME   Y + DGAD  CG+T+    PQ  P DG MR++GYTHDGPCE+++     L   N
Sbjct  77   FMERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  136

Query  135  CHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            CHE+I  +T+ LDYS C  +C L WYWLGVR LK  +SWQ+YK CIPL
Sbjct  137  CHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PHYKE_9185
Length=281

 Score = 172 bits (436),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 114/168 (68%), Gaps = 9/168 (5%)

Query  24   TATAHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRD  78
            T  AHQVV +PSPT+T  +  +K       PL+FLE +G +T E+F  ++ +N Y +LRD
Sbjct  21   TTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRD  80

Query  79   FME---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            FM+   Y V+DGAD  CG+T+    PQ  P DG MR++GYTHDGPCE+++     L   N
Sbjct  81   FMDKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  140

Query  135  CHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            CHE+I  +T+ LDYS+C  +C L WYWLGVR LK +YSWQIYK CIPL
Sbjct  141  CHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PYAR_24096
Length=227

 Score = 170 bits (431),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 109/164 (66%), Gaps = 7/164 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            AHQ V LP   YT  +++T + P   LE QGY+T  DFN + + N YKTLR+FM+    Y
Sbjct  26   AHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAY  85

Query  83   TVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
                GA + CGFT+  A  QP P DGA R++GYTH+GPCE+W+D  RV   DNCH  I  
Sbjct  86   KPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE  145

Query  142  KTY--NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
              +   +DYS+CKGTC L+WYWLG+R    +YSWQIYKACIPLS
Sbjct  146  TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PPTG_14254
Length=188

 Score = 169 bits (427),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 113/165 (68%), Gaps = 9/165 (5%)

Query  27   AHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
            AHQVV +P+PT+T  +  +K       PL+FLE +G++T E+F  ++ +NGYK+LRDFM+
Sbjct  22   AHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD  81

Query  82   ---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  137
               Y V +GAD  CG+T+    PQ  P DG MR+TGYTHDGPCE+++     L   NCHE
Sbjct  82   RAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHE  141

Query  138  TIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            +I  +T+ LDYS C  +C L WYWLGVR LK  YSWQ+YK CIP+
Sbjct  142  SIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PYAP_22278
Length=289

 Score = 171 bits (432),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 118/174 (68%), Gaps = 11/174 (6%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81
            +  AHQ V +P+PT+T +D++  + PL FLE QG +  +D  G+ R+ G KTLRD+M+  
Sbjct  21   SVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNK  80

Query  82   --YTV-ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQS--DNC  135
              Y + A GA + CG+TN N A QP P +G MRSTGYTHDGPCEVWLD+TRVL S   NC
Sbjct  81   ANYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNC  140

Query  136  HETIIGK--TYNLDYSSCKGTCTLRWYWLGVRFL-KNAYSWQIYKACIPLSASA  186
            H  +  K  +Y +D+S CKG C LRWYWLG R +    +SWQIYKAC+PL  S 
Sbjct  141  HRDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  194

>PITG_13520
Length=171

 Score = 167 bits (422),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 98/134 (73%), Gaps = 4/134 (3%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLLP P +TT DKDTKY PL FLE QG++T +DF  WR  NGYK+LRDFM+ 
Sbjct  23   PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR  82

Query  82   --YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P  GAMRSTGYTHDGPCEVWLD   VL  DNCHE 
Sbjct  83   AKYDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEK  142

Query  139  IIGKTYNLDYSSCK  152
              GK Y +DYSSCK
Sbjct  143  FPGKDYTVDYSSCK  156

>PHYCA_536934
Length=983

 Score = 180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 9/165 (5%)

Query  27   AHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
            AHQVV +PSPT+T  +  +        PL+FLE +GY T E+F  ++ +NGYK LRDFM+
Sbjct  38   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMD  97

Query  82   ---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  137
               Y V DGAD  CG+++ N  PQ  P DG MR++GYTHDGPCE+W+     L   NCHE
Sbjct  98   NAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHE  157

Query  138  TIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            +I  +T+ LDYS C  +C L WYWLGVR+LK  YSWQ+YK CIPL
Sbjct  158  SITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PYAP_22273
Length=268

 Score = 169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 113/183 (62%), Gaps = 10/183 (5%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            AHQ V  P   YT  D+ T + P   LE QGY+T +DFN +   NGYKTLRDFM+    Y
Sbjct  25   AHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAY  84

Query  83   TVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
                GA   CG+T+ NA PQP P +G  R++GYTH+GPCE+W+D   V    NCH  I  
Sbjct  85   KANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISE  144

Query  142  KTY--NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVF  199
            K +   +DYS+CKG C L+WYWLG+R +   YSWQIYKACIPL   A +     NK+ V 
Sbjct  145  KAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL---ADKNGGGNNKTKVP  201

Query  200  DPT  202
             PT
Sbjct  202  TPT  204

>PYAP_22279
Length=223

 Score = 167 bits (424),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 114/172 (66%), Gaps = 13/172 (8%)

Query  28   HQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YT  83
            HQ + +P+PT TTD       PL FLE QG +  +D  G+ R  G KTLRDFM+    Y 
Sbjct  22   HQRITIPAPTLTTDRNTATN-PLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  84   V-ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVL--QSDNCHETI  139
            V A GA + CG+T+ N A QP P +G MRSTGYTHDGPCEVWLD+TRVL   S +CH+ I
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  140  IGK---TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARR  188
             G+   +Y +D+S CKG C LRWYWL  R + + +SWQ+YK C+PL  SA R
Sbjct  141  -GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAAR  191

>PYIW_18791
Length=194

 Score = 162 bits (410),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 108/166 (65%), Gaps = 7/166 (4%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---  81
            A AHQ V +P P +T   K T +APL+FLE  G +T E  +G+ ++ GY TLR  M+   
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  82   -YTVADGAD-YYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
             Y     AD + CG+T+ +   Q  P D  MR+TGYTH GPCEVW+D  RV+  DNCHE 
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSA  184
            +   T  +DYS+CKG CT+RWYWLG+R+LK  +SWQ+YK CI L+ 
Sbjct  139  V-SNTTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTG  183

>PYIR_26546
Length=239

 Score = 157 bits (397),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 111/167 (66%), Gaps = 8/167 (5%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQ-GYETVEDFNGWRRNNGYKTLRDFME-  81
            TA AHQ+V+LP PT+T + K  ++ P+ +LEGQ G+    DFNG+  + G+KT+R+FM+ 
Sbjct  24   TARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDN  83

Query  82   ---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCH-  136
               Y     AD+ CG+T ++  PQP P +  +R+TGYTH+GPCE+WLD  +V    NCH 
Sbjct  84   DKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHY  143

Query  137  ETIIGKTYN-LDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            +   G  +  LD+SSC G CT+ WYW+G+R    + SWQIYK CIPL
Sbjct  144  DVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYSO_262732
Length=188

 Score = 154 bits (388),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 102/167 (61%), Gaps = 23/167 (14%)

Query  25   ATAHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRDF  79
            A AHQVV +PSPT+T  +           PL FLE QG++T               LRDF
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDF  64

Query  80   ME---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNC  135
            M+   YTV +GAD  CG+T+     Q  P DG MR++GYTHDGPCE+++     L   NC
Sbjct  65   MDNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNC  124

Query  136  HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            HE+I  +T+ LDYS C  +CTL WYWLGVRFL N YSWQ+YK CIP+
Sbjct  125  HESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PHYSO_341596
Length=231

 Score = 152 bits (385),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 90/126 (71%), Gaps = 12/126 (10%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLL        DKDTKY PL FLE QG+ET EDF  WR  NGYK+LRDFM+ 
Sbjct  23   PTADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK  74

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              YTV  GAD+ CGFT+    PQP P G AMRSTGYTHDGPCEVWLD T+VL+ DNCHE 
Sbjct  75   AKYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEK  134

Query  139  IIGKTY  144
              GK Y
Sbjct  135  FPGKDY  140

>PHYCA_14368
Length=219

 Score = 149 bits (377),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 99/166 (60%), Gaps = 47/166 (28%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME--  81
            TA AHQ+VLLP P +TT+DKDTKY PL FLE QG++T +DF  WR  N YK+LRDFM+  
Sbjct  24   TAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNA  83

Query  82   -YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETII  140
             YTV DGAD+ CGFT+                                            
Sbjct  84   KYTVTDGADFSCGFTDP-------------------------------------------  100

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
             K Y +DYSSCKGTCTLRWYWLG+RFLKN YSWQ+YKACIPLS S 
Sbjct  101  -KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSG  145

>PHYSO_527908
Length=174

 Score = 145 bits (365),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 100/154 (65%), Gaps = 9/154 (6%)

Query  24   TATAHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRD  78
            +  AHQVV +P+PT+T  +  +        PL FLEGQG+ T  +F  +  +NGYK+LRD
Sbjct  18   SVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRD  77

Query  79   FME---YTVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            FM+   Y+V  GAD  CG+T+ N  PQ  P DG MR++G+THD PCE+++     L   N
Sbjct  78   FMDNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPN  137

Query  135  CHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLK  168
            CHE+I  + + LDYS+C  +C L WYWLGVRF+K
Sbjct  138  CHESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PYU1_G001738
Length=226

 Score = 135 bits (339),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 91/161 (57%), Gaps = 5/161 (3%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            A   VL P P Y  D  + + AP+  LE QG +T  D + + +  GY  LR  ++    Y
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  83   TVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
             V   A   CG+T+     QP P   A  STGY  +GPCEVWLD  +V+   NCH    G
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  142  KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
              + LDYSSCKG+C LRWYWLG++ +   YSWQ+YK C+ L
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYRA_81105
Length=201

 Score = 133 bits (335),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 94/163 (58%), Gaps = 5/163 (3%)

Query  29   QVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84
            Q+VL P P +  D  D +   L +L+ QG  T  +  GW + +GY +LR  ++    Y V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143
             + A + CG T+     Q  P + + +S+GYT DGPCEVWLD T+     NCH       
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            + +DYS+C   C LRWYWLG+++++ AYSWQ+YK CI L   A
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199

>PPTG_17123
Length=201

 Score = 132 bits (332),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 95/162 (59%), Gaps = 5/162 (3%)

Query  29   QVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84
            QVVL P P +  D  D +   L +L+ QG  T  +   W + +GY +LR  ++    Y V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143
             + A + CG T+     QP P + + +++GYT DGPCEVWLD T+V    NCH       
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSAS  185
            + +DYSSC   CTL WYWLG+++++  YSWQ+YK C+ LS +
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198

>PHYSO_246676
Length=187

 Score = 131 bits (329),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 98/168 (58%), Gaps = 42/168 (25%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME-  81
            PTA AHQ+VLLP P +TT+DK TKY PL FLE QG++T EDF  WR+ NGY+TLRDFM+ 
Sbjct  6    PTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDK  65

Query  82   --YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  138
              Y V  GAD+ CGFT+    PQP P+G  MRSTGYTHDG                 H +
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG---------------LVHAS  110

Query  139  IIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            ++                       +  +KN+YSW++YKACIPLS S 
Sbjct  111  LV-----------------------LDGMKNSYSWKVYKACIPLSGSG  135

>PYVX_18175
Length=147

 Score = 129 bits (323),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 94/177 (53%), Gaps = 56/177 (32%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEY  82
            P A AHQ V+LP P++TT D+D  Y+PL FLE QG++T EDF+ WRR NGYKTLR F   
Sbjct  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSF---  79

Query  83   TVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142
                                      M S  YT                           
Sbjct  80   --------------------------MDSGKYTDTA------------------------  89

Query  143  TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVF  199
               +DYSSCKG+CTL WYW+GVR+LK AYSWQ+YK C+PLS SAR LE A+N+S + 
Sbjct  90   ---IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALI  143

>PHYSO_353401
Length=146

 Score = 128 bits (322),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 88/142 (62%), Gaps = 5/142 (4%)

Query  50   LTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAPQPNP  105
            L +L+ QG  T  +   W + +GY +LR  ++    Y V + A + CG T+     QP P
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  106  -DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGV  164
             + + +++GYT DGPCEVWLD T+V    NCH       + +DYS+C  +CTL WYWLG+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  165  RFLKNAYSWQIYKACIPLSASA  186
            ++++ AYSWQ+YK C+ LS +A
Sbjct  123  KYVEGAYSWQVYKNCVALSKTA  144

>HYAP_07096
Length=251

 Score = 131 bits (329),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 97/160 (61%), Gaps = 6/160 (4%)

Query  29   QVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84
            QVVL PSP +  DD   +   L +L+ QG +T  +   W++ +GY +LR  ++    Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  85   ADGADYYCGFTNVNAAP-QPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142
            +  A + CGFT++ +   Q  P +G + S+GYT DGPCEVW D T+V    NC       
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  143  TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
             + +DYSSC  +CTLRWYWLG++++   YSWQ+YK CI L
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PHYCA_537323
Length=200

 Score = 129 bits (325),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 94/163 (58%), Gaps = 5/163 (3%)

Query  29   QVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84
            QVV  P P +  D  D +   L +L+ QG  T  +   W   +GY +LR  ++    Y V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143
             + A + CG T+     QP P + + +++GYT DGPCEVWLD T+V    NCH       
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            + +DYSSC  +CTL WYWLG+++++  YSWQ+YK C+ L  +A
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198

>PITG_18452
Length=856

 Score = 134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 94/160 (59%), Gaps = 5/160 (3%)

Query  29   QVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84
            Q+VL P P +  D  D +   L +L+ QG  T  +   W +  GY +LR  ++    Y V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143
             + A + CG T+     QP P + + +++GYT DGPCE+WLD T+V    NCH       
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
            + +DYSSC G+C L WYWLG+++++  YSWQ+YK C+ LS
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

>PHYSO_340369
Length=200

 Score = 124 bits (312),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 92/161 (57%), Gaps = 15/161 (9%)

Query  27   AHQVVLLPSPtyttddkdtky-----APLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
            A+QVV +P+PT+T  +  T        PL + E QG+ T  +F  W+  NG+KTLRDFM 
Sbjct  24   ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFM-  82

Query  82   YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
                D  +Y     +V +  Q   D  MR+ GYT DGPCE+WLD+T    S +C  ++  
Sbjct  83   ----DNGNY-----SVTSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPN  133

Query  142  KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
             TY LDYS C  +C + WY LGV      YSW++YK CIPL
Sbjct  134  MTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PYIW_18788
Length=244

 Score = 122 bits (305),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 90/163 (55%), Gaps = 6/163 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82
            A+  V  P P +  D      A +  LE Q   T  D  G+ +  GY +LR  ++    Y
Sbjct  26   ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  85

Query  83   TVADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG  141
             V   + + CG+T+     QP P +G +R TGY  DGPCE+W+D  ++L S NC +   G
Sbjct  86   DVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145

Query  142  KTYNLDYSSCKGTCTLRWYWLGV-RFLKNAYSWQIYKACIPLS  183
             +  LDYSSCKG CTLRWY L V +    +YSW++YK C+ LS
Sbjct  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

>PYAP_18131
Length=226

 Score = 117 bits (294),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 10/118 (8%)

Query  76   LRDFMEYTV-ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSD  133
            + D   Y V A GA + CG T+ N   QP P +G MRSTG+THDG   VW+D+TRVL S 
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  134  --NCHETIIGK---TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
              NCH++I G+   +Y +D+S CKG C +RWYWLG+R L   +SWQ+YKACIP+ AS 
Sbjct  59   LGNCHKSI-GQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASG  115

>PYVX_18179
Length=147

 Score = 110 bits (275),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 87/175 (50%), Gaps = 55/175 (31%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYT  83
             A AHQ V+LP PT+T++D D  Y+PL FLE QG+ T EDFN WR  N            
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSAN------------  71

Query  84   VADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143
                                         GY          D+ R        + + GK 
Sbjct  72   -----------------------------GY----------DTLRAFMD----QAVSGKD  88

Query  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198
              +DYSSC G+CTL W+W+GVR+LK AYSWQ+YK C+PLS SAR LE AAN S +
Sbjct  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143

>PHYSO_342364
Length=194

 Score = 106 bits (264),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 12/140 (9%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDG--AMRST  112
            G   ++V+ FN  + ++ YK LR  ++ T   G +  CG+TN N  PQP P    A+ S 
Sbjct  57   GNTQKSVQVFNSLKTSHNYKDLRTLLDNTAVYGPN--CGYTNPNGTPQPIPTNGKAIFSR  114

Query  113  GYTHDGPCEVWLDSTRVLQSDNC-----HETIIGKT-YNLDYSSC--KGTCTLRWYWLGV  164
            G  H GPCE+WLD  +V+ +D+C     H  +  KT + +DYS C  KG C +R+YWLG 
Sbjct  115  GLIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGF  174

Query  165  RFLKNAYSWQIYKACIPLSA  184
            + L     WQ YK CIPL A
Sbjct  175  QALGKKTVWQTYKNCIPLKA  194

>PYU1_G007476
Length=195

 Score = 106 bits (264),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 73/136 (54%), Gaps = 14/136 (10%)

Query  61   VEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG----AMRSTGYT  115
            + DF    +  GYKTLR F+E   A      CG+T  N  P+  P DG    A  + G+ 
Sbjct  63   MNDFARISKQKGYKTLRSFLENKGAS-----CGYTEPNTTPRAIPRDGKVIFAHSNVGFV  117

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            H GPCE+WLD+  +L  DNC +   G      +D+SSCKGTC LR YWLG  F      W
Sbjct  118  HPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQGQRW  175

Query  174  QIYKACIPLSASARRL  189
            Q YK C+P+    +RL
Sbjct  176  QTYKYCVPVKKGGKRL  191

>PYIR_16435
Length=304

 Score = 104 bits (259),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 72/124 (58%), Gaps = 11/124 (9%)

Query  63   DFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            +F    +  GY TLR ++E          CG TN +A P+  P+ +    S    H GPC
Sbjct  66   NFATVSKEKGYSTLRSYIE-----DKGTLCGRTNPDATPKAIPSDNTVKFSRAIVHPGPC  120

Query  121  EVWLDSTRVLQSDNCHETIIGK--TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            E+WLD  RV+Q DNC  T   K  T+ +D+SSCKG+C LRW+WLG++   +   WQ+YK 
Sbjct  121  ELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKN  178

Query  179  CIPL  182
            C+PL
Sbjct  179  CVPL  182

>PHYRA_78626
Length=473

 Score = 105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 83/163 (51%), Gaps = 46/163 (28%)

Query  25   ATAHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRDF  79
            A AHQVV +PSPT+T  +  +        PL+FLE +G+ET E+F  ++ +NGY +LRDF
Sbjct  277  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  336

Query  80   MEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
            +     D A Y    + +N                                    CHE+I
Sbjct  337  L-----DKAKYKLALSYLN------------------------------------CHESI  355

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
              +T+ LDYS C  +C L WYWLG R+LK +YSWQ+YK CI L
Sbjct  356  TDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PHYRA_78625
Length=434

 Score = 105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 83/163 (51%), Gaps = 46/163 (28%)

Query  25   ATAHQVVLLPSPtyttddkdtkyA-----PLTFLEGQGYETVEDFNGWRRNNGYKTLRDF  79
            A AHQVV +PSPT+T  +  +        PL+FLE +G+ET E+F  ++ +NGY +LRDF
Sbjct  238  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  297

Query  80   MEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETI  139
            +     D A Y    + +N                                    CHE+I
Sbjct  298  L-----DKAKYKLALSYLN------------------------------------CHESI  316

Query  140  IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
              +T+ LDYS C  +C L WYWLG R+LK +YSWQ+YK CI L
Sbjct  317  TDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PYIR_16444
Length=182

 Score = 98.6 bits (244),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 74/132 (56%), Gaps = 11/132 (8%)

Query  58   YETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYT  115
            ++  ++F    +  G+ TLR ++E   A      CG TN  A P+P P DG +  S    
Sbjct  58   WKDPKNFAKVAKQKGFPTLRSYIENKGA-----ICGKTNAKATPKPIPSDGKVHFSRAIV  112

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIGK--TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            H GPCE+WLD+ RV Q+DNC      K   + +D+SSCKG C LR++WLG++       W
Sbjct  113  HPGPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRW  170

Query  174  QIYKACIPLSAS  185
            Q+YK C+P+   
Sbjct  171  QVYKNCVPVKGK  182

>PYAP_24689
Length=252

 Score = 99.8 bits (247),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 79/150 (53%), Gaps = 16/150 (11%)

Query  49   PLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG  107
            P T   G  Y+ V      R+ +G KTLR F+E          CG TN NA  +P P DG
Sbjct  55   PGTIRTGAQYDAV------RKKHGVKTLRAFLESKGP-----VCGSTNPNAKRKPIPRDG  103

Query  108  AMR-STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVR  165
             ++  +   H GPCE+W D+TRV    +C++     T + +DYS C+G C LR+YWLG++
Sbjct  104  LIKFGSSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ  163

Query  166  FLKNAYSWQIYKACIPLSASARRLEVAANK  195
                   WQ YK C+PL    R LE   ++
Sbjct  164  --DGGKRWQSYKNCVPLGNDKRMLEEGGDE  191

>PHYSO_438103
Length=238

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 88/176 (50%), Gaps = 18/176 (10%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFL------EGQGYETVEDFNGWRRNNGYKTL  76
            P+A AH  +L+P   +T          +  +      +G    +VE F   +  N +K L
Sbjct  18   PSADAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDL  77

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   G D  CGFT+ N  PQP P DG A  S    H GPCE+WLD+T+VL  D+
Sbjct  78   KTLMDDTSVYGQD--CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYEDD  135

Query  135  C------HETIIGKTYNLDYSSCK-GTCT-LRWYWLGVRFLKNAYSWQIYKACIPL  182
            C          I   + +DYSSC  G C  +R+YWL  + L +   WQ YK CIPL
Sbjct  136  CFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PYIR_16443
Length=275

 Score = 99.0 bits (245),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 12/123 (10%)

Query  62   EDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYTHDGP  119
            ++F    +  G++TLR ++E   A      CG TN NA+P+  P D  ++ S    H GP
Sbjct  62   KNFATVSKQKGFETLRSYIEDKGA-----LCGRTNPNASPKAIPSDSVVKFSRAIVHPGP  116

Query  120  CEVWLDSTRVLQSDNCHETIIGK--TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIY-  176
            CE+WLD  RV+Q DNC  T   K  T+ +D+SSCKG+C LRW+WLG++   +   WQ+Y 
Sbjct  117  CEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYS  174

Query  177  KAC  179
            K+C
Sbjct  175  KSC  177

>PHYRA_78689
Length=296

 Score = 99.0 bits (245),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 88/176 (50%), Gaps = 18/176 (10%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFL------EGQGYETVEDFNGWRRNNGYKTL  76
            P+A AH  +L+P   +           +  +      +G   ++V+ F   +  N +K L
Sbjct  19   PSADAHGYMLIPESQFKGSASSAWVVQIDPVWTSDKWDGNNPQSVDTFKSLKTANNFKDL  78

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   GAD  CGFT+ +  PQP P DG A  S    H GPCE+WLD T+VL  D+
Sbjct  79   KTLMDDTSVYGAD--CGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDDTKVLYEDD  136

Query  135  C------HETIIGKTYNLDYSSC-KGTCT-LRWYWLGVRFLKNAYSWQIYKACIPL  182
            C          I   + +DYSSC  G C  +R+YWL  + L +   WQ YK CIPL
Sbjct  137  CFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>PHYRA_74651
Length=344

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 13/132 (10%)

Query  64   FNGWRRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            +   + +NGY  +R  ++  T   GAD  CGFT+ NA P+  P+   A  S G  H GPC
Sbjct  69   YTSLKESNGYSDIRTLLDSDTSLYGAD--CGFTDPNATPKDPPSTGDATFSRGMVHAGPC  126

Query  121  EVWLDSTRVLQSDNCHETIIGKTYN-------LDYSSC-KGTCTLRWYWLGVRFLKNAYS  172
            E+WLD T+VL +DNC       T         +DYSSC  G CTLR+YWL  + L ++  
Sbjct  127  EIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSSTV  186

Query  173  WQIYKACIPLSA  184
            WQ+YK C+PL+ 
Sbjct  187  WQVYKNCVPLTG  198

>PHYCA_127270
Length=279

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 77/153 (50%), Gaps = 12/153 (8%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G   ++V+ F   +  N +K L+  M+ T   GAD  CGFT+ N  PQP P DG A  S
Sbjct  56   DGNNPQSVDTFKSLKAANNFKDLKTLMDDTSVYGAD--CGFTDPNGTPQPIPTDGKATFS  113

Query  112  TGYTHDGPCEVWLDSTRVLQSDNC------HETIIGKTYNLDYSSC-KGTCT-LRWYWLG  163
                H GPCE+WLD  +VL  D+C          I   + +DYSSC  G C  +R+YWL 
Sbjct  114  RALVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLA  173

Query  164  VRFLKNAYSWQIYKACIPLSASARRLEVAANKS  196
             + L     WQ YK CIPL  S         KS
Sbjct  174  FQGLSKKTVWQSYKDCIPLKGSGGGGSSTTQKS  206

>PYIW_19151
Length=248

 Score = 96.7 bits (239),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 79/129 (61%), Gaps = 11/129 (9%)

Query  62   EDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYTHDGP  119
            ++F    +  G+ TLR ++E   A      CGFT+   +P+  P D  +R S    H GP
Sbjct  59   KNFAAAAKEKGFSTLRSYLEDKGA-----VCGFTDPKVSPRAIPADRTIRFSRDIPHPGP  113

Query  120  CEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYK  177
            CE+++D TRV Q+D+C     G   ++++D+S CKG C +R+YWLG++   +   WQ+YK
Sbjct  114  CELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQVYK  171

Query  178  ACIPLSASA  186
            +C+P+S+SA
Sbjct  172  SCVPVSSSA  180

>PHYSO_533903
Length=208

 Score = 94.7 bits (234),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 80/140 (57%), Gaps = 13/140 (9%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRST  112
            G   ++VE F   +  N +K L+  ++ T   G D  CGFT+ N  PQP P DG A+ S 
Sbjct  58   GNTAKSVEVFKSLKVANNFKDLKTMLDDTSLYGPD--CGFTDPNGTPQPIPTDGKAVFSR  115

Query  113  GYTHDGPCEVWLDSTRVLQSDNC-----HETIIGKT-YNLDYSSCK--GTCTLRWYWLGV  164
            G  H GPCE WLD  +VL +D+C     H  +  KT + +DYSSC+  G   +R+YWLG 
Sbjct  116  GLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGF  175

Query  165  RFLKNAYS-WQIYKACIPLS  183
            + L +  + WQ YK CIPL 
Sbjct  176  QALDDKKTVWQTYKDCIPLQ  195

>PYU1_G014690
Length=295

 Score = 96.3 bits (238),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 11/124 (9%)

Query  63   DFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            +F    +  G+ TLR ++E   A      CG T+ NA P+  P+ +    S    H GPC
Sbjct  62   NFAKVSKEKGFDTLRSYIEDKGA-----LCGKTDPNATPKAIPSDNKVHFSRPIVHPGPC  116

Query  121  EVWLDSTRVLQSDNCHETIIGK--TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            E+WLD  RV+Q D+C  T   +   +N+D+SSCK  C LR++WLG++   +   WQ+YK 
Sbjct  117  EIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKN  174

Query  179  CIPL  182
            C+PL
Sbjct  175  CVPL  178

>PHYCA_130365
Length=266

 Score = 95.9 bits (237),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 69/130 (53%), Gaps = 12/130 (9%)

Query  64   FNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCE  121
            F     +N YK +R  M+     G D  CGFT+ N  P  P  DG A  S G  H GPCE
Sbjct  66   FKELAASNNYKDVRSMMDGNSVYGED--CGFTDPNGTPVDPPTDGTATFSRGIVHAGPCE  123

Query  122  VWLDSTRVLQSDNCHETIIGKTYN-------LDYSSC-KGTCTLRWYWLGVRFLKNAYSW  173
            +WLD   VLQ+D+C       T +       +DYSSC  G C LR+YWLG++ L     W
Sbjct  124  IWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVW  183

Query  174  QIYKACIPLS  183
            Q YK CIPL+
Sbjct  184  QAYKNCIPLT  193

>PHYSO_340333
Length=284

 Score = 95.9 bits (237),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 85/176 (48%), Gaps = 18/176 (10%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFL------EGQGYETVEDFNGWRRNNGYKTL  76
            P+A AH  +L+P   +           +  +      +G    +V+ F   +  N +K L
Sbjct  19   PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   GAD  CGFT+ N  PQP P DG A  S    H GPCE+WLD  +VL  D+
Sbjct  79   KTLMDDTSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLYEDD  136

Query  135  C------HETIIGKTYNLDYSSC-KGTCT-LRWYWLGVRFLKNAYSWQIYKACIPL  182
            C          I   + +DYSSC  G C  +R+YWL  + +     WQ YK CIPL
Sbjct  137  CFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PYAP_18711
Length=210

 Score = 94.4 bits (233),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 75/141 (53%), Gaps = 10/141 (7%)

Query  58   YETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYT  115
            + T   ++  R+  G K LR F+E    +     CG TN NA  +P P DG ++  +   
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLESKGPE-----CGRTNPNAKRKPIPSDGLIKFGSSME  109

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQ  174
            H GPCEVW D+T V    +C +     T + +DYS CKG C LR+YWLG++       WQ
Sbjct  110  HPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQ  167

Query  175  IYKACIPLSASARRLEVAANK  195
             YK C+P+ ++ +   + A +
Sbjct  168  SYKNCVPIGSATKSRSIDAEE  188

>PYIW_18792
Length=125

 Score = 91.7 bits (226),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 4/100 (4%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVA-  85
            AHQ V LP+PT+T   +  ++ PL FLEGQGY+   DF  + ++ GYK LR FM+   A 
Sbjct  23   AHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAY  82

Query  86   --DGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEV  122
              DG ++ CG++++   PQP P  GA+RSTGYTHDGP  +
Sbjct  83   KVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PHYSO_340332
Length=295

 Score = 95.9 bits (237),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 85/176 (48%), Gaps = 18/176 (10%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFL------EGQGYETVEDFNGWRRNNGYKTL  76
            P+A AH  +L+P   +           +  +      +G    +V+ F   +  N +K L
Sbjct  19   PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   GAD  CGFT+ N  PQP P DG A  S    H GPCE+WLD  +VL  D+
Sbjct  79   KTLMDDTSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLYEDD  136

Query  135  C------HETIIGKTYNLDYSSC-KGTCT-LRWYWLGVRFLKNAYSWQIYKACIPL  182
            C          I   + +DYSSC  G C  +R+YWL  + +     WQ YK CIPL
Sbjct  137  CFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYSO_533682
Length=278

 Score = 95.5 bits (236),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 76/139 (55%), Gaps = 12/139 (9%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G    +VE F  ++  N +K L+  M+ T   G D  CGFT+ N  PQP P DG A  S
Sbjct  56   DGNNPGSVEVFTSFKSVNNFKDLKTLMDDTSVYGQD--CGFTDPNGTPQPIPTDGKATFS  113

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETI------IGKTYNLDYSSC-KGTCT-LRWYWLG  163
             G  H GPCE+WLD  +VL  D+C+         +  T+ +DYSSC  G C  +R Y LG
Sbjct  114  RGLIHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLG  173

Query  164  VRFLKNAYSWQIYKACIPL  182
             + L +   WQ YK CIPL
Sbjct  174  FQGLVDKTVWQSYKNCIPL  192

>PPTG_14221
Length=275

 Score = 94.7 bits (234),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 72/139 (52%), Gaps = 12/139 (9%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G   ++V+ F   +  N +K L+  M+ T   GAD  CGFTN N  PQP P DG A  S
Sbjct  56   DGNNPKSVDTFKSLKAANNFKDLKTLMDDTSVYGAD--CGFTNPNGTPQPIPTDGKATFS  113

Query  112  TGYTHDGPCEVWLDSTRVLQSDNC------HETIIGKTYNLDYSSC-KGTCT-LRWYWLG  163
                H GPC +WLD   VL  D+C          I   + +DYSSC  G C  +R+YWL 
Sbjct  114  RALVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLA  173

Query  164  VRFLKNAYSWQIYKACIPL  182
             + L     WQ YK CIPL
Sbjct  174  FQGLNKKTVWQSYKDCIPL  192

>PHYKE_6001
Length=289

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 86/180 (48%), Gaps = 18/180 (10%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFL------EGQGYETVEDFNGWRRNNGYKTL  76
            P A AH  +L+P   +           +  +      +G   ++V  FN  ++ N Y  L
Sbjct  19   PRADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTAFNALKKANNYVDL  78

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   GAD  CGFT+ N  PQP P DG A  S    H GPCE+WLD   V   ++
Sbjct  79   KTLMDDTSVYGAD--CGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDDKMVFSDED  136

Query  135  CH-----ETI-IGKTYNLDYSSCKGTC--TLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            C+     E + +   + +DYSSC G     +R+YWL  + +     WQ YK CIPL  S 
Sbjct  137  CYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPLEGSG  196

>PYU1_G005324
Length=191

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 74/141 (52%), Gaps = 16/141 (11%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM  109
            TF  G  Y  V          GYK L+ F+     D     CG T  NA  +  P DG +
Sbjct  54   TFRTGAQYAAVAP------KKGYKDLKSFL-----DSKGPTCGNTLSNAKAKAIPKDGML  102

Query  110  R-STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFL  167
            + ++   H GPCE+WL +TR   +D+C +T    T + +D+S+CKG C LR+YWLG++  
Sbjct  103  KFASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--  160

Query  168  KNAYSWQIYKACIPLSASARR  188
                 WQ YK C+PL +S  R
Sbjct  161  DGGKRWQSYKNCVPLKSSKLR  181

>PYU1_G005326
Length=191

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 74/141 (52%), Gaps = 16/141 (11%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM  109
            TF  G  Y  V          GYK L+ F+     D     CG T  NA  +  P DG +
Sbjct  54   TFRTGAQYAAVAP------KKGYKDLKSFL-----DSKGPTCGNTLSNAKAKAIPKDGML  102

Query  110  R-STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFL  167
            + ++   H GPCE+WL +TR   +D+C +T    T + +D+S+CKG C LR+YWLG++  
Sbjct  103  KFASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--  160

Query  168  KNAYSWQIYKACIPLSASARR  188
                 WQ YK C+PL +S  R
Sbjct  161  DGGKRWQSYKNCVPLKSSKLR  181

>PYU1_G005328
Length=191

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 74/141 (52%), Gaps = 16/141 (11%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM  109
            TF  G  Y  V          GYK L+ F+     D     CG T  NA  +  P DG +
Sbjct  54   TFRTGAQYAAVAP------KKGYKDLKSFL-----DSKGPTCGNTLSNAKAKAIPKDGML  102

Query  110  R-STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFL  167
            + ++   H GPCE+WL +TR   +D+C +T    T + +D+S+CKG C LR+YWLG++  
Sbjct  103  KFASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--  160

Query  168  KNAYSWQIYKACIPLSASARR  188
                 WQ YK C+PL +S  R
Sbjct  161  DGGKRWQSYKNCVPLKSSKLR  181

>PYAP_18709
Length=235

 Score = 92.8 bits (229),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 70/115 (61%), Gaps = 10/115 (9%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYTHDGPCEVWLDSTRV  129
            G+K LR F+E          CG +  NA+P+P P DG ++ ++   H GPCEVWLD+TR 
Sbjct  68   GFKDLRSFLEDKGP-----TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRA  122

Query  130  LQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
              +D+C +     T + +D+ +CKG+C LR+YWLG++       WQ YK CIPL+
Sbjct  123  FHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PITG_05271
Length=278

 Score = 92.8 bits (229),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 73/143 (51%), Gaps = 12/143 (8%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G    +V  F   +  N +K L+  M+ T   GAD  CGFT+ N   QP P DG A  S
Sbjct  56   DGNKPGSVNAFKALKTANKFKDLKTLMDDTSVYGAD--CGFTDPNGKAQPIPKDGKATFS  113

Query  112  TGYTHDGPCEVWLDSTRVLQSDNC------HETIIGKTYNLDYSSC-KGTCT-LRWYWLG  163
                H GPCE+WLD T+VL  D+C          I   + +DYSSC  G C  +R+YWL 
Sbjct  114  RALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLA  173

Query  164  VRFLKNAYSWQIYKACIPLSASA  186
             + +     WQ YK CIPL  S 
Sbjct  174  FQGVDGKTVWQSYKDCIPLEGSG  196

>PPTG_04618
Length=326

 Score = 93.6 bits (231),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 67/127 (53%), Gaps = 12/127 (9%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCEVWLDST  127
             N YK +R  M+     G D  CGFT+    P +P  DG A  S G  H GPCE+WLD  
Sbjct  73   KNNYKDVRSLMDGNPVYGED--CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDK  130

Query  128  RVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIYKAC  179
             VLQ+D+C        +  I     +DYSSC  G C LR+YWL ++ L     WQ YK C
Sbjct  131  MVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNC  190

Query  180  IPLSASA  186
            IPL+  A
Sbjct  191  IPLTGPA  197

>PYIW_27477
Length=180

 Score = 90.5 bits (223),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 68/112 (61%), Gaps = 11/112 (10%)

Query  69   RNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYTHDGPCEVWLDS  126
            +  G++TLR ++E   A      CG T+ NA  +  P D  ++ S    H GPCE+W+D 
Sbjct  46   KEKGFETLRSYIEDKGAK-----CGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCELWIDD  100

Query  127  TRVLQSDNCHETIIGK--TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIY  176
            TRV+Q DNC +T   K  T+ +D+S+CKG C LRW+WLG++   +   WQ+Y
Sbjct  101  TRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PHYCA_534296
Length=309

 Score = 93.2 bits (230),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 74/139 (53%), Gaps = 12/139 (9%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G    +VE F   +  N +K L+  M+ T   GAD  CGFTN +   QP P DG A  S
Sbjct  30   DGNNAGSVETFKSLKSANNFKDLKTLMDDTSVYGAD--CGFTNPSGTAQPIPTDGKATFS  87

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETI------IGKTYNLDYSSC-KGTCT-LRWYWLG  163
                H GPCE+WLD T+VL  D+C+         I   + +DYSSC  G C  +R+YWL 
Sbjct  88   RALVHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLA  147

Query  164  VRFLKNAYSWQIYKACIPL  182
             + +     WQ YK CIPL
Sbjct  148  FQGVDGKTVWQSYKDCIPL  166

>PITG_04948
Length=232

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWL  124
            + +N  K +R  ++  T   GAD  CG+TN + +P+  P DG A  S G  H GPCE+WL
Sbjct  71   KASNNAKDIRTLLDSDTSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWL  128

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  I     +DYSSC  G C LR+YWL ++ L     WQ+Y
Sbjct  129  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVY  188

Query  177  KACIPLSASA  186
            K CIPLS  A
Sbjct  189  KNCIPLSGPA  198

>PHYRA_73607
Length=343

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 75/134 (56%), Gaps = 13/134 (10%)

Query  64   FNGWRRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            ++  + +NGY  +R  ++  T   GAD  CGFTN +A  +  P    A  S G  H GPC
Sbjct  69   YSSLKSSNGYSDIRTLLDSDTSLYGAD--CGFTNPDATAKDPPTTGDATFSRGMVHVGPC  126

Query  121  EVWLDSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYS  172
            E+WLD T+VL +DNC       T +       +DYSSC  + C LR+YWL  + + ++  
Sbjct  127  EIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMV  186

Query  173  WQIYKACIPLSASA  186
            WQ+YK C+PL+  A
Sbjct  187  WQVYKNCVPLTGPA  200

>PITG_04949
Length=337

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 68/126 (54%), Gaps = 12/126 (10%)

Query  71   NGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCEVWLDSTR  128
            N +K +R  M+     G +  CGFT+    P +P  DG A  S G  H GPCE+WLD   
Sbjct  74   NNFKDVRSLMDGNPVFGEE--CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKM  131

Query  129  VLQSDNCH-------ETIIGKTYNLDYSSCK-GTCTLRWYWLGVRFLKNAYSWQIYKACI  180
            VLQ+D+C        +  I     +DYSSC  G C LR+YWL ++ LK    WQ YK CI
Sbjct  132  VLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCI  191

Query  181  PLSASA  186
            PL+  A
Sbjct  192  PLTGPA  197

>PHALS_03176
Length=207

 Score = 90.1 bits (222),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 13/144 (9%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRST  112
            G   ++V+ F   +  N +K L+  M+ T A GA   CGF++    PQP P DG A  S 
Sbjct  57   GNTQKSVKTFQKLKAANKFKDLKTLMD-TSAFGAK--CGFSDPKGKPQPIPKDGKATFSR  113

Query  113  GYTHDGPCEVWLDSTRVLQSDNCH------ETIIGKTYNLDYSSC-KGTCT-LRWYWLGV  164
               H GPCE+WLD+ +VL  D+C+      +  I   + +DYSSC  G C  +R+YWL  
Sbjct  114  AIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAF  173

Query  165  RFLKNAYSWQIYKACIPLSASARR  188
            + +     WQ YK CIPL  S+ +
Sbjct  174  QGVNGKTVWQSYKNCIPLQGSSGK  197

>PPTG_04622
Length=273

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 71/137 (52%), Gaps = 17/137 (12%)

Query  64   FNGWRRNNGYKTLRDFMEYTVADGADYY---CGFTNVNAAPQ--PNPDGAMRSTGYTHDG  118
            +   + +NGY  +R  ++       D Y   CGFT+ +A P+  P    A  S G  H G
Sbjct  69   YTSLKESNGYSDIRALLD----SDTDLYGANCGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  119  PCEVWLDSTRVLQSDNCHETIIGKTYN-------LDYSSCK-GTCTLRWYWLGVRFLKNA  170
            PCE+WLD T VL +D+C       T +       +DYSSC  G C LR+YWL  + + + 
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  171  YSWQIYKACIPLSASAR  187
              WQ+YK C+PL+  A 
Sbjct  185  MVWQVYKDCVPLTGPAE  201

>PYU1_G005325
Length=207

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 71/135 (53%), Gaps = 16/135 (12%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM  109
            TF  G  Y  V          GYK L+ F+     D     CG T  NA  +  P DG +
Sbjct  54   TFRTGAQYAAVAP------KKGYKDLKSFL-----DSKGPTCGNTLSNAKAKAIPKDGML  102

Query  110  R-STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFL  167
            + ++   H GPCE+WL +TR   +D+C +T    T + +D+S+CKG C LR+YWLG++  
Sbjct  103  KFASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--  160

Query  168  KNAYSWQIYKACIPL  182
                 WQ YK CIPL
Sbjct  161  DGGKRWQSYKNCIPL  175

>PYAR_14260
Length=212

 Score = 89.4 bits (220),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 64/121 (53%), Gaps = 10/121 (8%)

Query  71   NGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYT--HDGPCEVWLDSTR  128
             G+K LR F+E          CG +  +A P+P P   M     T  H GPCE+WLD T 
Sbjct  44   KGFKNLRSFLESKGP-----TCGNSLSSAKPKPIPSDGMVKFASTLEHPGPCEIWLDETM  98

Query  129  VLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
               SD+C +     T   +++S+CKG+C LR+YWLG++   +   WQ YK C+PL     
Sbjct  99   AFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPLGGGKS  156

Query  188  R  188
            R
Sbjct  157  R  157

>PHYSO_483955
Length=320

 Score = 91.7 bits (226),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 66/126 (52%), Gaps = 12/126 (10%)

Query  71   NGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCEVWLDSTR  128
            N YK +R  M+     G D  CGFT+    P  P  DG A  S G  H GPCE+WLD   
Sbjct  74   NNYKDVRSLMDGNPVYGED--CGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWLDDKM  131

Query  129  VLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIYKACI  180
            VLQ+D+C        +  I     +DYSSC  G C LR+YWL ++ L     WQ YK CI
Sbjct  132  VLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCI  191

Query  181  PLSASA  186
            PL+  A
Sbjct  192  PLTGPA  197

>PYAR_14256
Length=199

 Score = 89.0 bits (219),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 72/140 (51%), Gaps = 15/140 (11%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMR  110
            TF  G  Y  V        + G+K LR F+E          CG T  NA P+P     ++
Sbjct  50   TFRTGAQYAAVAP------DKGFKNLRAFLE-----DKGPTCGNTLPNAKPKPXXXXLIK  98

Query  111  -STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFLK  168
             ++   H GPCE+WLD +     D+C +     T + +D+S+CKG+C LR+YWLG++   
Sbjct  99   LASTIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--N  156

Query  169  NAYSWQIYKACIPLSASARR  188
            +   WQ YK CIPL  +  R
Sbjct  157  SGKRWQSYKNCIPLGGAQSR  176

>PHYKE_6002
Length=197

 Score = 89.0 bits (219),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 87/165 (53%), Gaps = 15/165 (9%)

Query  23   PTATAHQVVLLPSPtyttddkdt---kyAPL---TFLEGQGYETVEDFNGWRRNNGYKTL  76
            P   AH  +L+P   +  D       + AP+   +  +G   ++V  F+  ++ N +  L
Sbjct  19   PQVNAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDL  78

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   GAD  CGFT+ +  PQP P DG A  S    H GPCE+WLDST+    DN
Sbjct  79   KTLMDDTSVYGAD--CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFSKDN  136

Query  135  CHETIIGKTYNLDYSSC-KGTCT-LRWYWLGVRFLKNAYSWQIYK  177
            C +    +T+ +DYSSC  G C  +R+YWL  + L +   WQ Y+
Sbjct  137  CADM---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PPTG_04619
Length=276

 Score = 90.1 bits (222),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 71/130 (55%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWL  124
            + +N  K +R  ++  T   GAD  CG+TN +  P+  P DG A  S G  H GPCE+WL
Sbjct  71   KASNNAKDIRTLLDSDTSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWL  128

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  I     +DYSSC  G C  R+YWL ++ L     WQ+Y
Sbjct  129  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVY  188

Query  177  KACIPLSASA  186
            K CIPLS  A
Sbjct  189  KNCIPLSGPA  198

>PYU1_G005323
Length=251

 Score = 89.4 bits (220),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 16/136 (12%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM  109
            TF  G  Y  V          GYK L+ F+E          CG +  +A  +P P DG +
Sbjct  53   TFRTGAQYAAVAP------GKGYKDLKSFLE-----DKGPVCGNSLPDAKAKPIPSDGVI  101

Query  110  R-STGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFL  167
            + ++   H GPCEVW D  R    D+C +T    T + +D+S+CKG+C LR+YWLG++  
Sbjct  102  KLASTIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--  159

Query  168  KNAYSWQIYKACIPLS  183
                 WQ YK CIPL+
Sbjct  160  DGGKRWQSYKNCIPLT  175

>PHYKE_7717
Length=568

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)

Query  141  GKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSA  184
            GK Y +DYS+CKGTCTLRWYWLGVRFLKNAYSWQ+YKACIPL+ 
Sbjct  4    GKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLTG  47

>PHYRA_85794
Length=230

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 69/144 (48%), Gaps = 24/144 (17%)

Query  73   YKTLRDFMEYTVAD------GADYYCGFTNVNAAPQPNPDGAMR------STGYTHDGPC  120
            YKT+      +V D      GAD  CGFT  +  PQP P             GYTH GPC
Sbjct  62   YKTMAAEKGVSVRDVVLDMVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPC  121

Query  121  EVWLDSTRVLQSDNCH--------ETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYS  172
            E+++D   VL SDNC         ++ I     +DYSSC G CT   YWLG    +NA  
Sbjct  122  ELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-Q  177

Query  173  WQIYKACIPLSASARRLEVAANKS  196
            WQ Y  C+PLS +    +  A+ S
Sbjct  178  WQAYINCVPLSGTGETTQTQASGS  201

>PHYRA_77971
Length=230

 Score = 89.0 bits (219),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 69/144 (48%), Gaps = 24/144 (17%)

Query  73   YKTLRDFMEYTVAD------GADYYCGFTNVNAAPQPNPDGAMR------STGYTHDGPC  120
            YKT+      +V D      GAD  CGFT  +  PQP P             GYTH GPC
Sbjct  62   YKTMAAEKGVSVRDVVLDMVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPC  121

Query  121  EVWLDSTRVLQSDNCH--------ETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYS  172
            E+++D   VL SDNC         ++ I     +DYSSC G CT   YWLG    +NA  
Sbjct  122  ELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-Q  177

Query  173  WQIYKACIPLSASARRLEVAANKS  196
            WQ Y  C+PLS +    +  A+ S
Sbjct  178  WQAYINCVPLSGTGETTQTQASGS  201

>PHYSO_485524
Length=278

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 72/130 (55%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWL  124
            + +N  K +R  ++  T   GA+  CG+TN +A P+  P DG A  S G  H GPCE+WL
Sbjct  71   KDSNNAKDIRTLLDSDTKLYGAN--CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWL  128

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  I     +DYSSC  G C  R+YWL ++ L     WQ+Y
Sbjct  129  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVY  188

Query  177  KACIPLSASA  186
            K CIPLS  A
Sbjct  189  KNCIPLSGPA  198

>CCI47381
Length=211

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 72/128 (56%), Gaps = 20/128 (16%)

Query  73   YKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM------RSTGY--THDGPCEVW  123
            ++TLRDF++         YCG TN NA+P+P P D A+         G+  +H GPCEVW
Sbjct  72   FRTLRDFLK-----DKGPYCGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGPCEVW  126

Query  124  LDSTRVLQSDNC--HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIP  181
            L  TRV   DNC  H T       +++SSC G C L+++WL +    +   WQ+YK CIP
Sbjct  127  LGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL----HEPQWQVYKNCIP  182

Query  182  LSASARRL  189
            ++ +  RL
Sbjct  183  IAPNGIRL  190

>PHYRA_73582
Length=326

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 68/135 (50%), Gaps = 17/135 (13%)

Query  64   FNGWRRNNGYKTLRDFMEYTVADGADYY--CGFTNVNAAPQPNP-DG-AMRSTGYTHDGP  119
            F      N YK L+  M     DG ++   CGFT+ N  P   P DG A  S G  H GP
Sbjct  67   FKELSATNNYKDLKTLM-----DGPEFGEDCGFTDPNGTPSDPPTDGTATFSRGIVHAGP  121

Query  120  CEVWLDSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAY  171
            CE+WLD   VLQ+D+C        +  I     +DYS C  G C LR+YWL ++ L    
Sbjct  122  CEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKA  181

Query  172  SWQIYKACIPLSASA  186
             WQ YK CIPL+  A
Sbjct  182  VWQSYKNCIPLTGPA  196

>PHYCA_531163
Length=314

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 13/134 (10%)

Query  64   FNGWRRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            +   + +NGY  +R  ++  T   GAD  CG+TN +A  +  P+   A  S G  H GPC
Sbjct  69   YTSLKSSNGYSDIRTLLDSDTSLYGAD--CGYTNADATAKDPPSTGDATFSRGMVHVGPC  126

Query  121  EVWLDSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYS  172
            E+WLD T VL +D+C       T +       +DYSSC  + C LR+YWL  + + +A  
Sbjct  127  EIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIV  186

Query  173  WQIYKACIPLSASA  186
            WQ+YK C+PL+  A
Sbjct  187  WQVYKDCVPLTGPA  200

>PHALS_03177
Length=259

 Score = 88.6 bits (218),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 13/138 (9%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRST  112
            G   ++V+ F   +  N +K L+  M+  V  G D  CG+++ N  PQP P DG A  S 
Sbjct  57   GNTQKSVKAFQSLKAANNFKDLKTLMDNPVL-GRD--CGYSDPNGKPQPIPKDGKATFSR  113

Query  113  GYTHDGPCEVWLDSTRVLQSDNCH------ETIIGKTYNLDYSSC-KGTCT-LRWYWLGV  164
               H GPCE+WLD+ +VL  D+C+      +  I   + +DYSSC  G C  +R+YWL  
Sbjct  114  AMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAF  173

Query  165  RFLKNAYSWQIYKACIPL  182
            + +     WQ YK CIPL
Sbjct  174  QGINGKTFWQSYKMCIPL  191

>PYU1_G007364
Length=316

 Score = 89.4 bits (220),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 71/129 (55%), Gaps = 20/129 (16%)

Query  66   GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRS-------TGY--TH  116
             ++ +  Y +LRD ++     G D  CG T ++A P+P P   M S        G+  +H
Sbjct  82   AFQASGKYASLRDLLQ---GHGED--CGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSH  136

Query  117  DGPCEVWLDSTRVLQSDNCHETIIGKTYNL--DYSSCKGTCTLRWYWLGVRFLKNAYSWQ  174
             GPCE+WLD T VL+ +NC     G    +  D+SSC G C +R+YWL ++      +WQ
Sbjct  137  TGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQ  192

Query  175  IYKACIPLS  183
            IYK CIPL+
Sbjct  193  IYKNCIPLA  201

>PHYKE_10578
Length=239

 Score = 87.8 bits (216),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 85/180 (47%), Gaps = 25/180 (14%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLT---FLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
            A AH  + +P PT+      + +  L    +  G G + V  F       G  +++D + 
Sbjct  20   ADAHGALKVPEPTFEQGASHSNWVTLVDNYWDIGSGGDQVGKFKTMATEKGM-SVKDVIL  78

Query  82   YTVADGADYYCGFTNVNAAPQPNP-DGAM-----RSTGYTHDGPCEVWLDSTRVLQSDNC  135
              V D     CGFT  +A PQP P DG +      + G+TH GPCEV++D   VL  DNC
Sbjct  79   DMVKD---KKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNC  135

Query  136  HETIIG--------KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
             +   G            +DYSSC G C L +YWLG +  +    WQ Y  C+PL+ S +
Sbjct  136  EDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLTGSGK  191

>PHALS_03179
Length=372

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 76/142 (54%), Gaps = 13/142 (9%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRST  112
            G   ++V+ +   +  N +K L+  ME T A G +  CGF++    PQP P DG A  S 
Sbjct  98   GNTEQSVKAYQSLKAANNFKDLKTLME-THALGPE--CGFSDPKGKPQPIPKDGKATLSR  154

Query  113  GYTHDGPCEVWLDSTRVLQSDNCH------ETIIGKTYNLDYSSC-KGTCT-LRWYWLGV  164
               H GPCE+WLD+ +VL  D+C+      +  I     +DYSSC  G C  +R+YWL  
Sbjct  155  AIVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAF  214

Query  165  RFLKNAYSWQIYKACIPLSASA  186
            + +K    WQ YK CIPL  S 
Sbjct  215  QGIKGITFWQSYKNCIPLQGSG  236

>PHYRA_73584
Length=287

 Score = 87.8 bits (216),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 75/135 (56%), Gaps = 15/135 (11%)

Query  64   FNGWRRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            ++  +++NGY  +R  ++  T   GA+  CGFTN +A  +  P    A  S G  H GPC
Sbjct  66   YSSLKKSNGYSDIRTLLDSDTTLYGAN--CGFTNPDATAKDPPTTGDATFSRGMVHAGPC  123

Query  121  EVWLDSTRVLQSDNCHETIIGKTYN--------LDYSSCKGT-CTLRWYWLGVRFLKNAY  171
            E+WLD T VL +D+C +T  G            +DYSSC  + C LR+YWL  + + +  
Sbjct  124  EIWLDDTLVLSNDDC-QTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKT  182

Query  172  SWQIYKACIPLSASA  186
             WQ+YK C+PL+  A
Sbjct  183  VWQVYKDCVPLTGPA  197

>PHYCA_12942
Length=353

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 81/170 (48%), Gaps = 18/170 (11%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFLE-GQGYETVEDFNGWRRNNGYKTLRDFME  81
            P A AH  +  P PT+     +       + + G G + V  F       G  +++D + 
Sbjct  18   PNADAHGSLKQPKPTFDGSSAEWVTMIDNYWDIGSGGDQVGKFKTMAAERGM-SVKDVIL  76

Query  82   YTVADGADYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPCEVWLDSTRVLQSDNC  135
              V D     CG+T  +A PQP P DG ++       G+TH GPCE+++D   VL  DNC
Sbjct  77   DMVKD---KKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNC  133

Query  136  HETIIG---KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
             E   G       +DYSSC G C L  YWLG    +NA  WQ Y  C+PL
Sbjct  134  EEEFKGGDTSDMKIDYSSCNGNCMLTIYWLG---FQNA-QWQAYVNCVPL  179

>PHALS_05392
Length=367

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 64/126 (51%), Gaps = 12/126 (10%)

Query  71   NGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDG--AMRSTGYTHDGPCEVWLDSTR  128
            N +K +R  M+     G D  CG+T+ N  P   P    A  S G  H GPCE+WLD   
Sbjct  157  NNFKDVRSLMDGNPVYGED--CGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLDDKM  214

Query  129  VLQSDNCH-------ETIIGKTYNLDYSSCKGT-CTLRWYWLGVRFLKNAYSWQIYKACI  180
            VLQ+D+C        +  I     +DYSSC    C LR+YWL ++ L     WQ YK CI
Sbjct  215  VLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKNCI  274

Query  181  PLSASA  186
            PL+  A
Sbjct  275  PLNGPA  280

>PHYRA_73583
Length=630

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWL  124
            + +N  K +R  ++  T   GA+  CG+TN +A+P+  P+   A  S G  H GPCE+WL
Sbjct  71   KASNNAKDIRTLLDSDTTLYGAN--CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWL  128

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  I     +DYSSC  G C  R+YWL ++ L     WQ+Y
Sbjct  129  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVY  188

Query  177  KACIPLSASA  186
            K CIPLS  A
Sbjct  189  KNCIPLSGPA  198

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 70/130 (54%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWL  124
            + +N  K +R  ++  T   GAD  CGFT+  A P+  P+   A  S G  H GPCEVWL
Sbjct  372  KASNNIKDIRTMIDSDTKLYGAD--CGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWL  429

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  +     +DYSSC  G C  R++WL ++   +   WQ+Y
Sbjct  430  DDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVY  489

Query  177  KACIPLSASA  186
            K C+PLS  A
Sbjct  490  KNCVPLSGPA  499

>PHYKE_2809
Length=291

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 68/128 (53%), Gaps = 13/128 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYTHDGPCEVWL  124
            +  N  K +R  ++  T   G D  CGFT+  A P+  P DGA   S G  H GPCE+WL
Sbjct  58   KAANNVKDIRTMLDSDTKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWL  115

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  I     +DYSSC  G C  R+YWL ++ L     WQ+Y
Sbjct  116  DDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVY  175

Query  177  KACIPLSA  184
            K C+PLS 
Sbjct  176  KNCVPLSG  183

>PYIR_19612
Length=260

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 79/140 (56%), Gaps = 17/140 (12%)

Query  58   YETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYT  115
            ++  ++F    +  G+ TLR ++E   A      CGFT+ N AP+  P D  +R S   +
Sbjct  57   WKDPKNFATAAKEKGFATLRSYLEDKGA-----TCGFTDPNVAPRAIPADRKVRFSRDIS  111

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            H GPCE+W+D  RV Q+D+C     G   ++++D++ C G C +R+YWL ++   +   W
Sbjct  112  HPGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRW  169

Query  174  QIYKA------CIPLSASAR  187
            Q+Y++      C+P+S S +
Sbjct  170  QVYRSELTRDLCVPVSGSGK  189

>PPTG_04647
Length=327

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 71/131 (54%), Gaps = 13/131 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWL  124
            + +NGY  +R  ++  T   GAD  CG+TN +A  +  P    A  S G  H GPCE+WL
Sbjct  72   KSSNGYSDIRTLLDSDTDLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEIWL  129

Query  125  DSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYSWQIY  176
            D T VL +DNC       T +       +DYSSC  + C LR+YWL  + + +   WQ+Y
Sbjct  130  DDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQVY  189

Query  177  KACIPLSASAR  187
            K C+PL+  A 
Sbjct  190  KDCVPLTGPAS  200

>SDRG_16535
Length=313

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 10/143 (7%)

Query  61   VEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGY-----T  115
               F    R + ++TL  F++   +      CG TN N APQP P     + G      +
Sbjct  61   TRQFTMQFRASKFQTLASFVD-DPSFAPCGTCGITNANGAPQPLPSVLKWANGQEGFVAS  119

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQI  175
            H+GPCEVW DSTRV Q+DNC    +    ++D + C G   LR  WL +    +  SWQ+
Sbjct  120  HEGPCEVWCDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQV  175

Query  176  YKACIPLSASARRLEVAANKSVV  198
            Y  C+PLS S   +  A++ S+ 
Sbjct  176  YINCVPLSGSTIEIPPASSPSMT  198

>H310_06362
Length=197

 Score = 84.7 bits (208),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 27/139 (19%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM------RSTGY--THDGPCEV  122
            G+KTLR  ++    D     CG+T +N   +P P DG +         G+  +H GPCE+
Sbjct  51   GFKTLRAMLDPHGPD-----CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTGPCEI  105

Query  123  WLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKAC  179
            WLD+TRV Q++NC      K      +D+SSC G+CT+R+YWL +    +   WQ+YK C
Sbjct  106  WLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLWQVYKNC  161

Query  180  IPLSASARRLEVAANKSVV  198
             PL      + +AA+ +VV
Sbjct  162  APL------VGLAASPTVV  174

>PHYRA_79140
Length=424

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 71/138 (51%), Gaps = 23/138 (17%)

Query  73   YKTLRDFMEYTVADGA-----DYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPCE  121
            YKT+    + TV D          CG T+ +A+PQP P DG  +       G+TH GPCE
Sbjct  62   YKTMAAEKKMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCE  121

Query  122  VWLDSTRVLQSDNCHETI----IGKTYN----LDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            ++LD T VL SDNC +      +G T      +DYSSC G CTL  YWL     +NA  W
Sbjct  122  IYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLA---FQNAQ-W  177

Query  174  QIYKACIPLSASARRLEV  191
            Q Y  C+PLS S    + 
Sbjct  178  QAYVNCVPLSGSGSATQT  195

>PHYRA_73606
Length=366

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 72/132 (55%), Gaps = 13/132 (10%)

Query  64   FNGWRRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPC  120
            + G + +NGY  +R  ++  T   GAD  CG+TN +A  +  P    A  S G  H GPC
Sbjct  69   YTGLKSSNGYSDIRTLLDSDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPC  126

Query  121  EVWLDSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYS  172
            E+WLD T VL +D+C       T +       +DYSSC  + C LR+YWL  + + +   
Sbjct  127  EIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIV  186

Query  173  WQIYKACIPLSA  184
            WQ+YK C+PL+ 
Sbjct  187  WQVYKDCVPLTG  198

>PYIW_15526
Length=256

 Score = 85.5 bits (210),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 72/137 (53%), Gaps = 24/137 (18%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGY----  114
            +   +F       GY +L++ ++ +V+      CG+TN NAAP       ++S  Y    
Sbjct  63   QNAAEFTAAWPKTGYTSLKEMLDKSVSG-----CGYTNPNAAPVD--VSGLKSMKYQNNE  115

Query  115  -------THDGPCEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVR  165
                   +H GPCE W+D+T++  +D+C +T  G   T  +DYS CKGTC L +YWL V 
Sbjct  116  YKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVH  175

Query  166  FLKNAYSWQIYKACIPL  182
              K    WQ+YK C+ +
Sbjct  176  SPK----WQVYKGCVAI  188

>PHYSO_484051
Length=285

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 13/131 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWL  124
            + +NGY  +R  ++  T   GAD  CGFTN +A+P+  P       S    H  PCE+WL
Sbjct  73   KESNGYSDIRTLLDSDTSLYGAD--CGFTNPDASPKDPPTTGDPTFSRCMVHASPCEIWL  130

Query  125  DSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYSWQIY  176
            D T VL +D+C       T         +DYSSC  + C LR+YWL  + + +   WQ+Y
Sbjct  131  DDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQVY  190

Query  177  KACIPLSASAR  187
            K C+PL+  A 
Sbjct  191  KDCVPLTGPAE  201

>PHYKE_2937
Length=366

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 72/130 (55%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWL  124
            + +NGY  +R  ++  T   GAD  CG+TN +A  +  P    A  S G  H GPCE+WL
Sbjct  77   KSSNGYSDIRTLLDSDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEIWL  134

Query  125  DSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYSWQIY  176
            D T VL +D+C       T +       +DYSSC  + C LR+YWL  + + ++  WQ+Y
Sbjct  135  DDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQVY  194

Query  177  KACIPLSASA  186
            K C+PL+  A
Sbjct  195  KDCVPLTGPA  204

>PPTG_07509
Length=299

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 74/154 (48%), Gaps = 22/154 (14%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR---  110
            G G + V  F    +  G  +++D +   V D     CG+T  +  P+P P DG ++   
Sbjct  52   GSGGDQVGKFKTMAKEKGM-SVKDVVLDMVKD---KKCGYTRTDVDPKPIPADGKVKWWG  107

Query  111  --STGYTHDGPCEVWLDSTRVLQSDNCHETIIG--------KTYNLDYSSCKGTCTLRWY  160
                G+TH GPCE+++D   VL  DNC E   G            +D+SSC G CTL  Y
Sbjct  108  NGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIY  167

Query  161  WLGVRFLKNAYSWQIYKACIPLSASARRLEVAAN  194
            WLG    +NA  WQ Y  C+PL  S    +  A+
Sbjct  168  WLG---FQNAQ-WQAYVNCVPLQGSGSATQTQAS  197

>PHYRA_83494
Length=224

 Score = 84.3 bits (207),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 71/136 (52%), Gaps = 20/136 (15%)

Query  75   TLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPCEVWLDSTR  128
            ++RD +   V  G D  CG T+ +AAPQ  P DG  +       G+TH GPCE+++D   
Sbjct  8    SVRDVVLDMV--GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKM  65

Query  129  VLQSDNCHETI----IGKTYN----LDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACI  180
            VL  DNC +      +G T      +DYSSC G CT   YWL     +NA  WQ Y  C+
Sbjct  66   VLHGDNCEDDYPGGDVGSTVTSDMPVDYSSCNGDCTFTIYWLA---FQNAQ-WQAYVNCV  121

Query  181  PLSASARRLEVAANKS  196
            PL+ S    + AA+ +
Sbjct  122  PLTGSGSTTQTAASST  137

>PPTG_07507
Length=299

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 74/154 (48%), Gaps = 22/154 (14%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR---  110
            G G + V  F    +  G  +++D +   V D     CG+T  +  P+P P DG ++   
Sbjct  52   GSGGDQVGKFKTMAKEKGM-SVKDVVLDMVKD---KKCGYTRTDVDPKPIPADGKVKWWG  107

Query  111  --STGYTHDGPCEVWLDSTRVLQSDNCHETIIG--------KTYNLDYSSCKGTCTLRWY  160
                G+TH GPCE+++D   VL  DNC E   G            +D+SSC G CTL  Y
Sbjct  108  NGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIY  167

Query  161  WLGVRFLKNAYSWQIYKACIPLSASARRLEVAAN  194
            WLG    +NA  WQ Y  C+PL  S    +  A+
Sbjct  168  WLG---FQNAQ-WQAYVNCVPLQGSGSATQTQAS  197

>PHYCA_534473
Length=1050

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 68/132 (52%), Gaps = 17/132 (13%)

Query  68   RRNNGYKTLRDFMEYTVADGADYY---CGFTN--VNAAPQPNPDGAMRSTGYTHDGPCEV  122
            + +NGY  +R  ++       D Y   CGFT+  V A   P    A  S G  H GPCE+
Sbjct  845  KESNGYSDIRTLLDSDT----DLYGANCGFTDPDVTAKDPPTTGDATFSRGMVHAGPCEI  900

Query  123  WLDSTRVLQSDNCHETIIGKTYN-------LDYSSCKGT-CTLRWYWLGVRFLKNAYSWQ  174
            WLD T+VL +D+C       T         +DYSSC  + C LR+YWL  + + +   WQ
Sbjct  901  WLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIVWQ  960

Query  175  IYKACIPLSASA  186
            +YK C+PL+  A
Sbjct  961  VYKDCVPLTGPA  972

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 15/128 (12%)

Query  68   RRNNGYKTLRDFMEYTVADGADYY--CGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVW  123
            +++N  K +R  ++   AD   Y   CG T+  A P+  P+   A  S G  H GPCE+W
Sbjct  540  KKSNNVKDIRTMID---ADPKLYGEDCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEIW  596

Query  124  LDSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQI  175
            LD   VLQ+D+C        +  I     +DYSSC  G C  R+YWL ++   +   WQ+
Sbjct  597  LDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQV  656

Query  176  YKACIPLS  183
            YK CIPL+
Sbjct  657  YKNCIPLT  664

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 60/121 (50%), Gaps = 12/121 (10%)

Query  64   FNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCE  121
            F      N YK +R  M+     G D  CGFT+    P  P  DG A  S G  H GPCE
Sbjct  67   FKELAAKNNYKDVRTLMDGNPVYGED--CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCE  124

Query  122  VWLDSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSW  173
            +WLD   VLQ+D+C        +  I     +DYSSC  G C LR+YWL ++ LK   + 
Sbjct  125  IWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGGGAS  184

Query  174  Q  174
            Q
Sbjct  185  Q  185

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 61/118 (52%), Gaps = 13/118 (11%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWL  124
            + +N  K +R  ++  T   GAD  CG+TN +  P+  P DG A  S G  H GPCE+WL
Sbjct  277  KASNNAKDIRTLLDSDTKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWL  334

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQ  174
            D   VL +D+C        +  I     +DYSSC  G C  R+YWL ++ L    + Q
Sbjct  335  DDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGGGASQ  392

>PHYKE_3913
Length=321

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 59/103 (57%), Gaps = 10/103 (10%)

Query  92   CGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCH-------ETIIGK  142
            CGFTN +A P+  P DG A  S G  H GPCE+WLD   VLQ+D+C        +  I  
Sbjct  121  CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISI  180

Query  143  TYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSA  184
               +DYSSC  G C  R+YW+ ++ L     WQ+YK C+PL+ 
Sbjct  181  FKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCVPLTG  223

>PYIW_25463
Length=216

 Score = 84.0 bits (206),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 75/141 (53%), Gaps = 20/141 (14%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVN-AAPQPNPDGAMR------S  111
            + V+ F       GYK+L++ M+  V       CGF+  + AA   +   +M+       
Sbjct  65   QNVQQFTAAWSKTGYKSLKELMDKQVPG-----CGFSRTDIAAVDVSGMSSMKFQNNEYK  119

Query  112  TGY--THDGPCEVWLDSTRVLQSDNCHETIIGKTYN--LDYSSCKGTCTLRWYWLGVRFL  167
             G+  +H GPCE W+D+T+V  SD+C ++  G   N  + Y++CKGTC L +YWL +   
Sbjct  120  EGFLGSHHGPCEGWIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQ  179

Query  168  KNAYSWQIYKACIPLSASARR  188
            K    WQ YK C+P+ A A R
Sbjct  180  K----WQAYKHCVPIKAGAAR  196

>PHYSO_533747
Length=206

 Score = 83.2 bits (204),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 13/137 (9%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRST  112
            G   ++VE F   +  N +K L+  ++ T   G D  CGFT+ N  PQP P DG A+ S 
Sbjct  58   GNTAKSVEVFKSLKVANNFKDLKTMLDDTSLYGPD--CGFTDPNGTPQPIPTDGKAVFSR  115

Query  113  GYTHDGPCEVWLDSTRVLQSDNC-----HETIIGKT-YNLDYSSCK--GTCTLRWYWLGV  164
            G  H GPCE WLD  +VL +D+C     H  +  KT + +DYSSC+  G   +R+YWLG 
Sbjct  116  GLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGF  175

Query  165  RFLKNAYS-WQIYKACI  180
            + L +  + WQ Y   +
Sbjct  176  QALDDKKTVWQTYSTLL  192

>PHYRA_86016
Length=236

 Score = 84.0 bits (206),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 60/122 (49%), Gaps = 18/122 (15%)

Query  89   DYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETIIG-  141
            D  CG+T  +  PQP P DG ++       G+TH GPCE+++D T VL  D+C E   G 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  142  -------KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAAN  194
                       +DYSSC G CTL  YWL     +NA  WQ Y  C+PL  S    +    
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNAQ-WQAYVNCVPLKGSGSATQTQTQ  134

Query  195  KS  196
             S
Sbjct  135  TS  136

>PPTG_04620
Length=342

 Score = 85.5 bits (210),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 70/130 (54%), Gaps = 19/130 (15%)

Query  68   RRNNGYKTLRDFMEYTVADG-ADYY---CGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCE  121
            +++N  K +R     T+ DG A  Y   CG T+  A P+  P+   A  S G  H GPCE
Sbjct  73   KKSNNVKDIR-----TMIDGDAKLYGEDCGNTDPKATPKDPPSTGDATFSRGIVHAGPCE  127

Query  122  VWLDSTRVLQSDNCH-------ETIIGKTYNLDYSSCK-GTCTLRWYWLGVRFLKNAYSW  173
            +WLD   VLQ+D+C        +  I     +DYSSCK G C  R+YWL ++   +   W
Sbjct  128  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLW  187

Query  174  QIYKACIPLS  183
            Q+YK CIPLS
Sbjct  188  QVYKNCIPLS  197

>PHYSO_459106
Length=223

 Score = 83.6 bits (205),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 67/130 (52%), Gaps = 13/130 (10%)

Query  68   RRNNGYKTLRDFMEY-TVADGADYYCGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWL  124
            ++ N  K +R  ++  T   G D  CGFT+    PQ  P    A  S G  H GPCE+WL
Sbjct  71   KKANNVKDIRTMIDSDTKLYGED--CGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEIWL  128

Query  125  DSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSWQIY  176
            D   VLQ+D+C        +  +     +DYSSC  G C  R+YWL ++   +   WQ+Y
Sbjct  129  DDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQVY  188

Query  177  KACIPLSASA  186
            K CIPL+  A
Sbjct  189  KNCIPLTGPA  198

>PHYRA_86752
Length=300

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 71/151 (47%), Gaps = 23/151 (15%)

Query  65   NGWRRNNGYKTLRDFMEYTVADGA-----DYYCGFTNVNAAPQPNP-DGAMR-----STG  113
            +G  +   YKT+    + +V D       D  CG+T  +  PQP P DG ++       G
Sbjct  54   SGGDQVGKYKTMAAEKKMSVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGG  113

Query  114  YTHDGPCEVWLDSTRVLQSDNCHETIIG--------KTYNLDYSSCKGTCTLRWYWLGVR  165
            +TH GPCE+++D T VL  D+C E   G            +DYSSC G CTL  YWL   
Sbjct  114  FTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLA--  171

Query  166  FLKNAYSWQIYKACIPLSASARRLEVAANKS  196
              +NA  WQ Y  C+PL  S    +     S
Sbjct  172  -FQNAQ-WQAYVNCVPLKGSGSATQTQTQTS  200

>PYAP_18713
Length=184

 Score = 82.4 bits (202),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 71/139 (51%), Gaps = 19/139 (14%)

Query  51   TFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQ--PNPDGA  108
            TF  G  Y  V       ++ G+K LR F+E          CG TN NA P+  P+    
Sbjct  56   TFKTGAQYAVVA------KDKGFKDLRSFLE-----DKGPACGKTNPNAKPRNVPSDSKV  104

Query  109  MRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGTCTLRWYWLGVR  165
            + S    H GPCE+W+D T V  +D+C E   GK    + +D+SSCKG C LR+YWLG++
Sbjct  105  VFSRPMVHRGPCELWIDDTMVYHNDDC-ELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ  163

Query  166  FLKNAYSWQIYKACIPLSA  184
               +   WQ Y   I  S+
Sbjct  164  --DSGKRWQSYSTYIAESS  180

>PHYRA_83500
Length=394

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 70/138 (51%), Gaps = 23/138 (17%)

Query  73   YKTLRDFMEYTVADGA-----DYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPCE  121
            YKT+    + TV D          CG T+ +A+PQP P DG  +       G+TH GPCE
Sbjct  62   YKTMAAEKKMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCE  121

Query  122  VWLDSTRVLQSDNCHETI----IGKTYN----LDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            ++LD T VL SDNC +      +G T      +DYSSC G CTL  YWL     +NA  W
Sbjct  122  IYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLA---FQNAQ-W  177

Query  174  QIYKACIPLSASARRLEV  191
            Q Y  C PLS S    + 
Sbjct  178  QAYVNCAPLSGSGSATQT  195

>PYIR_23585
Length=240

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 70/128 (55%), Gaps = 13/128 (10%)

Query  60   TVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR-STGYTHD  117
            +  DF       G+ T R F+E          CG T  NA+P+P P D  ++ S    H 
Sbjct  58   SAADFAKTAPGKGFATTRAFLE-----SRGPTCGNTLANASPKPIPSDNTVKFSRAIVHP  112

Query  118  GPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQ  174
            GPCE+W+D+TRV  +D+C E   G    T+ +D+S+CKG+C LR+YWLG++       +Q
Sbjct  113  GPCELWIDNTRVYHNDDC-EAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQ  169

Query  175  IYKACIPL  182
             Y  C+ L
Sbjct  170  SYSKCLAL  177

>PYAR_24113
Length=192

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 84/172 (49%), Gaps = 20/172 (12%)

Query  27   AHQVVLLPSPtyttddkdtkyAPLTFLEGQGYET--------VEDFNGWRRNNGYKTLRD  78
            AH  ++ P+P YTT+  ++    +  L+    +T           FN   +N+ YK+L++
Sbjct  21   AHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLKE  80

Query  79   FM--EYTVADGADYYCGFTNVNAA-PQPNPDGAM--RSTGYTHDGPCEVWLDSTRVLQSD  133
             +     V+ GA   CGF  ++ A PQP PD       TG +H GPCEVW D+    Q D
Sbjct  81   LVLQNQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTG-SHTGPCEVWCDNNLAFQDD  139

Query  134  NCHETIIGKTYNLDYS--SCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
            NC + I G    L+Y   +C G   L  YW+ +   +    WQ+Y  C PLS
Sbjct  140  NCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAPLS  187

>SDRG_07565
Length=278

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 79/164 (48%), Gaps = 23/164 (14%)

Query  53   LEGQGYETVEDFN-GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR  110
             +G   E V  F   ++  + +KTLRD +E          CG +  NA+ +  P DG M 
Sbjct  112  FDGSPQENVAAFTTAFKAQSQFKTLRDMLEPQ-----GPACGNSLPNASKKTIPSDGTMT  166

Query  111  ----STG----YTHDGPCEVWLDSTRVLQSDNCHETIIGKT---YNLDYSSCKGT-CTLR  158
                 TG     +H GPCEVWLD  RV Q D+C      K      +DYSSC G+ C LR
Sbjct  167  WLNPDTGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLR  226

Query  159  WYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFDPT  202
            +YWL +    +   WQ+YK C+PL  + + ++     S    PT
Sbjct  227  FYWLAL----HQPQWQVYKNCVPLQGNGQAVKAVGPSSPSMAPT  266

>PYIW_24289
Length=196

 Score = 81.6 bits (200),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 60/123 (49%), Gaps = 8/123 (7%)

Query  64   FNGWRRNNGYKTLRDFME--YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCE  121
            F+    +  Y+ LRD ++     + G D  CGFTNV +A QP    A      TH GPCE
Sbjct  78   FSSQTDSIKYRNLRDLIDTKAVFSAGTDKECGFTNVTSAKQPLSAHATGGFTPTHQGPCE  137

Query  122  VWLDSTRVLQSDNCHETIIGKTYNLDY--SSCKGTCTLRWYWLGVRFLKNAYSWQIYKAC  179
            +W D   V Q+DNC +        L Y  S C G   L++YWL V  +K    W+ Y  C
Sbjct  138  IWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINC  193

Query  180  IPL  182
             PL
Sbjct  194  APL  196

>PYVX_14662
Length=540

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 71/139 (51%), Gaps = 12/139 (9%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G    +V+ +       G   +R  ++ T   G D  CGFT+ +   Q  P DG A  S
Sbjct  57   DGNNQGSVDTYKSLAAEKGVTEIRSLLDDTSIYGQD--CGFTDPDGTAQDIPTDGKATFS  114

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETIIG------KTYNLDYSSC-KGTCT-LRWYWLG  163
             G  H GPCE+WLD T VL  D+C+ T  G        + +DYSSC  G C  +R+YWL 
Sbjct  115  RGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLA  174

Query  164  VRFLKNAYSWQIYKACIPL  182
             + +     WQ+YK CIPL
Sbjct  175  FQGVDGDTVWQVYKNCIPL  193

>CCA17179
Length=185

 Score = 81.3 bits (199),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 67/128 (52%), Gaps = 20/128 (16%)

Query  73   YKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM------RSTGY--THDGPCEVW  123
            ++ LRDF++         YCG TN NA P+P P D A+         G+  +H GPCEVW
Sbjct  46   FQNLRDFLK-----DKGPYCGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGPCEVW  100

Query  124  LDSTRVLQSDNCHETIIGKTYN--LDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIP  181
            L+  RV   DNC E          +D+S+C   C L+++WL +        WQ+YK CIP
Sbjct  101  LNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALH----EPQWQVYKNCIP  156

Query  182  LSASARRL  189
            ++ +  +L
Sbjct  157  IAPNGIKL  164

>PITG_11936
Length=333

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 71/140 (51%), Gaps = 16/140 (11%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFM-EYTVADGADY--YCGFTNVNAAPQPNPD-----  106
            G   +   +FN     + YK+L++FM +  V    D+   CG+TN +A PQP P      
Sbjct  60   GSPTDNTANFNKGFAASKYKSLKEFMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEW  119

Query  107  --GAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNL--DYSSCKGTCTLRWYWL  162
              GA      +H+GPCEV+ D TRV Q DNC +        L  D+ +C G+  L  YW+
Sbjct  120  SHGAGEGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWI  179

Query  163  GVRFLKNAYSWQIYKACIPL  182
             +    ++ SWQ+Y  C PL
Sbjct  180  AL----HSPSWQVYINCAPL  195

>PYIR_20481
Length=277

 Score = 83.2 bits (204),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 20/124 (16%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQP---------NPDGAMRSTGYTHDGPC  120
            N GYK+L++ ++ +V       CGFT  + AP             D   +    +H GPC
Sbjct  72   NTGYKSLKEMLDLSVPG-----CGFTLTDGAPVDVSGLKSMKWQNDQEQKGFIDSHHGPC  126

Query  121  EVWLDSTRVLQSDNCHE--TIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            EVW+D+T+++ SD+C    T       +DYS CKG C L +YWL +    +  +WQIYK 
Sbjct  127  EVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLAL----HEPNWQIYKQ  182

Query  179  CIPL  182
            C+P+
Sbjct  183  CVPI  186

>SDRG_08129
Length=218

 Score = 82.0 bits (201),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 82/158 (52%), Gaps = 24/158 (15%)

Query  53   LEGQGYETVEDF-NGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR  110
             +G   E V  F + ++  + +KTLRD +E          CG +  NA+ +  P DGAM 
Sbjct  50   FDGSPQENVAAFTSAFKVQSQFKTLRDMLEPQ-----GPACGNSLPNASKKTIPSDGAMT  104

Query  111  ----STG----YTHDGPCEVWLDSTRVLQSDNCHETIIGKT---YNLDYSSCKGT-CTLR  158
                 TG     +H GPCEVWLD  RV Q+D+C      K      +DYSSC G  C LR
Sbjct  105  WRNPDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLR  164

Query  159  WYWLGVRFLKNAYSWQIYKACIPLSASARRLE-VAANK  195
            +YWL +    +   WQ+YK C+PL  + + ++ + A+K
Sbjct  165  FYWLAL----HQPQWQVYKNCVPLQGNGQAVKAIKADK  198

>PITG_04947
Length=298

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 67/129 (52%), Gaps = 19/129 (15%)

Query  68   RRNNGYKTLRDFMEYTVADG-ADYY---CGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCE  121
            +++N  K +R     T+ DG A  Y   CG T+  A P+  P    A  S G  H GPCE
Sbjct  46   KKSNNIKDIR-----TMIDGDAKLYGEDCGNTDPKATPKDPPTTGDATFSRGIVHAGPCE  100

Query  122  VWLDSTRVLQSDNCH-------ETIIGKTYNLDYSSCK-GTCTLRWYWLGVRFLKNAYSW  173
            +WLD   VLQ+D+C        +  I     +DYSSCK G C  R+YWL ++       W
Sbjct  101  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLW  160

Query  174  QIYKACIPL  182
            Q+YK CIPL
Sbjct  161  QVYKNCIPL  169

>PYAP_18221
Length=226

 Score = 81.3 bits (199),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 73/145 (50%), Gaps = 28/145 (19%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGY----  114
            +  + F    + +G K+LR+ M+  V       CG TN N  P+      +++  Y    
Sbjct  67   QNTQVFTDAFKQSGLKSLRELMDKYVPG-----CGNTNPNTTPRD--VTKLKTMTYQNNE  119

Query  115  -------THDGPCEVWLDSTRVLQSDNCHETIIGKTY----NLDYSSCKGTCTLRWYWLG  163
                   +H GPCEVW+D+TRV Q+++C      K+Y     +DYS CKGTC L +YWL 
Sbjct  120  YKEGFLNSHHGPCEVWIDNTRVFQNNDCAANY--KSYPAALPVDYSKCKGTCRLTFYWLA  177

Query  164  VRFLKNAYSWQIYKACIPLSASARR  188
            +   K    WQ YK C+P+   A R
Sbjct  178  LHSQK----WQAYKQCVPIKYGASR  198

>PHALS_05394
Length=288

 Score = 82.0 bits (201),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 66/126 (52%), Gaps = 12/126 (10%)

Query  71   NGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCEVWLDSTR  128
            N +K+ R  M+     GAD  CG+T+ N  P  P  DG A  S    H G CE+W++   
Sbjct  76   NNFKSARSLMDGNPVYGAD--CGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWINKKM  133

Query  129  VLQSDNCHETIIGKTYN-------LDYSSCKG-TCTLRWYWLGVRFLKNAYSWQIYKACI  180
            VLQ+D+C      K          +DYSSCKG  C LR+YWL ++ + +   WQ YK CI
Sbjct  134  VLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNCI  193

Query  181  PLSASA  186
             +  S+
Sbjct  194  SIKGSS  199

>SDRG_15426
Length=523

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 23/141 (16%)

Query  61   VEDFN-GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRS-----TGY  114
            V +FN  +   + YKTLRD ++ +  D     CG T  N AP+P P   M +     TG 
Sbjct  33   VANFNKAFAAQSQYKTLRDLLDLSGPD-----CGNTRTNVAPKPIPSDGMMTWQNPDTGE  87

Query  115  ----THDGPCEVWLDSTRVLQSDNC---HETIIGKTYNLDYSSCK-GTCTLRWYWLGVRF  166
                +H GPCE+WLD+ RV Q+DNC     T       +DY+ C    C LR+YWL +  
Sbjct  88   GFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLALHQ  147

Query  167  LKNAYSWQIYKACIPLSASAR  187
             +    WQ+YK C+PL  + +
Sbjct  148  PQ----WQVYKNCVPLQGNEQ  164

>H257_13550
Length=266

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 75/139 (54%), Gaps = 24/139 (17%)

Query  59   ETVEDFNGWRRNN---GYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM-----  109
            + V  FN   R+    G+KTLR  ++    D     CG++ ++   +P P DG +     
Sbjct  90   KNVAAFNKAFRDQQATGFKTLRAMLDPQGPD-----CGYSKLDVPAKPIPSDGNVVWQNP  144

Query  110  -RSTGY--THDGPCEVWLDSTRVLQSDNCHETIIGKT---YNLDYSSCKGTCTLRWYWLG  163
                G+  +H GPCE+WLD+TRV Q+D+C      K      +D++SC G+CT+R+YW+ 
Sbjct  145  DSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIA  204

Query  164  VRFLKNAYSWQIYKACIPL  182
            +    +   WQ+YK C PL
Sbjct  205  L----HQDLWQVYKNCAPL  219

>PHYCA_18657
Length=295

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 70/146 (48%), Gaps = 21/146 (14%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAM-----  109
            G G + V  +    +  G  ++RD +   V  G D  CGFT  +  P+P P         
Sbjct  138  GSGGDQVGKYKTLAKEKGV-SVRDVILQMV--GNDKKCGFTRTDVDPKPVPTNGKAVWLG  194

Query  110  -RSTGYTHDGPCEVWLDSTRVLQSDNCH--------ETIIGKTYNLDYSSCKGTCTLRWY  160
                G+TH GPCE+++D   VL SD+C         ++ I     +DYSSC G CT   Y
Sbjct  195  NDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPNDSGIMSEMPVDYSSCNGDCTFSIY  254

Query  161  WLGVRFLKNAYSWQIYKACIPLSASA  186
            WLG    +NA  WQ Y  C+PLS + 
Sbjct  255  WLG---FQNA-QWQAYINCVPLSGTG  276

>SPRG_19916
Length=305

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 72/142 (51%), Gaps = 23/142 (16%)

Query  61   VEDFN-GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRS-----TGY  114
            V +FN  ++    +KTLRD ++    D     CG T  N A +  P   M +     TG 
Sbjct  60   VANFNKAFKAQTQFKTLRDMLDPQGPD-----CGNTLTNGAKKAIPTNGMMTWQNPDTGE  114

Query  115  ----THDGPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGT-CTLRWYWLGVRF  166
                +H GPCEVW+D  RV Q+D+C      K      +DYSSC G  C LR+YWL +  
Sbjct  115  GFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLAL--  172

Query  167  LKNAYSWQIYKACIPLSASARR  188
              +   WQ+YK C+PL  + ++
Sbjct  173  --HEPMWQVYKNCVPLEGNGQK  192

>PYU1_G005872
Length=297

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 20/140 (14%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDGAMR------STGY--THDGPCEV  122
            GYK+L+  M+  V       CG++N NAAP   +   AM+        G+  +H GPCE 
Sbjct  79   GYKSLKQMMDKAVPG-----CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  133

Query  123  WLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACI  180
            W+D+TRV   D+C     G   T  + Y SCKGTC L +YWL +   K    WQ YK+C+
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  181  PLSASARRLEVAANKSVVFD  200
             +  +A   E +++   + D
Sbjct  190  AIKNNAYSEERSSDPEDLED  209

>PYU1_G005871
Length=284

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 20/140 (14%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDGAMR------STGY--THDGPCEV  122
            GYK+L+  M+  V       CG++N NAAP   +   AM+        G+  +H GPCE 
Sbjct  79   GYKSLKQMMDKAVPG-----CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  133

Query  123  WLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACI  180
            W+D+TRV   D+C     G   T  + Y SCKGTC L +YWL +   K    WQ YK+C+
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  181  PLSASARRLEVAANKSVVFD  200
             +  +A   E +++   + D
Sbjct  190  AIKNNAYSEERSSDPEDLED  209

>SDRG_08137
Length=282

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 81/158 (51%), Gaps = 24/158 (15%)

Query  53   LEGQGYETVEDF-NGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR  110
             +G   E V  F + ++  + +KTLRD +E          CG +  NA+ +  P DG M 
Sbjct  114  FDGSPQENVAAFTSAFKAQSQFKTLRDMLEPQ-----GPACGNSLPNASKKTIPSDGTMT  168

Query  111  ----STG----YTHDGPCEVWLDSTRVLQSDNCHETIIGKT---YNLDYSSCKGT-CTLR  158
                 TG     +H GPCEVWLD  RV Q+D+C      K      +DYSSC G  C LR
Sbjct  169  WRNPDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLR  228

Query  159  WYWLGVRFLKNAYSWQIYKACIPLSASARRLE-VAANK  195
            +YWL +    +   WQ+YK C+PL  + + ++ + A+K
Sbjct  229  FYWLAL----HQPQWQVYKNCVPLQGNGQAVKAIKADK  262

>PYIW_24288
Length=201

 Score = 78.6 bits (192),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 15/123 (12%)

Query  71   NGYKTLRDFMEYTV--ADGADYYCGFTNVNAAPQPNP-------DGAMRSTGYTHDGPCE  121
            N Y+ LR+ +++T   + GAD  CGFT+   A QP P       +   +    TH+GPCE
Sbjct  83   NRYRNLRELVDFTAVFSAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPCE  142

Query  122  VWLDSTRVLQSDNCHETIIGKTYNLDY--SSCKGTCTLRWYWLGVRFLKNAYSWQIYKAC  179
            VW D     +  NC +  +G    L Y  S C G   L++YWL +    ++  W++Y  C
Sbjct  143  VWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYINC  198

Query  180  IPL  182
            +PL
Sbjct  199  VPL  201

>PHYCA_97965
Length=288

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 26/158 (16%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR---  110
            G G + V  F    +  G  +++D +   V D     CG+T  +  PQP P DG ++   
Sbjct  55   GSGGDQVGKFKTMAKEKGM-SVKDVVLDMVKD---KKCGYTRTDVDPQPIPSDGIVKWWG  110

Query  111  --STGYTHDGPCEVWLDSTRVLQSDNCHETIIG--------KTYNLDYSSCKGTCTLRWY  160
                G+TH GPCE+++D   VL  D+C +   G           ++D+SSC G CTL  Y
Sbjct  111  NGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIY  170

Query  161  WLGVRFLKNAYSWQIYKACIPL----SASARRLEVAAN  194
            WL  +  +    WQ Y  C+PL    SA+  +  VA +
Sbjct  171  WLAFQNEQ----WQSYVNCVPLQGDGSATQTQTSVAGS  204

>PYU1_G005868
Length=267

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 20/124 (16%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQP---------NPDGAMRSTGYTHDGPC  120
            ++ YK+LR+ ++  V D     CGFT  +  P             D   +    +H GPC
Sbjct  72   SSSYKSLREMLDSAVPD-----CGFTLTDGTPVDVSSLKSMKWQNDQEQKGFIDSHHGPC  126

Query  121  EVWLDSTRVLQSDNCHE--TIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            E+W+D T+++ SD+C    T       +DYS CKG C L +YWL +    +  +WQIYK 
Sbjct  127  ELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLAL----HEPNWQIYKQ  182

Query  179  CIPL  182
            C+P+
Sbjct  183  CVPI  186

>PHYCA_12943
Length=287

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 26/158 (16%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR---  110
            G G + V  F    +  G  +++D +   V D     CG+T  +  PQP P DG ++   
Sbjct  55   GSGGDQVGKFKTMAKEKGM-SVKDVVLDMVKD---KKCGYTRTDVDPQPIPSDGIVKWWG  110

Query  111  --STGYTHDGPCEVWLDSTRVLQSDNCHETIIG--------KTYNLDYSSCKGTCTLRWY  160
                G+TH GPCE+++D   VL  D+C +   G           ++D+SSC G CTL  Y
Sbjct  111  NGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIY  170

Query  161  WLGVRFLKNAYSWQIYKACIPL----SASARRLEVAAN  194
            WL  +  +    WQ Y  C+PL    SA+  +  VA +
Sbjct  171  WLAFQNEQ----WQSYVNCVPLQGDGSATQTQTSVAGS  204

>PHYCA_120062
Length=212

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (51%), Gaps = 15/138 (11%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR--S  111
            G  Y+ V+D   W   N   +++D++    +D  +  CG T  N  PQP P DG ++  S
Sbjct  8    GDYYQAVDD---WFTKNNVDSVKDYVTKYASDIPE--CGNTKKNGTPQPLPTDGFVKHDS  62

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGTCTLRWYWLGVRFLK  168
             G +H GPCE+W D TRV  + NC     G+   +  +D  +CK +  L +YWL +    
Sbjct  63   IGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSLPIDLDTCKSSSELVFYWLALHVQP  122

Query  169  NAYSWQIYKACIPLSASA  186
                WQ+Y  C+ L  SA
Sbjct  123  ----WQVYINCVTLDGSA  136

>PYAP_22257
Length=247

 Score = 79.0 bits (193),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 19/127 (15%)

Query  67   WRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-------DGAMRSTGY--THD  117
            ++    +KTL+D +E  +       CG ++    PQ          +     TG+  +H 
Sbjct  65   FKSQKTFKTLKDMVEKQLKGS----CGKSSGKGKPQSVEGLSDVHWENTEEKTGFVSSHS  120

Query  118  GPCEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQI  175
            GPCE+W+D TRV+  DNC     G      ++YS CKG C LR+YWL +    +   WQ+
Sbjct  121  GPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLAL----HEPEWQV  176

Query  176  YKACIPL  182
            YK C+P+
Sbjct  177  YKNCVPI  183

>PHYRA_73581
Length=293

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 49/89 (55%), Gaps = 9/89 (10%)

Query  108  AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYN--------LDYSSCKGT-CTLR  158
            A  S G  H GPCE+WLD T VL  D+C +T     Y         +DYSSC  + C LR
Sbjct  120  ATFSRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLR  179

Query  159  WYWLGVRFLKNAYSWQIYKACIPLSASAR  187
            +YWL  +   + Y WQIYK C+PL+  A 
Sbjct  180  FYWLAFQGSNDGYVWQIYKHCVPLTGPAE  208

>PHYRA_83499
Length=473

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 67/143 (47%), Gaps = 23/143 (16%)

Query  73   YKTLRDFMEYTVADGA-----DYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPCE  121
            YKT+    + +V D       D  CG+T  +  PQP P DG ++       G+TH GPCE
Sbjct  62   YKTMAAEKKMSVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCE  121

Query  122  VWLDSTRVLQSDNCHETIIG--------KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            +++D T VL  D+C E   G            +DYSSC G CTL  YWL     +NA  W
Sbjct  122  IYIDDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNA-QW  177

Query  174  QIYKACIPLSASARRLEVAANKS  196
            Q Y  C+ L  S    +     S
Sbjct  178  QAYVNCVSLKGSGSATQTQTQTS  200

 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 12/67 (18%)

Query  118  GPCEVWLDSTRVLQSDNCHETIIGKTYN--------LDYSSCKGTCTLRWYWLGVRFLKN  169
            GPCE++LD T +L  DNC +   G   +        +DYSSC G CTL  YWLG +  + 
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ-  409

Query  170  AYSWQIY  176
               WQ Y
Sbjct  410  ---WQAY  413

>PHYSO_255056
Length=269

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 59/101 (58%), Gaps = 12/101 (12%)

Query  87   GADYYCGFTNVNAAPQ-PNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTY  144
            GAD  CGF+N +A P+ P  DG A    G  H GPCE+WLD T VL +D+C      K +
Sbjct  94   GAD--CGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDDTMVLHNDDC-----AKAF  146

Query  145  NL-DYSSCKGTCTLRWYWLGVR-FLKNAYSWQIYKACIPLS  183
            ++ DY S  G C  R+YWL  +      Y WQIYK CIPL+
Sbjct  147  SVEDYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLT  186

>PYAP_24691
Length=145

 Score = 76.3 bits (186),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 3/86 (3%)

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQ  174
            H GPCE+W D+TRV    +C +     T + +DYS CKG C LR+YWLG++       WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQ  60

Query  175  IYKACIPLSASARRLEVAANKSVVFD  200
             YK C+P+    R L    +++   D
Sbjct  61   SYKNCVPIGNGKRMLAEGDDEATEDD  86

>PHALS_04411
Length=262

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 64/131 (49%), Gaps = 12/131 (9%)

Query  64   FNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDG-AMRSTGYTHDGPCE  121
            F      N YK +R  M+   A G D  CGFT+    P  P  DG A  S G  H GPCE
Sbjct  67   FKELAAKNNYKNVRTLMDGNPAFGED--CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCE  124

Query  122  VWLDSTRVLQSDNCH-------ETIIGKTYNLDYSSC-KGTCTLRWYWLGVRFLKNAYSW  173
            +W +   +LQ+D+C        +  I     + YS C  G   LR+YWL ++ L+    W
Sbjct  125  LWCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVW  184

Query  174  QIYKACIPLSA  184
            Q YK CIPL+ 
Sbjct  185  QAYKNCIPLTG  195

>PHYRA_80750
Length=275

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 77/170 (45%), Gaps = 18/170 (11%)

Query  23   PTATAHQVVLLPSPtyttddkdtkyAPLTFL------EGQGYETVEDFNGWRRNNGYKTL  76
            P+A AH  +L+P   +           +  +      +G    +V+ F   +  N +  L
Sbjct  19   PSADAHGYMLIPESQFKDSANSAWVVQIDPVWDSADWDGNNAGSVDAFKALKTANNFVDL  78

Query  77   RDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDN  134
            +  M+ T   GAD  CGFT+ +  PQP P DG A  S    H GPCE+WLD  +V   D+
Sbjct  79   KTLMDDTATFGAD--CGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWLDDKKVFYEDD  136

Query  135  CHETI------IGKTYNLDYSSCKGTC--TLRWYWLGVRFLKNAYSWQIY  176
            C  T       I   + +DYS C G     +R+YWL  + +     WQ Y
Sbjct  137  CFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  186

>PHYSO_324715
Length=274

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 90/178 (51%), Gaps = 33/178 (19%)

Query  50   LTFLEGQGYETVED---FNGWRRNN-----------GYKT-LRDFMEY-TVADGADYYCG  93
            LT ++G GY  V +    +  +++N           GY+  +R  ++  T   GAD  CG
Sbjct  31   LTTVQGHGYMLVPEAVPLSDHKKDNMISSWIKAKAEGYENNIRKLLDGDTKLYGAD--CG  88

Query  94   FTNVNAAPQ-PNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYN------  145
            +++ NA+P+ P+ DG A  S G  H GPCE+WLD   +L  D+C ET     Y       
Sbjct  89   YSDPNASPKDPSTDGTATFSRGIAHHGPCEIWLDDKMILHDDDCEETFGTSDYEKIKTVF  148

Query  146  --LDYSSCKGT-CTLRWYWL---GVRFLKNAYSWQIYKACIPLSA-SARRLEVAANKS  196
              +DYSSC    C L +YWL   G     + Y WQIYK  + L+  +A ++  A+N +
Sbjct  149  KPIDYSSCSANGCMLHFYWLAFQGRTTGNSKYVWQIYKCYVALTGPAAGQVSTASNST  206

>PHYCA_98479
Length=276

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 68/130 (52%), Gaps = 24/130 (18%)

Query  73   YKTLRDFMEYTVAD------GADYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPC  120
            +KT+ +    +V D      G+   CG T  + + QP P DG  +       G+TH GPC
Sbjct  61   FKTMAEEKGVSVKDVVLDMVGSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPC  120

Query  121  EVWLDSTRVLQSDNCHETI----IGKTYN----LDYSSCKGTCTLRWYWLGVRFLKNAYS  172
            E+++D T VL  DNC +      +G T      +DYSSCKG CTL  YWLG    +NA  
Sbjct  121  EIYIDDTMVLHGDNCEDEYPGGDVGSTVTSDMPVDYSSCKGDCTLTIYWLG---FQNA-Q  176

Query  173  WQIYKACIPL  182
            WQ Y  C+PL
Sbjct  177  WQAYINCVPL  186

>PYAR_20617
Length=254

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 61/128 (48%), Gaps = 10/128 (8%)

Query  58   YETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYT--  115
            ++T   +    +  G   LR F+E          CG +  +A P+  P     S   T  
Sbjct  55   FKTGAQYAAKAKAEGIPDLRTFLE-----DKGPVCGNSLKDATPKAIPASGKISLASTIE  109

Query  116  HDGPCEVWLDSTRVLQSDNCHETIIGKT-YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQ  174
            H GPCEVW D       D+C +T    T + +D+S C G+C LR+YWLG++       WQ
Sbjct  110  HAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQ  167

Query  175  IYKACIPL  182
             YK C+PL
Sbjct  168  SYKNCVPL  175

>PHYRA_84947
Length=265

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 79/179 (44%), Gaps = 25/179 (14%)

Query  24   TATAHQVVLLPSPtyttddkdtkyAPLTFLE----------GQGYETVEDFNGWRRNNGY  73
            + T H  ++LP P            P   ++          G  YE V+    W   N  
Sbjct  19   STTGHGNIILPKPEGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYEAVDS---WFTKNNI  75

Query  74   KTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR--STGYTHDGPCEVWLDSTRVL  130
             +L++++     D ++  CG T  N APQP P DG  +  + G +H GPCE+W D TRV 
Sbjct  76   ASLKEYITTYGTDISE--CGVTKKNGAPQPVPSDGYAQHDNLGNSHPGPCEIWCDDTRVF  133

Query  131  QSDNCHETIIGKT---YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
               NC     G++     +D S+CK +  L +YWL +        WQ+Y  C+ L  + 
Sbjct  134  HDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHI----QPWQVYINCVALDGAG  188

>SPRG_22161
Length=300

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 72/142 (51%), Gaps = 23/142 (16%)

Query  61   VEDFN-GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRS-----TGY  114
            V +FN  ++    +KTLRD ++    D     CG T  N A +  P   M +     TG 
Sbjct  60   VANFNKAFKAQTQFKTLRDMLDPQGPD-----CGNTLTNGAKKAIPTNGMMTWQNPDTGE  114

Query  115  ----THDGPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGT-CTLRWYWLGVRF  166
                +H GPCEVW+D+ RV Q+D+C      K      +DYSSC    C LR+YWL +  
Sbjct  115  GFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLAL--  172

Query  167  LKNAYSWQIYKACIPLSASARR  188
              +   WQ+YK C+PL  + ++
Sbjct  173  --HEPMWQVYKNCVPLKGNGQQ  192

>PITG_08202
Length=191

 Score = 77.0 bits (188),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 64/127 (50%), Gaps = 16/127 (13%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G   ++V+ F   +  N +K LR  M+ T   GAD  CGFTN N  PQP P DG A  S
Sbjct  57   DGNNAKSVDTFKSLKAANNFKDLRTLMDDTSVYGAD--CGFTNPNDTPQPIPSDGKATFS  114

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCK-GTCT-LRWYWLGVRFLKN  169
                H GPC +WLD    ++S           + +DYSSC  G C  +R+YWL  + L  
Sbjct  115  RALVHHGPCGIWLDDKMDIKS----------IFPVDYSSCSNGGCKQMRFYWLAFQGLNK  164

Query  170  AYSWQIY  176
               WQ Y
Sbjct  165  KTVWQSY  171

>PHYCA_122958
Length=260

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 64/121 (53%), Gaps = 13/121 (11%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFT--NVNAAPQPNPDGAMRSTGY--THDGPCEVWLD  125
            N GY +LR+ ++  V+D A+     +  +V+     N        G+  +H GPCEVW+D
Sbjct  75   NTGYSSLRNMLDQQVSDCANTKTDVSPVDVSGLTVMNWQNDQEQKGFIDSHHGPCEVWID  134

Query  126  STRVLQSDNCHETIIGKTY----NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIP  181
             T V   D+C  T  G +Y      DYS C G CTLR+YWL +       +WQIYK C+P
Sbjct  135  DTMVDHQDDCVAT-YGSSYPANVKADYSQCSGDCTLRFYWLALH----EPNWQIYKQCVP  189

Query  182  L  182
            +
Sbjct  190  I  190

>PYU1_G005985
Length=200

 Score = 77.0 bits (188),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 70/148 (47%), Gaps = 20/148 (14%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAP---------QPN  104
            +G   E  + F       GY +L+  ++  VA G    CG + V+  P         +  
Sbjct  61   DGSPQENTQQFTSGFHAAGYSSLKALLD-PVAPG----CGNSRVDVPPVGVSRLAAMEFR  115

Query  105  PDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWL  162
             D        +H GPCEVW+D+ R+   D+C     G   T  +++S C+G CTL +YWL
Sbjct  116  NDEFHEGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWL  175

Query  163  GVRFLKNAYSWQIYKACIPLSASARRLE  190
             +    +  +WQ+YK C+P+    +RL 
Sbjct  176  AL----HEPTWQVYKQCVPIENQGKRLR  199

>PPTG_18166
Length=445

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 73/146 (50%), Gaps = 22/146 (15%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM----  109
            G G + V  F    +  G  +++D +   V D     CG T  N +P+P P DG +    
Sbjct  51   GSGGDQVGKFKTMAKEKGM-SVKDVVLDMVKD---QKCGNTVENGSPKPIPSDGKVKWFG  106

Query  110  -RSTGYTHDGPCEVWLDSTRVLQSDNCHE--------TIIGKTYNLDYSSCKGTCTLRWY  160
             R  G+TH GPCE++LD   VL  D+C E        +  G    +D+SSC G CTL  Y
Sbjct  107  HRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIY  166

Query  161  WLGVRFLKNAYSWQIYKACIPLSASA  186
            WL     +NA  WQ Y  C+PLS S+
Sbjct  167  WLA---FQNAQ-WQTYVNCVPLSGSS  188

>PHYKE_2539
Length=258

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 63/125 (50%), Gaps = 21/125 (17%)

Query  70   NNGYKTLRDFMEYTVADGADY--------YCGFTNVNAAPQPNPDGAMRSTGYTHDGPCE  121
            N GY +LRD ++  V D A+           G T +N        G + S    H GPCE
Sbjct  65   NAGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTTMNWQNDQEQKGFIDS----HHGPCE  120

Query  122  VWLDSTRVLQSDNCHETIIGKTY----NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYK  177
            VW+D T V   D+C  T  G  Y    N D+S C G CTLR+YW+ +    +  +WQIYK
Sbjct  121  VWIDDTLVDHQDDCVAT-YGSGYPASVNADFSKCSGDCTLRFYWIAL----HEPNWQIYK  175

Query  178  ACIPL  182
             C+P+
Sbjct  176  QCVPV  180

>PPTG_03160
Length=379

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 16/143 (11%)

Query  53   LEGQGYETVEDFNGWRRNNGYKTLRDFM---EYTVADGADYYCGFTNVNAAPQPNPDGAM  109
              G   + V  F     ++ YK+L++++      +  GA   CG  +    PQP P   +
Sbjct  56   FNGAPKDNVAAFTKAFTSSKYKSLKEYVTDKAKIIVSGATLTCGSCDPKQEPQPMPKSTV  115

Query  110  R-----STGYT--HDGPCEVWLDSTRVLQSDNC--HETIIGKTYNLDYSSCKGTCTLRWY  160
                  S G+T  H+GPCEVW D  R  Q D+C  H T++      D  +C G  TL +Y
Sbjct  116  EWSHSDSEGFTPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFY  175

Query  161  WLGVRFLKNAYSWQIYKACIPLS  183
            W+ +    ++ SWQ+Y  C PL+
Sbjct  176  WMAM----HSSSWQVYVNCAPLA  194

>PHYSO_255975
Length=187

 Score = 76.3 bits (186),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 65/128 (51%), Gaps = 9/128 (7%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRV  129
            N GY +LRD ++  VAD A+     + V+ A          +   +H GPCEVW+D   V
Sbjct  64   NTGYSSLRDMLDQQVADCANTRIDVSPVDVAGLTVVTWENGNGITSHRGPCEVWVDDIVV  123

Query  130  LQSDNCHETIIGKT---YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL--SA  184
               D+C  T    T      ++S C G CTLR+YWL +   K    WQIYK C+P+  ++
Sbjct  124  NHQDDCVATYGAGTQIKVPANFSKCLGDCTLRFYWLALHEPK----WQIYKQCVPIVNNS  179

Query  185  SARRLEVA  192
             AR L  A
Sbjct  180  GARALRTA  187

>PHYCA_69583
Length=224

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 55/104 (53%), Gaps = 12/104 (12%)

Query  92   CGFTNVNA-APQPNPDG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYN----  145
            CGF+N +A A  P  DG A    G  H GPCE+WLD   VL +D+C +      Y     
Sbjct  96   CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKS  155

Query  146  ----LDYSSCKGT-CTLRWYWLGVR-FLKNAYSWQIYKACIPLS  183
                +DYSSC  + C  R+YWL  +      Y WQIYK CIPL+
Sbjct  156  VFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLT  199

>SPRG_07799
Length=345

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 70/131 (53%), Gaps = 14/131 (11%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAA-PQPNPD------GAMRS  111
            +   DF    + + +KTL+D +E   + G    CG T ++ + PQ  P       G    
Sbjct  64   DNTADFTKHFKASRFKTLKDLIESQPSGGE---CGITKLDPSKPQALPSVVRWRHGDNEG  120

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAY  171
               +H+GPCE+W D+TRV  ++NC + I   +  +D + C G  TLR++WL +    ++ 
Sbjct  121  FTPSHEGPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----HSS  176

Query  172  SWQIYKACIPL  182
            SWQ+YK C+ L
Sbjct  177  SWQVYKNCVAL  187

>PHYKE_8104
Length=86

 Score = 73.2 bits (178),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)

Query  23  PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
           PTA AHQ+VLLP PT+TT+DKDTKY PL FLEG+G+   EDF  WR  NGYK+LRDFM+
Sbjct  23  PTADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMD  81

>HYAP_14170
Length=266

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 63/131 (48%), Gaps = 21/131 (16%)

Query  64   FNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQP---------NPDGAMRSTGY  114
            F     N GYK+LRD ++  V       C  T  + AP             D   +    
Sbjct  59   FKSSFANAGYKSLRDMLDQQVPG-----CANTRTDVAPVDVAGLTVMNWQNDKEHKGFID  113

Query  115  THDGPCEVWLDSTRVLQSDNC---HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAY  171
            +H GPCE W+D T V + D+C   + T    + N D+S C G CTLR+YWL +  +    
Sbjct  114  SHHGPCETWIDDTMVDRQDDCVATYGTGFPASVNADFSRCSGVCTLRFYWLALHEV----  169

Query  172  SWQIYKACIPL  182
            +WQ+YK C+P+
Sbjct  170  NWQVYKQCVPI  180

>PHYRA_86151
Length=170

 Score = 75.5 bits (184),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 4/74 (5%)

Query  50   LTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNP-  105
            L+FLE +G+ET E+F  ++ +NGY +LRDF++   Y V+DGAD  CG+++    PQ  P 
Sbjct  29   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  88

Query  106  DGAMRSTGYTHDGP  119
            DG M  +GYTHD P
Sbjct  89   DGTMSPSGYTHDAP  102

>SPRG_07796
Length=322

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 10/130 (8%)

Query  73   YKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGY-----THDGPCEVWLDST  127
            ++TL  F++          CG TN   A QP P     + G      +H+GPCEVW DST
Sbjct  74   FRTLAAFVDSQNVASCGR-CGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCDST  132

Query  128  RVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASAR  187
            RV Q+DNC         ++D + C G   LR  WL +    +  SWQ+Y  C+PLS S  
Sbjct  133  RVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPLSGSTV  188

Query  188  RLEVAANKSV  197
             +  AA+ S+
Sbjct  189  VIPPAASPSM  198

>PHYRA_87941
Length=157

 Score = 75.1 bits (183),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 4/74 (5%)

Query  50   LTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNP-  105
            L+FLE +G+ET E+F  ++ +NGY +LRDF++   Y V+DGAD  CG+++    PQ  P 
Sbjct  16   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  75

Query  106  DGAMRSTGYTHDGP  119
            DG M  +GYTHD P
Sbjct  76   DGTMSPSGYTHDAP  89

>PPTG_07516
Length=294

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 70/142 (49%), Gaps = 22/142 (15%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR---  110
            G G + +  F    +  G  +++D +   V D     CG T  N  PQP P DG ++   
Sbjct  51   GSGGDQIGKFKAMAKEKGM-SVKDVVLDMVKD---QKCGNTLENGDPQPIPADGKVKWHG  106

Query  111  --STGYTHDGPCEVWLDSTRVLQSDNCHETIIG------KTYNL--DYSSCKGTCTLRWY  160
                G+TH GPCE++LD   VL  D+C +   G      +T ++  D+SSC G C L  Y
Sbjct  107  NEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIY  166

Query  161  WLGVRFLKNAYSWQIYKACIPL  182
            WL     +NA  WQ Y  C+PL
Sbjct  167  WLA---FQNAQ-WQTYVNCVPL  184

>PHYRA_84732
Length=265

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 13/121 (11%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFT--NVNAAPQPNPDGAMRSTGY--THDGPCEVWLD  125
            N GY +LRD ++  V D A+     +  +V+     N        G+  +H GPCEVW+D
Sbjct  78   NAGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTVLNWQNDQEQKGFIDSHHGPCEVWID  137

Query  126  STRVLQSDNCHETIIGKTY----NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIP  181
             T+V   D+C  T  G  Y    + D+S C G CTLR+YWL +    +  +WQ+YK C+P
Sbjct  138  DTKVDHQDDCVAT-YGSGYPASVSADFSKCSGDCTLRFYWLAL----HEPNWQVYKQCVP  192

Query  182  L  182
            +
Sbjct  193  V  193

>PPTG_07520
Length=294

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 70/142 (49%), Gaps = 22/142 (15%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR---  110
            G G + +  F    +  G  +++D +   V D     CG T  N  PQP P DG ++   
Sbjct  51   GSGGDQIGKFKAMAKEKGM-SVKDVVLDMVKD---QKCGNTLENGDPQPIPADGKVKWHG  106

Query  111  --STGYTHDGPCEVWLDSTRVLQSDNCHETIIG------KTYNL--DYSSCKGTCTLRWY  160
                G+TH GPCE++LD   VL  D+C +   G      +T ++  D+SSC G C L  Y
Sbjct  107  NEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIY  166

Query  161  WLGVRFLKNAYSWQIYKACIPL  182
            WL     +NA  WQ Y  C+PL
Sbjct  167  WLA---FQNAQ-WQTYVNCVPL  184

>PPTG_10186
Length=270

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 11/120 (9%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFT--NVNAAPQPNPDGAMRSTGY--THDGPCEVWLD  125
            N GY +LRD ++  V D A+     +  +V+     N        G+  +H GPCEVW+D
Sbjct  78   NAGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLSVMNWQNDQEQKGFIDSHHGPCEVWID  137

Query  126  STRVLQSDNC---HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
             T V   D+C   + T    +   D+S C G CTLR+YWL +       +WQIYK C+P+
Sbjct  138  DTMVDHQDDCVAAYGTGYPASVKADFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPI  193

>SDRG_16534
Length=320

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 69/146 (47%), Gaps = 17/146 (12%)

Query  51   TFLEGQGYETVEDFNGWR-----RNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP  105
            T L G  YE   D+N  +     + + +KTL+ F++     G D  CG T+ N   QP P
Sbjct  49   TVLPGSSYEQGPDWNTDQFTKHFKASSFKTLKAFLD-AYPTGGD--CGITDSNGPAQPLP  105

Query  106  DGAMRSTGY-----THDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWY  160
                 + G      +H GPCE+W D TRV Q DNC   +     ++D S C G   L   
Sbjct  106  STVKWANGQEGFISSHQGPCELWCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTML  165

Query  161  WLGVRFLKNAYSWQIYKACIPLSASA  186
            WL +   +    WQ+YK C+ LS  A
Sbjct  166  WLALHTPE----WQVYKNCVNLSGVA  187

>PPTG_03139
Length=320

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 67/132 (51%), Gaps = 16/132 (12%)

Query  63   DFNGWRRNNGYKTLRDFM-EYTVADGADYY--CGFTNVNAAPQPNPD-------GAMRST  112
            +FN     + Y +L++FM +  V    D+   CG+TN +  PQP P+       G+    
Sbjct  68   NFNKGFAASKYSSLKEFMTDKMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGF  127

Query  113  GYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNL--DYSSCKGTCTLRWYWLGVRFLKNA  170
              +H+GPCEVW D TRV Q DNC +        L  D+ +C G+  L  YW+ +    ++
Sbjct  128  TASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HS  183

Query  171  YSWQIYKACIPL  182
             SWQ+Y  C  L
Sbjct  184  PSWQVYINCAAL  195

>PYU1_G001519
Length=265

 Score = 76.3 bits (186),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 56/125 (45%), Gaps = 10/125 (8%)

Query  64   FNGWRRNNGYKTLRDFM---EYTVADGADYYCGFTNVNAAPQPNPDGAM-RSTGYTHDGP  119
               ++    YK+L+D        V  GA   CGF++VN  PQP PD         +H GP
Sbjct  71   LKAFKAQTKYKSLKDLAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGP  130

Query  120  CEVWLDSTRVLQSDNCHETI--IGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYK  177
            CEVW D   V Q DNC   I  +      D + C G   L  +W+ +       +WQIY 
Sbjct  131  CEVWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHVP----TWQIYT  186

Query  178  ACIPL  182
             C P+
Sbjct  187  NCAPI  191

>PYU1_G005873
Length=214

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 70/143 (49%), Gaps = 20/143 (14%)

Query  59   ETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDGAMR------S  111
            +  + F       GYK+L+  M+  V       CG++  + AP   +   +M+       
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMDKAVPG-----CGYSRTDIAPVDVSRMSSMKFQNNEYK  120

Query  112  TGY--THDGPCEVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFL  167
             G+  +H GPCE W+D+TRV   D+C     G   T  + + +CKGTC L +YWL +   
Sbjct  121  EGFLASHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSP  180

Query  168  KNAYSWQIYKACIPLSASARRLE  190
            K    WQ YK+C+P+  +A   E
Sbjct  181  K----WQAYKSCVPIKYNAYSAE  199

>PYIW_18790
Length=86

 Score = 71.6 bits (174),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 3/78 (4%)

Query  31   VLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVA---DG  87
            VLLP PT+T   +  ++ PL FLE QG++T  DF  + R+ GYKTLRDFM+   A   DG
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVDG  64

Query  88   ADYYCGFTNVNAAPQPNP  105
             D+ CG++ +   PQP P
Sbjct  65   GDFECGWSTLKGTPQPIP  82

>PITG_20312
Length=270

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 63/124 (51%), Gaps = 19/124 (15%)

Query  70   NNGYKTLRDFMEYTVADGADY--------YCGFTNVNAAPQPNPDGAMRSTGYTHDGPCE  121
            N GY +LRD ++  VAD A+           G + +N        G + S    H GPCE
Sbjct  78   NAGYSSLRDMLDQQVADCANTRTDGSPVDVSGLSLINWQNDEEQKGFIDS----HHGPCE  133

Query  122  VWLDSTRVLQSDNCHETI-IGKTYNL--DYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            VW+D T V   ++C  T   G   N+  D+S C G CTLR+YWL +       +WQIYK 
Sbjct  134  VWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALH----EPNWQIYKQ  189

Query  179  CIPL  182
            C+P+
Sbjct  190  CVPI  193

>PHYKE_10295
Length=292

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 23/142 (16%)

Query  73   YKTLRDFMEYTVADGADYYCGFTNVNAAPQP---------NPDGAMRSTGYTHDGPCEVW  123
            +KTLR  M+    D     CG T +  +P             D   +    +H GPCE W
Sbjct  75   FKTLRALMDTVAPD-----CGNTALTGSPVDVSALSSMKWQNDQEQKGFIDSHHGPCEAW  129

Query  124  LDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIP  181
            +D TRV+QSD+C            +DYSSC G CT  +YW+ +    +  +WQ+YK C P
Sbjct  130  IDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMAL----HEPNWQVYKQCAP  185

Query  182  L---SASARRLEVAANKSVVFD  200
            +   S   +  +  A+KS   D
Sbjct  186  ITNGSGGGQSSKTGASKSTTTD  207

>PYVX_16138
Length=559

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 69/152 (45%), Gaps = 26/152 (17%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQ--PNPDGAMRST  112
            G   ++V+ +       G   +R  ++ T   GAD  CG+T+ +   Q  P    A  S 
Sbjct  58   GNSQDSVDTYVSLAEEKGVTQIRSLLDDTSIYGAD--CGYTDPDGTAQDIPTDSTATFSR  115

Query  113  GYTHDGPCEVWLDSTRVLQSDNCHETIIG------KTYNLDYSSC--KGTCTLRWYWLGV  164
            G  H GPCE+WLD T VL  D+C+ T  G        + +DYSSC   G   +R+YWL  
Sbjct  116  GMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAF  175

Query  165  RFLKNAYSWQIYKA--------------CIPL  182
            + + +   WQ+Y                CIPL
Sbjct  176  QGVDDETVWQVYSVMSAQLTAMRDFTEDCIPL  207

>PITG_20631
Length=270

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 21/125 (17%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQP---------NPDGAMRSTGYTHDGPC  120
            N GY +LRD ++  VAD     C  T  + +P             D   +    +H GPC
Sbjct  78   NAGYSSLRDMLDQQVAD-----CANTRTDGSPVDVSGLSLMNWQNDEEQKGFIDSHHGPC  132

Query  121  EVWLDSTRVLQSDNCHETI-IGKTYNL--DYSSCKGTCTLRWYWLGVRFLKNAYSWQIYK  177
            EVW+D T V   ++C  T   G   N+  D+S C G CTLR+YWL +       +WQIYK
Sbjct  133  EVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALH----EPNWQIYK  188

Query  178  ACIPL  182
             C+P+
Sbjct  189  QCVPI  193

>PYVX_20783
Length=276

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 81/174 (47%), Gaps = 26/174 (15%)

Query  25   ATAHQVVLLPSPtyttddkdtkyAPLTFLE----------GQGYETVEDFNGWRRNNGYK  74
            A+ H  +++P PT  +D       P   ++          G  Y+ V+D   W   NG  
Sbjct  20   ASGHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDD---WFTANGIS  76

Query  75   TLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR--STGYTHDGPCEVWLDSTRVLQ  131
            +L+   EY    G+   CG T  +  PQP P DG  +  + G +H GPCE+W D TRV  
Sbjct  77   SLK---EYITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFT  133

Query  132  SDNCHETIIGKT---YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            S NC     G++     +D ++C G+    +YWL +     A  WQ+Y  C+ L
Sbjct  134  STNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQVYINCVAL  183

>PYIR_24743
Length=357

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 68/129 (53%), Gaps = 21/129 (16%)

Query  66   GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAM------RSTGY--TH  116
             ++  + +KTLRD ++   AD     CG +  +A+ +  P DG +         G+  +H
Sbjct  80   AFQGQSEFKTLRDLLKDHGAD-----CGDSKPDASRKAIPGDGKVVWQNPDTGEGFVPSH  134

Query  117  DGPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
             GPCE+WLD  RV   +NC      K      +D+SSCK  C LR+YWL +    +  +W
Sbjct  135  TGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HEPTW  190

Query  174  QIYKACIPL  182
            Q+YK C+PL
Sbjct  191  QVYKNCVPL  199

>PYIR_24421
Length=213

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 24/152 (16%)

Query  54   EGQGY---------ETVEDFNGWRRNNGYKTLRDFM--EYTVADGADYYCGFTNVNAAPQ  102
            +G GY            + F    +++ YK++RD +  + +   GA   CG ++ + A Q
Sbjct  23   DGHGYMSSFTTDPSSNAKAFTAALKSSSYKSVRDLVNAKASFISGASKECGISSSSGAKQ  82

Query  103  PNPDGAMR-----STGYT--HDGPCEVWLDSTRVLQSDNCHETIIGKTYNL--DYSSCKG  153
            P P   +      S G+T  H+GPCEVW D+     +DNC +        L  D S C G
Sbjct  83   PLPAQYVEWAHSSSEGFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSG  142

Query  154  TCTLRWYWLGVRFLKNAYSWQIYKACIPLSAS  185
               LR+YW+ +    ++ +WQ+Y  C PLS +
Sbjct  143  ASMLRFYWVAL----HSSTWQVYINCAPLSGA  170

>PYAP_18226
Length=226

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 21/143 (15%)

Query  69   RNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQP-------NPDGAMRSTGY--THDGP  119
            + +G K+LR  M+  V       CG TN N  P+        N        G+  +H GP
Sbjct  78   KQSGLKSLRQLMDKYVPG-----CGNTNPNTTPRDVTKLKTMNWQNNEYKEGFLASHRGP  132

Query  120  CEVWLDSTRVLQSDNCHETIIGKTYNL--DYSSCKGT-CTLRWYWLGVRFLKNAYSWQIY  176
            CEVW+D+TRV Q+++C         +L  DYS CK + C LR+YWL +   K    WQ Y
Sbjct  133  CEVWIDNTRVFQNNDCAGNYKSYPASLPVDYSKCKSSKCMLRFYWLALHSEK----WQAY  188

Query  177  KACIPLSASARRLEVAANKSVVF  199
            K C+P+   A R     ++S  F
Sbjct  189  KQCVPIKYGASRSMDDEDESYSF  211

>PYIW_15528
Length=311

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 24/150 (16%)

Query  67   WRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGY-----------T  115
            ++    YKTL+DF +  V D A+       V+ +       AM+   Y           T
Sbjct  78   FKNQTTYKTLKDFGDTFVKDCANTRLDVPAVDVS-------AMKELKYQNDEKQMGVINT  130

Query  116  HDGPCEVWLDSTRVLQSDNC--HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSW  173
            H GPCE+W++ TRV Q+++C  +       + +DYS CKG CT+ +Y L V  LK    W
Sbjct  131  HHGPCEIWIEKTRVFQTNDCRGYTDAYPAVFPVDYSVCKGDCTITFYLLAVHELK----W  186

Query  174  QIYKACIPLSASARRLEVAANKSVVFDPTA  203
            QIY     +S S      +   + VF P A
Sbjct  187  QIYSKLPSVSVSTLSTRASILTTSVFPPCA  216

>PYAP_18138
Length=268

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 61/111 (55%), Gaps = 9/111 (8%)

Query  69   RNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTR  128
            + +G K LR +++  + +  D      +V+  P P  +        TH GPCE W+D TR
Sbjct  80   KQHGVKDLRSYIDAKITECGD---SLKDVSPKPIPKTNTVTFERALTHKGPCEFWIDDTR  136

Query  129  VLQSDNCHETIIGK-TYNLDYSSCKG-TCTLRWYWLGVRFLKNAYSWQIYK  177
            V Q+++C      K T  LDYS C G TC LR+YWLG   L+N+  WQ+Y+
Sbjct  137  VFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLG---LQNS-DWQVYR  183

>PHYSO_476077
Length=268

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (49%), Gaps = 13/135 (10%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAPQP----NPDGAMRSTGYTHDGPCEVWLDST  127
            GY +LRD ++  V D A+     + V+ +         D   +    +H GPCEVW+D T
Sbjct  80   GYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSHHGPCEVWIDDT  139

Query  128  RVLQSDNCHETIIGKTY----NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
             V   D+C     G  Y    N D+S C G CTLR+YWL +    +  +WQIYK C+P+ 
Sbjct  140  MVEHQDDC-VAKYGSGYPAKVNADFSKCSGDCTLRFYWLAL----HEPNWQIYKQCVPVV  194

Query  184  ASARRLEVAANKSVV  198
            + +         +VV
Sbjct  195  SGSGAQTTMVQGTVV  209

>PHYSO_472009
Length=268

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (49%), Gaps = 13/135 (10%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAPQP----NPDGAMRSTGYTHDGPCEVWLDST  127
            GY +LRD ++  V D A+     + V+ +         D   +    +H GPCEVW+D T
Sbjct  80   GYSSLRDMLDQQVTDCANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSHHGPCEVWIDDT  139

Query  128  RVLQSDNCHETIIGKTY----NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183
             V   D+C     G  Y    N D+S C G CTLR+YWL +    +  +WQIYK C+P+ 
Sbjct  140  MVEHQDDC-VAKYGSGYPAKVNADFSKCSGDCTLRFYWLAL----HEPNWQIYKQCVPVV  194

Query  184  ASARRLEVAANKSVV  198
            + +         +VV
Sbjct  195  SGSGAQTTMVQGTVV  209

>PYVX_22511
Length=303

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 69/128 (54%), Gaps = 15/128 (12%)

Query  70   NNGYKTLRDFM--EYTVADGADYYCGFTNVNAAPQPNPDGAMR-----STGYT--HDGPC  120
             +GY TL++++  + T+  GA   CG    +A PQP P   +      + G T  H GPC
Sbjct  31   TSGYSTLKNYVNVKMTLIPGATEECGLAIPDATPQPLPAKYVEWYHSPTEGLTESHHGPC  90

Query  121  EVWLDSTRVLQSDNC--HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            E++  +TRV ++D+C  H   I   +  D +SC G   L +YWL +    + Y WQ+Y  
Sbjct  91   EIYCGNTRVFKNDDCSTHYKTIPAQFPYDRASCLGASHLTFYWLTL----HEYQWQVYIN  146

Query  179  CIPLSASA  186
            C+PL A++
Sbjct  147  CVPLVATS  154

>SDRG_00948
Length=352

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 14/117 (12%)

Query  73   YKTLRDFMEYTVADGADYYCGFTNVNAA-PQPNPD------GAMRSTGYTHDGPCEVWLD  125
            +KTL+D +E   + G    CG T ++ + PQ  P       G       +H+GPCE+W D
Sbjct  78   FKTLKDLIESQPSGGE---CGITKLDPSKPQALPSVVRWRHGDNEGFTPSHEGPCELWCD  134

Query  126  STRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182
            +TRV  ++NC + I   +  +D + C G  TLR++WL +    ++ SWQ+YK C+ L
Sbjct  135  NTRVYDNENCAKNIADGSMPIDTAKCAGAKTLRFFWLAL----HSSSWQVYKNCVAL  187

>PPTG_03153
Length=314

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 62/139 (45%), Gaps = 15/139 (11%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNPDGA---  108
            G   + V  F     ++ YK+L+  ++     +  GA   CG  +  A PQP P      
Sbjct  57   GAPADNVAAFTKAFESSKYKSLKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWY  116

Query  109  -MRSTGYT--HDGPCEVWLDSTRVLQSDNC--HETIIGKTYNLDYSSCKGTCTLRWYWLG  163
               S G+T  H+GPCEVW D  RV   DNC  H T        + S C G   L  YW+ 
Sbjct  117  HSESEGFTATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVA  176

Query  164  VRFLKNAYSWQIYKACIPL  182
            +    +  SWQ+Y  C PL
Sbjct  177  M----HGPSWQVYVNCAPL  191

>PHYCA_103479
Length=314

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 72/165 (44%), Gaps = 38/165 (23%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTG  113
            +G   +  + F       GYK+LR+ ++    D      GF+   A P       +  TG
Sbjct  57   DGSPSQNAQVFADHWNATGYKSLREMVDPIATD-----YGFSVKTATP-------VDVTG  104

Query  114  YT----------------HDGPCEVWLDSTRVLQSDNCHETIIGKTY----NLDYSSCKG  153
            YT                H+GPCE W+D TR+   DNC      KTY      DYSSCKG
Sbjct  105  YTEMWWQNDEYKEGFIASHEGPCEGWIDDTRIFHYDNCAAQF--KTYPAKIPADYSSCKG  162

Query  154  TCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198
             C   +YWL +    +  +WQIYK C+P++ +        +  VV
Sbjct  163  DCLFSFYWLAL----HEPNWQIYKQCVPITNNGSGATTTTDAPVV  203

>PYVX_24563
Length=254

 Score = 74.3 bits (181),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 67/131 (51%), Gaps = 28/131 (21%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-----------QPNPDGAMRSTGY--TH  116
            + GY +LR  ++ +V+D     CG T  + +P           Q + +G     G+  +H
Sbjct  75   STGYTSLRAMIDESVSD-----CGNTRTDVSPVDMTGKKVLHWQNDQEGV----GFVSSH  125

Query  117  DGPCEVWLDSTRVLQSDNCHETIIGKTYNL--DYSSCKGTCTLRWYWLGVRFLKNAYSWQ  174
             GPCEVW+D   V   D+C         N+  D+S C G+CTLR+YWL +    +  +WQ
Sbjct  126  HGPCEVWIDDVMVTHQDDCRAVYTSYPANVDADFSKCSGSCTLRFYWLAL----HEPNWQ  181

Query  175  IYKACIPLSAS  185
            IYK C P++ S
Sbjct  182  IYKQCAPITNS  192

>HYAP_11923
Length=606

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 66/145 (46%), Gaps = 18/145 (12%)

Query  66   GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPD----GAMRSTGYT--HDGP  119
            G  + +  K L   +   VA GA   CG T+ N  PQP PD        + G+T  H+GP
Sbjct  75   GSSKFSSIKDLATSLGQIVAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGP  134

Query  120  CEVWLDSTRVLQSDNC--HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYK  177
            CE W D T+V Q +NC  H T        D + C G     +YWL +     + +WQ+Y 
Sbjct  135  CEAWCDDTQVFQDENCAAHFTTAPAKMPYDKAKCSGASRFTFYWLALH----SSTWQVYV  190

Query  178  ACIPLSA------SARRLEVAANKS  196
             C  L        S  + EV A++S
Sbjct  191  NCAALEGGSGDMYSTSQTEVNASES  215

>PPTG_04617
Length=496

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 59/109 (54%), Gaps = 13/109 (12%)

Query  87   GADYYCGFTNVNAAPQPNP-DG-AMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTY  144
            GAD  C +++  A P+ +P DG A  S G  H GPCE+WLD   VL  D+C +T     Y
Sbjct  64   GAD--CEYSDPKADPKTSPSDGTATFSRGIAHHGPCEIWLDDKMVLHDDDCEKTFGTADY  121

Query  145  N--------LDYSSCKGT-CTLRWYWLGVRFLKNAYSWQIYKACIPLSA  184
                     +DYSSC  + C  R+YW+  +   N Y  QIY+ C+PL+ 
Sbjct  122  MTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVPLTG  170

>PPTG_01148
Length=295

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 20/125 (16%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQP---------NPDGAMRSTGYTHDGPC  120
            N+ +KTL+  M+   +D     CG T++  +P             D   +    +H GPC
Sbjct  72   NSKFKTLKAMMDTVASD-----CGKTSLTGSPVDVSSLSSMTWQNDQEQKGFIDSHRGPC  126

Query  121  EVWLDSTRVLQSDNCHETIIG--KTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            E W+D TRV  SD+C     G      +D+SSC G CT  +YWL +    +  +WQ+YK 
Sbjct  127  EGWIDDTRVFHSDDCRADYTGYPAEIPVDFSSCSGDCTFTFYWLAL----HEPNWQVYKQ  182

Query  179  CIPLS  183
            C P++
Sbjct  183  CAPIT  187

>PPTG_07521
Length=281

 Score = 74.3 bits (181),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 64/130 (49%), Gaps = 24/130 (18%)

Query  73   YKTLRDFMEYTVAD------GADYYCGFTNVNAAPQPNP-DGAMR-----STGYTHDGPC  120
            +KT+ +    TV D      GA   CG T  +   QP P DG  +       G+TH GPC
Sbjct  61   FKTMAEEKNVTVKDVVLDMVGAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPC  120

Query  121  EVWLDSTRVLQSDNCHETI----IGKTYN----LDYSSCKGTCTLRWYWLGVRFLKNAYS  172
            E++LD   VL  DNC +      +G T      +DYSSC   CTL  YWL     +NA +
Sbjct  121  EIYLDDKMVLHGDNCEDEYPGGDVGSTVTSDMPVDYSSCTEDCTLTIYWLA---FQNA-N  176

Query  173  WQIYKACIPL  182
            WQ Y  C+PL
Sbjct  177  WQAYINCVPL  186

>PYAR_16493
Length=256

 Score = 73.9 bits (180),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 8/118 (7%)

Query  73   YKTLRDFM--EYTVAD--GADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTR  128
            YKTL+D +  E TV     +D  CG T  + A +      ++ +G+TH GPCEVW D+T+
Sbjct  81   YKTLKDLIMGEQTVLTEYKSDAQCGLTTKDEAKRATLPATLKYSGFTHAGPCEVWCDNTK  140

Query  129  VLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
            +  +++C +T    T  +D S C+G   L  YW+ V    ++  WQ+Y  C+ L   +
Sbjct  141  LAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAV----HSEPWQVYTDCVYLKGGS  194

>PYVX_21297
Length=263

 Score = 73.9 bits (180),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 57/112 (51%), Gaps = 12/112 (11%)

Query  72   GYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRS--TGYTHDGPCEVWLDSTRV  129
            G   +RD      A+ A   CG T+ NAA QP P   + +      H GPCEVWLD T+V
Sbjct  52   GSDVIRDL-----ANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKV  106

Query  130  LQSDNCHETIIGKTYNLDYSSCKG-TCTLRWYWLGVRFLKNAYSWQIYKACI  180
              +++C  T   KT  +DYS C G +C LRW WL          W+I+  C+
Sbjct  107  ASANDCWSTYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCV  154

>PHYKE_3912
Length=252

 Score = 73.9 bits (180),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 54/105 (51%), Gaps = 10/105 (10%)

Query  92   CGFTNVNAAPQ--PNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYN----  145
            CGFT+ NA P+  P    A  S G  H G CE+WLD T VL SD+C       T      
Sbjct  75   CGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDTMVLSSDDCQAAYRDDTQEKASV  134

Query  146  ---LDYSSCKGTC-TLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186
               +D S C  +   LR+YWL  + + +   WQ+YK C+PL+  A
Sbjct  135  FTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCVPLTGPA  179

>PHYCA_112615
Length=196

 Score = 72.8 bits (177),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 65/127 (51%), Gaps = 16/127 (13%)

Query  54   EGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DG-AMRS  111
            +G    +V+ F   +  N +K L+  M+ T   GAD  CGFT+ N   QP P DG A  S
Sbjct  56   DGNKPGSVDAFKALKTANNFKDLKTLMDDTSVYGAD--CGFTDPNGKAQPIPSDGKATFS  113

Query  112  TGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSC-KGTCT-LRWYWLGVRFLKN  169
                H GPCE+WLD T+ ++S           + +DYSSC  G C  +R+YWL  + +  
Sbjct  114  RAIVHVGPCEIWLDDTKDIKS----------IFPVDYSSCDNGGCKEMRFYWLAFQGVDG  163

Query  170  AYSWQIY  176
               WQ Y
Sbjct  164  KTVWQSY  170

>PHYKE_6077
Length=322

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 64/140 (46%), Gaps = 16/140 (11%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFMEYTVADGADYY---CGFTNVNAAPQPNPD-----  106
            G   +   +FN     + Y +L++FM       +  +   CG+TN   A QP P+     
Sbjct  60   GAPKDNTANFNKGMAASKYTSLKEFMAAKAKVTSPEFTLECGYTNPKGAAQPLPETYVEW  119

Query  107  --GAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDY--SSCKGTCTLRWYWL  162
              G+      +H+GPCEVW D TRV Q DNC          L Y   +C G+  L  YW+
Sbjct  120  SHGSGEGFTSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWI  179

Query  163  GVRFLKNAYSWQIYKACIPL  182
             +    ++ SWQ+Y  C  L
Sbjct  180  AL----HSPSWQVYINCAAL  195

>SPRG_19917
Length=241

 Score = 73.6 bits (179),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 71/144 (49%), Gaps = 23/144 (16%)

Query  53   LEGQGYETVEDFN-GWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNP-DGAMR  110
              G       +FN  ++  + YKTLR  ++    D     CG T  N A +  P +G M 
Sbjct  52   FNGSPQNNAANFNKAFKAQSKYKTLRALLDQHGPD-----CGNTLTNVARKEIPSNGKMT  106

Query  111  ----STG----YTHDGPCEVWLDSTRVLQSDNCHETIIGK---TYNLDYSSCKGT-CTLR  158
                 TG     +H GPCEVWLD+ RV Q+D+C      K      +DYSSC    C LR
Sbjct  107  FQNPDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLR  166

Query  159  WYWLGVRFLKNAYSWQIYKACIPL  182
            +YW+ +    ++  WQ+YK C+PL
Sbjct  167  FYWIAL----HSPRWQVYKNCVPL  186

>PHYSO_262844
Length=276

 Score = 73.9 bits (180),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 20/124 (16%)

Query  70   NNGYKTLRDFMEYTVADGADYYCGFTNVNAAP-QPNPDGAMR------STGY--THDGPC  120
            N+ +KTLR  M+   +D     CG T +  +P   +   +M+        G+  +H GPC
Sbjct  72   NSQFKTLRAMMDTAASD-----CGNTALTGSPVDVSSLSSMKWQNDQEQMGFIDSHHGPC  126

Query  121  EVWLDSTRVLQSDNCHE--TIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKA  178
            E W+D TRV  SD+C    T       +DYS+C G CT  +YWL +    +  +WQ+YK 
Sbjct  127  EAWIDDTRVFHSDDCRAAYTSYPAEIPIDYSACSGDCTFTFYWLAL----HEPNWQVYKQ  182

Query  179  CIPL  182
            C P+
Sbjct  183  CAPI  186

>PHYCA_19598
Length=390

 Score = 74.7 bits (182),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 67/143 (47%), Gaps = 29/143 (20%)

Query  64   FNGWRRNN-----------GYKTLRDFM----EYTVADGADYYCGFTNVNAAPQPNPDGA  108
            FNG  ++N            YK+L+D      + TV+ GA   CG  +    PQP P+  
Sbjct  56   FNGAPKDNVAAYTKAFASSKYKSLKDLFTDKAKITVS-GATLTCGSCDPKEEPQPMPESI  114

Query  109  MR-----STGYT--HDGPCEVWLDSTRVLQSDNCHET--IIGKTYNLDYSSCKGTCTLRW  159
            +      S G+T  H+GPCEVW D  R  Q DNC     ++      D  +C G  TL +
Sbjct  115  VEWSHSDSEGFTPSHEGPCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTF  174

Query  160  YWLGVRFLKNAYSWQIYKACIPL  182
            YW+ +     + +WQ+Y  C PL
Sbjct  175  YWMAMH----SDTWQVYVNCAPL  193

>SDRG_17317
Length=122

 Score = 70.5 bits (171),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 8/78 (10%)

Query  115  THDGPCEVWLDSTRVLQSDNCHETIIGKT---YNLDYSSCKGT-CTLRWYWLGVRFLKNA  170
            +H GPCEVWLD  RV Q+D+C      K      +DYSSC G  C LR+YWL +    + 
Sbjct  41   SHTGPCEVWLDDKRVFQNDDCATNFPAKPAAHLPIDYSSCSGDGCMLRFYWLAL----HE  96

Query  171  YSWQIYKACIPLSASARR  188
              WQ+YK C+PL  +  +
Sbjct  97   PMWQVYKNCVPLEGNGEK  114

>PHYCA_19611
Length=531

 Score = 75.1 bits (183),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 66/140 (47%), Gaps = 16/140 (11%)

Query  55   GQGYETVEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNPDGAMR-  110
            G   +   +FN     + Y +L++FM      V       CG+TN   APQP P   +  
Sbjct  267  GSPADNTANFNKGMAASKYTSLKEFMNDKMVLVNKEFTKECGYTNPKEAPQPVPKTYVEW  326

Query  111  ----STGYT--HDGPCEVWLDSTRVLQSDNCHET--IIGKTYNLDYSSCKGTCTLRWYWL  162
                  G+T  H+GPCEVW D TRV Q DNC +   +I      D  +C G+  L  YW+
Sbjct  327  SHGDGEGFTQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWI  386

Query  163  GVRFLKNAYSWQIYKACIPL  182
             +    ++ SWQ+Y  C  L
Sbjct  387  AL----HSPSWQVYINCAAL  402

 Score = 30.4 bits (67),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query  115  THDGPCEVWLDSTRVLQSDNC---HETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAY  171
            T +GP  V      + + DNC   + T   K    D  +C G   L +YWL +    ++ 
Sbjct  75   TSNGPTVVAKALPPLTKDDNCAANYPTAPAK-VPYDRDACLGASRLTFYWLAL----HSS  129

Query  172  SWQIYKACIPL  182
            +WQ+Y  C  L
Sbjct  130  TWQVYTNCAAL  140

>PITG_19818
Length=147

 Score = 71.2 bits (173),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)

Query  23  PTATAHQVVLLPSPtyttddkdtkyAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME  81
           PTA AHQ+VLLP P +TT DKDTKY PL FLE QG++  +DF  WR  NGYK+LRDFM+
Sbjct  21  PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMD  79

Lambda      K        H        a         alpha
   0.319    0.134    0.440    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9339317703

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40