Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_00012101851858504e-117
PPTG_16671102092117432e-100
PHYCA_104436101811856682e-89
PHYRA_78819102002075782e-75
HYAP_01509102082114361e-53
PHYCA_97367203391911974071e-49
PPTG_07275203391841923759e-45
PHALS_10836102042063681e-43
PHYSO_554653102201033231e-36
PYVX_15869103312022587e-26
PYU1_G0032268196820678930.002
PYIW_1915781968262104870.015
PYAR_194629980111663810.037
HYAP_015081113258770.13
PYIR_144998196818663770.21
PHYRA_788181113469750.32
SPRG_0275745862847100770.45
PYAP_203999980113565740.46
SDRG_10804129647147142731.4
PYVX_15863918157683.6
PHYKE_57191113062655.9
PYVX_158671118771665.9
PHYSO_2965561113669648.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00012

Length=185
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00012                                                            332        4e-117
PPTG_16671                                                            290        2e-100
PHYCA_104436                                                          261        2e-89 
PHYRA_78819                                                           227        2e-75 
HYAP_01509                                                            172        1e-53 
PHYCA_97367                                                           161        1e-49 
PPTG_07275                                                            149        9e-45 
PHALS_10836                                                           146        1e-43 
PHYSO_554653                                                          129        1e-36 
PYVX_15869                                                            103        7e-26 
PYU1_G003226                                                          40.4       0.002 
PYIW_19157                                                            38.1       0.015 
PYAR_19462                                                            35.8       0.037 
HYAP_01508                                                            34.3       0.13  
PYIR_14499                                                            34.3       0.21  
PHYRA_78818                                                           33.5       0.32  
SPRG_02757                                                            34.3       0.45  
PYAP_20399                                                            33.1       0.46  
SDRG_10804                                                            32.7       1.4   
PYVX_15863                                                            30.8       3.6   
PHYKE_5719                                                            29.6       5.9   
PYVX_15867                                                            30.0       5.9   
PHYSO_296556                                                          29.3       8.7   

>PITG_00012
Length=185

 Score = 332 bits (850),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 185/185 (100%), Positives = 185/185 (100%), Gaps = 0/185 (0%)

Query  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITs  60
            MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITS
Sbjct  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITS  60

Query  61   srppssgsrsdspsNYSYeeeeeeRQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNY  120
            SRPPSSGSRSDSPSNYSYEEEEEERQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNY
Sbjct  61   SRPPSSGSRSDSPSNYSYEEEEEERQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNY  120

Query  121  VEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYN  180
            VEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYN
Sbjct  121  VEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYN  180

Query  181  MRYSR  185
            MRYSR
Sbjct  181  MRYSR  185

>PPTG_16671
Length=209

 Score = 290 bits (743),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 169/211 (80%), Gaps = 28/211 (13%)

Query  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITs  60
            MGLS+FFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGV RSPQMFNRWEH VKYNIT 
Sbjct  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60

Query  61   srppssgsrsdsps--------------------------NYSYeeeeeeRQVQFLFYGG  94
            SRPPSS     S                            NYSYEEE+E RQVQFLFYGG
Sbjct  61   SRPPSSLPPFASSQVGTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDE-RQVQFLFYGG  119

Query  95   SDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPM  154
            SDPPTPTS G LY S GYRSDMISNYVEPMSPAASIESPRI+HEMPCFFSPR+TPLQSPM
Sbjct  120  SDPPTPTSAGGLY-SNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFSPRDTPLQSPM  178

Query  155  SAPIYSPHLFKISEQRMSRRSTGYYNMRYSR  185
            SAPIYSPHLFKISEQR SRRSTGYY+MRYSR
Sbjct  179  SAPIYSPHLFKISEQRTSRRSTGYYSMRYSR  209

>PHYCA_104436
Length=181

 Score = 261 bits (668),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 158/185 (85%), Gaps = 4/185 (2%)

Query  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITs  60
            MG+S FF  +WD V +PFEDCTSCCDVLDPDYYRKTSPGV RSPQMFNRWE+ V+    S
Sbjct  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLS  60

Query  61   srppssgsrsdspsNYSYeeeeeeRQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNY  120
            S    SGS ++SP NYSYEEE+E RQVQFLFYGGSDPPTP SVG L+   GYRSDMISNY
Sbjct  61   SSGSRSGSSANSPLNYSYEEEDE-RQVQFLFYGGSDPPTPNSVGGLH-QNGYRSDMISNY  118

Query  121  VEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYN  180
            VEPMSPAASIESPRISHEMPCFFSPRNTP+QSPMSAPIYSPHLFKI+EQR +RRS GYY 
Sbjct  119  VEPMSPAASIESPRISHEMPCFFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYY-  177

Query  181  MRYSR  185
             R+SR
Sbjct  178  -RFSR  181

>PHYRA_78819
Length=200

 Score = 227 bits (578),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 156/207 (75%), Gaps = 29/207 (14%)

Query  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITs  60
            MG+SEFFHSVWD + RPFE+CTSCCDVLDP+YYRKTSPGV RSPQMFNR+ + VKY+ + 
Sbjct  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRF-NDVKYDFSK  59

Query  61   srppssgsrsdsp----------------------sNYSYeeeeeeRQVQFLFYGGSDPP  98
            SRPPSS   S S                        NYSYEEEEEER VQFLFYGGSDPP
Sbjct  60   SRPPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGSDPP  119

Query  99   TPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPI  158
            TPTS G     GGYRSDMISNYVEP+SPAA   SPRI+HEMPCFFSPRNTP QSPMSAPI
Sbjct  120  TPTSAGG---PGGYRSDMISNYVEPISPAA-FASPRINHEMPCFFSPRNTPAQSPMSAPI  175

Query  159  YSPHLFKISEQRMSRRSTGYYNMRYSR  185
            YSPHLFKI+EQR  R S G+Y+ RYSR
Sbjct  176  YSPHLFKIAEQR-HRHSAGHYS-RYSR  200

>HYAP_01509
Length=208

 Score = 172 bits (436),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 128/211 (61%), Gaps = 35/211 (17%)

Query  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITs  60
            MG+SE  +++  FVCRPF DC+SC DVLD  YY KTSPGV+ SPQMFNRWE+ VK+  T 
Sbjct  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKHGYTR  60

Query  61   srppssgsrsdspsNYSYeeeeee-----------------------------RQVQFLF  91
            SRP  S      P     +   +                              R+VQFLF
Sbjct  61   SRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLF  120

Query  92   YGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQ  151
            YGGSDPPTPTS G L  S GYRSDMIS+ V       SI SP+I+HE+PCFFSPR+TP +
Sbjct  121  YGGSDPPTPTSRGGLAASTGYRSDMISDAVS----LTSIRSPQINHEIPCFFSPRDTP-R  175

Query  152  SPMSAPIYSPHLFKISEQRMSRRSTGYYNMR  182
            S +SA +YSPH+FKI+EQ+  RR+    +MR
Sbjct  176  SSVSASMYSPHVFKITEQKQ-RRNARLRSMR  205

>PHYCA_97367
Length=191

 Score = 161 bits (407),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 127/197 (64%), Gaps = 24/197 (12%)

Query  1    MGLSEFFHSVWDFVCRPFEDCTSCCDVLD----PDYYRKTSPGVHRSPQMFNR--WEHGV  54
            MG+S+FF  VWDFVCRPFEDC SC +VLD    P YY KTSPGV R+P  F+R  W++ +
Sbjct  1    MGVSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDL  60

Query  55   KYNITssrppssgsrsdspsNY---------SYeeeeeeRQVQFLFYGGSDPPTPTSVGD  105
            KY+ + SRPP S S ++S   +         +    EE+ Q+QFLFY GSD     S  D
Sbjct  61   KYDFSLSRPPPSQSPANSRVVFPLSRSRSLSASRSLEEDEQIQFLFYSGSD----ISTSD  116

Query  106  LYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFK  165
               S GYRSD IS  ++P++     E PR+SHE+PCFFSPR+ PL +PMSAPIYSPHLF 
Sbjct  117  RLCSSGYRSDAISRPLQPIT-----EPPRLSHEIPCFFSPRDAPLMAPMSAPIYSPHLFM  171

Query  166  ISEQRMSRRSTGYYNMR  182
            ISEQR    S  Y N R
Sbjct  172  ISEQRGRSPSRHYSNRR  188

>PPTG_07275
Length=184

 Score = 149 bits (375),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 125/192 (65%), Gaps = 24/192 (13%)

Query  10   VWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNR--WEHGVKYNITs-------  60
            +WDF+ RPFEDC S CDVLDP YY KTSPGV R+P  F+R  WE+ +KY+ +        
Sbjct  1    MWDFLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFSLSRPPPSF  60

Query  61   -------srppssgsrsdspsNYSYeeeeeeRQVQFLFYGGSDPPTPTSVGDLYPSGGYR  113
                    +   S SRS S S     EEEEE+QVQFLFYGGSD  TP SVG L  S GYR
Sbjct  61   QSSSSGRMQFTLSRSRSQSRSASVLHEEEEEQQVQFLFYGGSDISTPVSVGKLC-SSGYR  119

Query  114  SDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRMSR  173
            SD+I   +  +S     + PRISHE+PCFFSPR+TP+ SPMSAPIYSPHLF+I+EQR   
Sbjct  120  SDVICTPMRLVS-----QPPRISHEIPCFFSPRDTPMMSPMSAPIYSPHLFQINEQRWRL  174

Query  174  RSTGYYNMRYSR  185
            R    +N RY +
Sbjct  175  RPR--HNGRYLK  184

>PHALS_10836
Length=204

 Score = 146 bits (368),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/206 (45%), Positives = 113/206 (55%), Gaps = 31/206 (15%)

Query  3    LSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEH----------  52
            +S F   +WD VC+PFE C +CCDVLDP YYRK SPG  R+PQMFN W++          
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKNTLTPSYP  60

Query  53   ----------GVKY------NITssrppssgsrsdspsNYSYeeeeeeRQVQFLFYGGSD  96
                       ++Y      N   +   S      S  + S  EEE E Q+ FLFYGGSD
Sbjct  61   TSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFYGGSD  120

Query  97   PPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRNTPLQSPMSA  156
              +P +VG  Y     R D+IS+  EP SP  SIESPRI H+MPCFFS    PLQ PMS 
Sbjct  121  SLSPKAVGKRY-----RRDIISDCQEPTSPVVSIESPRIDHKMPCFFSSTIAPLQFPMSD  175

Query  157  PIYSPHLFKISEQRMSRRSTGYYNMR  182
             IYS +L    +Q+  R  TG+ NMR
Sbjct  176  SIYSANLLGDIDQQGQRSGTGHCNMR  201

>PHYSO_554653
Length=220

 Score = 129 bits (323),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 79/103 (77%), Gaps = 7/103 (7%)

Query  85   RQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPA--ASIESPRISHEMPCF  142
            RQVQFLFYGGSDPPTPT  G  YPSG YRSDMIS Y++P  P   ASI SPRISHEMPCF
Sbjct  123  RQVQFLFYGGSDPPTPTG-GGAYPSG-YRSDMISKYIQPTEPISPASIASPRISHEMPCF  180

Query  143  FSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYNMRYSR  185
            FSPR TP  SPMSAPIYSPHLFKI+EQR   R+  YY    SR
Sbjct  181  FSPRTTPT-SPMSAPIYSPHLFKITEQRT--RNAEYYRRYTSR  220

 Score = 108 bits (270),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)

Query  1   MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNI  58
           MGLSEFF  +WD V  PFEDCTSCCDVLDPDYYRKTSPGV R+PQMFNRW+H VK+++
Sbjct  1   MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDV  58

>PYVX_15869
Length=331

 Score = 103 bits (258),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 105/202 (52%), Gaps = 30/202 (15%)

Query  3    LSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITs--  60
            LS ++ S   F+  PF DC + CD+  P      SPGV   PQ F R +  +KY+ T+  
Sbjct  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200

Query  61   ---------srppssgsrsdspsNYSYeeeeeeRQVQFLFYGGSDPPTPTSVGDLYPSGG  111
                     S P  S     S  ++   ++  ++  QFLFY GSDP TPTS   L    G
Sbjct  201  ISSSAASKSSSPARSTRSKTSSDSFLSYDDPYDQPTQFLFYCGSDPLTPTSA-QLAARNG  259

Query  112  YRSDMISNYVEPMSPAASIE--------SPRISHEMPCFFSPRNTPLQSPMSAPIYSPHL  163
             ++D IS Y    +P A  E        SPRISH++P FFSPRN P  SP +AP+YSPHL
Sbjct  260  LKTDTISGY----TPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPT-SPAAAPLYSPHL  314

Query  164  FKISEQRMSRRSTGYYNMRYSR  185
            F+I+E     R    Y MRYSR
Sbjct  315  FRITE-----REYDPYFMRYSR  331

>PYU1_G003226
Length=206

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 38/78 (49%), Gaps = 10/78 (13%)

Query  85   RQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIES--------PRIS  136
            +   F+FY GSD PT +  G      G  S   +      S AA + S        P+IS
Sbjct  96   KNTDFMFYCGSDTPT-SDAGQRNSFNGAASFSSTASASEFSEAAEVASEERAKVATPKIS  154

Query  137  HEMPCFFSPRNT-PLQSP  153
            H++P FFSPRN  P+ +P
Sbjct  155  HQIPVFFSPRNALPMPTP  172

>PYIW_19157
Length=262

 Score = 38.1 bits (87),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 46/104 (44%), Gaps = 9/104 (9%)

Query  75   NYSYeeeeeeRQVQFLFYGGSDPPTPTSVGDLYPSGGYR---SDMISNYVEPMSPAA---  128
            +Y  E E   +   F+FY G D  TP S       GG+    S   S + +    A+   
Sbjct  85   SYEQEYEASIKSTDFMFYCGFD--TPKSEHGRGEGGGFSFSSSTAPSEFSDDGERASMDR  142

Query  129  -SIESPRISHEMPCFFSPRNTPLQSPMSAPIYSPHLFKISEQRM  171
              + +P++SH++P FFSPRN     P   P   P   +IS  R 
Sbjct  143  VHVTTPKLSHQIPVFFSPRNAVPMLPRPKPREKPRPLRISNTRA  186

>PYAR_19462
Length=116

 Score = 35.8 bits (81),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 30/63 (48%), Gaps = 21/63 (33%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRN  147
            QFLF+ GSD            +   R+ + S+          IE+P ISH MP FF+P+N
Sbjct  71   QFLFFCGSD------------TSAARASLKSSK---------IETPMISHRMPVFFNPQN  109

Query  148  TPL  150
              L
Sbjct  110  AML  112

>HYAP_01508
Length=132

 Score = 34.3 bits (77),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (52%), Gaps = 4/58 (7%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSP  145
            QFL + GSD  T TS  +L  + G  + + S + +  +P  +   P I+  MP FF P
Sbjct  66   QFLLFCGSD--TATSPAELVSADG--TTLASRFAKLNAPGTAATQPVINRHMPVFFMP  119

>PYIR_14499
Length=186

 Score = 34.3 bits (77),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query  85   RQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFS  144
            ++  F+FY G D P  T+  DL        +M          A+ + +P+IS  +P FFS
Sbjct  95   KKTDFMFYCGFDTPNSTAPSDL------DEEMHEER------ASLVATPKISRNIPVFFS  142

Query  145  PRN  147
            PRN
Sbjct  143  PRN  145

>PHYRA_78818
Length=134

 Score = 33.5 bits (75),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 5/69 (7%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRN  147
            QFLF+ GSD     S     P+G   +  ++N   P +PA     P I H MP FF P  
Sbjct  66   QFLFFCGSDTSAFPSGELTSPNGSTLASRLANMTAP-TPA----QPAIDHHMPVFFMPPL  120

Query  148  TPLQSPMSA  156
            +P +  + A
Sbjct  121  SPTRPTLGA  129

>SPRG_02757
Length=2847

 Score = 34.3 bits (77),  Expect = 0.45, Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 30/100 (30%)

Query  96   DPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRI----------SHEMPCFFSP  145
            + P   +V DL PS             P+   A++++ R+          S   P FF  
Sbjct  223  NKPNALTVIDLAPS-------------PVLTEAALDALRVPPPPSPLFDPSLRSPIFFGY  269

Query  146  RNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYNMRYSR  185
             N P+QSP+        L K +E+ ++ R   Y+ +R +R
Sbjct  270  TNAPMQSPVD-------LTKANEKALADREAAYFELRIAR  302

>PYAP_20399
Length=135

 Score = 33.1 bits (74),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 9/65 (14%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEP-----MSPAASIESPRISHEMPCF  142
            QFLF+ GSD  +  + G      GY+++   ++         S A+ I++P+ISH++P F
Sbjct  68   QFLFFCGSDN-SGVAAGRRT---GYQTNHDFSFANAEVQARASRASEIQAPQISHKIPVF  123

Query  143  FSPRN  147
            F+P++
Sbjct  124  FAPQH  128

>SDRG_10804
Length=1471

 Score = 32.7 bits (73),  Expect = 1.4, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (55%), Gaps = 2/42 (5%)

Query  109  SGGYRSDMISNYVEP--MSPAASIESPRISHEMPCFFSPRNT  148
            S GY+   + +  EP  +SP   + +PR +H++P  F P  T
Sbjct  120  SRGYKEGTLQHPAEPSSVSPPKKVPTPRQAHKVPTSFKPTTT  161

>PYVX_15863
Length=181

 Score = 30.8 bits (68),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 13/57 (23%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFS  144
            +FLFYGGSD             G ++ D+  ++++ + P+A    P +   MP FFS
Sbjct  116  EFLFYGGSD-----------VDGAFKPDLRPSHLDLVQPSAI--RPVVKQHMPVFFS  159

>PHYKE_5719
Length=130

 Score = 29.6 bits (65),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRN  147
            QFLF+ GSD     S     P+G   +  +++   P +PA     P I+H MP FF P  
Sbjct  69   QFLFFCGSDTSAFPSGELTSPNGSTLASRLASITCP-TPA----QPAINHHMPVFFMPPL  123

Query  148  TP  149
            +P
Sbjct  124  SP  125

>PYVX_15867
Length=187

 Score = 30.0 bits (66),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 37/71 (52%), Gaps = 7/71 (10%)

Query  88   QFLFYGGSDP-PTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPR  146
            QFLF+ GSD   +     +  P     +  +++   PM PAA    P ISH+MP FF+P 
Sbjct  112  QFLFFCGSDSRDSGRGWKNNSPESTELAQRLTSLNFPM-PAA----PAISHKMPVFFTPA  166

Query  147  N-TPLQSPMSA  156
              T   SP++A
Sbjct  167  QPTQATSPLAA  177

>PHYSO_296556
Length=136

 Score = 29.3 bits (64),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFSPRN  147
            QFLF+ G+D     S      +G   +  I++   P +PA     P I H MP FF P  
Sbjct  68   QFLFFCGTDSSGSPSAELTAANGTTLASRIASMNAP-APA----QPAIDHHMPVFFMPPL  122

Query  148  TPLQSPMSA  156
            +P+   + A
Sbjct  123  SPVAPELGA  131

Lambda      K        H        a         alpha
   0.321    0.136    0.445    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7656441552

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40