Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_0001191601605931e-78
PPTG_1667292861965103e-64
PHYCA_50470692531954855e-61
PHYSO_47825391691694551e-57
PHYKE_57209221743253e-37
PHALS_1083592641923093e-34
HYAP_015139248742622e-27
PYVX_1586391811612023e-19
PYU1_G00322593697227661537e-12
PYAR_194629980111648700.82
PYIW_234919369721241720.93
PHYCA_1044361018167711.1
SPRG_004581590152893702.0
HYAP_015081113264663.5
PHYSO_2965561113658664.1
PHYRA_788181113458646.3
PHYKE_57191113058646.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00011

Length=160
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00011                                                            233        1e-78
PPTG_16672                                                            201        3e-64
PHYCA_504706                                                          191        5e-61
PHYSO_478253                                                          179        1e-57
PHYKE_5720                                                            129        3e-37
PHALS_10835                                                           123        3e-34
HYAP_01513                                                            105        2e-27
PYVX_15863                                                            82.4       3e-19
PYU1_G003225                                                          63.5       7e-12
PYAR_19462                                                            31.6       0.82 
PYIW_23491                                                            32.3       0.93 
PHYCA_104436                                                          32.0       1.1  
SPRG_00458                                                            31.6       2.0  
HYAP_01508                                                            30.0       3.5  
PHYSO_296556                                                          30.0       4.1  
PHYRA_78818                                                           29.3       6.3  
PHYKE_5719                                                            29.3       6.8  

>PITG_00011
Length=160

 Score = 233 bits (593),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/160 (100%), Positives = 160/160 (100%), Gaps = 0/160 (0%)

Query  1    MRAIGGLFKRKCsdaddatapsdseasqrrtsrwsrwshshrGSLPEAPLDVAAVAAPET  60
            MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSHSHRGSLPEAPLDVAAVAAPET
Sbjct  1    MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSHSHRGSLPEAPLDVAAVAAPET  60

Query  61   APIQENDSTKQSPTDPsdllladssdESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDD  120
            APIQENDSTKQSPTDPSDLLLADSSDESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDD
Sbjct  61   APIQENDSTKQSPTDPSDLLLADSSDESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDD  120

Query  121  LHQNDIRPSLQAKMPLFFSPPLVENMRRSSILPDPKEYEF  160
            LHQNDIRPSLQAKMPLFFSPPLVENMRRSSILPDPKEYEF
Sbjct  121  LHQNDIRPSLQAKMPLFFSPPLVENMRRSSILPDPKEYEF  160

>PPTG_16672
Length=286

 Score = 201 bits (510),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 154/196 (79%), Gaps = 36/196 (18%)

Query  1    MRAIGGLFKRKCsdaddatapsdseasqrrtsrwsrwshshrGSLPEAPLDVAAVAAPET  60
            MRAIGGLFKRK SD DDA  PSDSEASQRRTSRWSRWSHSHRGS PEAPL+VAAVAAPET
Sbjct  91   MRAIGGLFKRKASDVDDAMEPSDSEASQRRTSRWSRWSHSHRGSFPEAPLEVAAVAAPET  150

Query  61   APIQENDS------------------------------------TKQSPTDPsdlllads  84
            APIQEN+S                                    TKQSPTDPS+LL+ADS
Sbjct  151  APIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFNKTKQSPTDPSELLMADS  210

Query  85   sdESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVE  144
            SDESGAEPQRVSFLFFGGSD DSTFQPELRPSELDDLH+NDIRPSLQAKMPLFFSPPLVE
Sbjct  211  SDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKMPLFFSPPLVE  270

Query  145  NMRRSSILPDPKEYEF  160
            +MRRSSILPDPKEYEF
Sbjct  271  HMRRSSILPDPKEYEF  286

>PHYCA_504706
Length=253

 Score = 191 bits (485),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 151/195 (77%), Gaps = 35/195 (18%)

Query  1    MRAIGGLFKRKCsdaddatapsdseasqrrtsrwsrwshshrGSLPEAPLDVAAVAAPET  60
            MRAIGGLFKRK SDADDATAPSDSEASQRRTSRWSRWSHS+RGS+PEAPL+VAAVA PET
Sbjct  59   MRAIGGLFKRKSSDADDATAPSDSEASQRRTSRWSRWSHSNRGSMPEAPLEVAAVAEPET  118

Query  61   APIQENDS-----------------------------------TKQSPTDPsdllladss  85
            APIQEN+S                                   TKQSPTDPS L+ + SS
Sbjct  119  APIQENESVASSPHMEEPPAKKVKKVKAEKPKKEAKIKPPSFNTKQSPTDPSALVASGSS  178

Query  86   dESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVEN  145
            D S  EPQR+SFLFFGGSDTDSTFQPELRPSE D+LH+NDIRPSLQAKMPLFFSPP+VEN
Sbjct  179  DGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKMPLFFSPPMVEN  238

Query  146  MRRSSILPDPKEYEF  160
            MRRSSILPDPKEYEF
Sbjct  239  MRRSSILPDPKEYEF  253

>PHYSO_478253
Length=169

 Score = 179 bits (455),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 138/169 (82%), Gaps = 9/169 (5%)

Query  1    MRAIGGLFKRKCsdaddatapsdseasqr-rtsrwsrwshshrGSLPEAPLDVAAVAAPE  59
            MRAIGGLFKRK  DADD  APSDSEASQR  TSRWSRWS SHR SLPEAP++V AVA PE
Sbjct  1    MRAIGGLFKRKSIDADDPMAPSDSEASQRPSTSRWSRWSQSHRQSLPEAPMEVTAVAVPE  60

Query  60   TAPIQENDS------TKQSPTDPsdl--lladssdESGAEPQRVSFLFFGGSDTDSTFQP  111
             APIQEN+        KQSPTDPS L     DS DE  AEP RVSFLFFGGSD DSTFQP
Sbjct  61   AAPIQENEPPAPSSPVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQP  120

Query  112  ELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVENMRRSSILPDPKEYEF  160
            ELRPSELDDLH+N+IRPSLQ KMPLFFSPPLVENMRRSSILPDPKEYEF
Sbjct  121  ELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF  169

>PHYKE_5720
Length=221

 Score = 129 bits (325),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 69/74 (93%), Gaps = 0/74 (0%)

Query  87   ESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVENM  146
            E GAEP R+SFLFFGGSD +STF P+LRPS+LDDLH+ND+RPSLQAKMP FFSPP+VE+M
Sbjct  148  EYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAKMPQFFSPPVVEHM  207

Query  147  RRSSILPDPKEYEF  160
            RRSSILPDP+EYEF
Sbjct  208  RRSSILPDPREYEF  221

>PHALS_10835
Length=264

 Score = 123 bits (309),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 121/192 (63%), Gaps = 35/192 (18%)

Query  1    MRAIGGLFKRKCsdaddatapsdseasqrrtsrwsrwshshrGSLPEAPLDVAAVAAPET  60
            MRAIGG F+R CSDAD  T P DSE+SQRRTSRWS        S+PEAP  V      ET
Sbjct  76   MRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQ---SMPEAPSTVVVQEILET  132

Query  61   APIQ---ENDS-----------------------------TKQSPTDPsdllladssdES  88
               Q   EN+                              T+QSPT+ S++L A   DE 
Sbjct  133  TRSQNAAENEPLTKSPHTEEPPVKKVKKDKPKKAKNTPSPTEQSPTETSEMLSATLVDEL  192

Query  89   GAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVENMRR  148
            G E QRVSFLFFGGSD D TFQPELRPSELDDLH+NDIRPSLQAKMPLF  PPL +N+RR
Sbjct  193  GVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMPLFLPPPLPKNVRR  252

Query  149  SSILPDPKEYEF  160
            SSILPDP+EYEF
Sbjct  253  SSILPDPEEYEF  264

>HYAP_01513
Length=248

 Score = 105 bits (262),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 0/74 (0%)

Query  87   ESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVENM  146
            ES  +P RVSFL FGGS+ DSTF+PEL PSE DD+H ++IRP LQ KMPLFFS PL E +
Sbjct  175  ESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAERL  234

Query  147  RRSSILPDPKEYEF  160
            RRSS   DPKEYE 
Sbjct  235  RRSSAKSDPKEYEL  248

>PYVX_15863
Length=181

 Score = 82.4 bits (202),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 85/161 (53%), Gaps = 14/161 (9%)

Query  1    MRAIGGLFKRKCsdaddatapsdseasqrrtsrwsrwshshrGSLPEAPLDVAAVAAPET  60
            MRA+GGLF+RK   +  ++  S       R SR          S PEA   +A +  P  
Sbjct  34   MRAVGGLFRRKSGASSRSSMSSAPSERSWRMSRSR--------SRPEAATTLATMQPPHQ  85

Query  61   APIQENDSTKQSPTDPsdllladssdESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDD  120
            +  Q ++++  +              ++  E     FLF+GGSD D  F+P+LRPS LD 
Sbjct  86   SGKQASETSSANSFSSPSDPTELDVADAAPE-----FLFYGGSDVDGAFKPDLRPSHLDL  140

Query  121  LHQNDIRPSLQAKMPLFFSPPLVENMRRSSIL-PDPKEYEF  160
            +  + IRP ++  MP+FFS P  EN+RRSSIL  DP+EYEF
Sbjct  141  VQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADPREYEF  181

>PYU1_G003225
Length=227

 Score = 63.5 bits (153),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query  97   FLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSPPLV-ENM-RRSSILPD  154
            FLF+ GS  D++F+PE   S + ++  N IRPSL  +MP+FFSPP    N  RRSSIL D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  155  PKEYEF  160
            P+EYE 
Sbjct  186  PREYEL  191

>PYAR_19462
Length=116

 Score = 31.6 bits (70),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 28/48 (58%), Gaps = 8/48 (17%)

Query  93   QRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKMPLFFSP  140
            +R  FLFF GSDT S  +  L+ S+++        P +  +MP+FF+P
Sbjct  68   ERPQFLFFCGSDT-SAARASLKSSKIET-------PMISHRMPVFFNP  107

>PYIW_23491
Length=212

 Score = 32.3 bits (72),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 0/41 (0%)

Query  94   RVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKM  134
            R  F F+ GS  D++F+PE   S + ++  N IRP   +K 
Sbjct  141  RYQFHFYSGSAEDNSFKPERVHSTVAEIDYNTIRPRRGSKT  181

>PHYCA_104436
Length=181

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 26/67 (39%)

Query  93   QRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIR-------------------PSLQAK  133
            ++V FLF+GGSD  +       P+ +  LHQN  R                   P +  +
Sbjct  84   RQVQFLFYGGSDPPT-------PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHE  136

Query  134  MPLFFSP  140
            MP FFSP
Sbjct  137  MPCFFSP  143

>SPRG_00458
Length=528

 Score = 31.6 bits (70),  Expect = 2.0, Method: Composition-based stats.
 Identities = 23/93 (25%), Positives = 44/93 (47%), Gaps = 11/93 (12%)

Query  46   PEAPLDVAAVAAPE---TAPIQENDSTKQSPTDPsdllladssdESGAEPQRVSFLFFGG  102
            P A +D+ +  AP+   T+P+  ND+ + +P++ +     +   E+GA+P   S      
Sbjct  59   PSADVDMGSGDAPDAAATSPVTANDAVEVAPSEGNATDAGEPEVEAGADPTTESV-----  113

Query  103  SDTDSTFQPELRPSELDDLHQNDIR--PSLQAK  133
             D  +T Q    P++  +      +  PS +AK
Sbjct  114  -DEAATIQDTTVPNDASEAQTTGAKTTPSSEAK  145

>HYAP_01508
Length=132

 Score = 30.0 bits (66),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 11/64 (17%)

Query  93   QRVSFLFFGGSDTDSTFQPEL----------RPSELDDLHQNDIRPSLQAKMPLFFSPPL  142
            +R  FL F GSDT +T   EL          R ++L+       +P +   MP+FF PP+
Sbjct  63   ERSQFLLFCGSDT-ATSPAELVSADGTTLASRFAKLNAPGTAATQPVINRHMPVFFMPPV  121

Query  143  VENM  146
            V  +
Sbjct  122  VAEL  125

>PHYSO_296556
Length=136

 Score = 30.0 bits (66),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (47%), Gaps = 8/58 (14%)

Query  93   QRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDI--------RPSLQAKMPLFFSPPL  142
            +R  FLFF G+D+  +   EL  +    L             +P++   MP+FF PPL
Sbjct  65   ERPQFLFFCGTDSSGSPSAELTAANGTTLASRIASMNAPAPAQPAIDHHMPVFFMPPL  122

>PHYRA_78818
Length=134

 Score = 29.3 bits (64),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 8/58 (14%)

Query  93   QRVSFLFFGGSDTDSTFQPELR-------PSELDDLHQ-NDIRPSLQAKMPLFFSPPL  142
            +R  FLFF GSDT +    EL         S L ++      +P++   MP+FF PPL
Sbjct  63   ERPQFLFFCGSDTSAFPSGELTSPNGSTLASRLANMTAPTPAQPAIDHHMPVFFMPPL  120

>PHYKE_5719
Length=130

 Score = 29.3 bits (64),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (45%), Gaps = 8/58 (14%)

Query  93   QRVSFLFFGGSDTDSTFQPELRPSELDDLHQ--------NDIRPSLQAKMPLFFSPPL  142
            +R  FLFF GSDT +    EL       L             +P++   MP+FF PPL
Sbjct  66   ERPQFLFFCGSDTSAFPSGELTSPNGSTLASRLASITCPTPAQPAINHHMPVFFMPPL  123

Lambda      K        H        a         alpha
   0.314    0.133    0.389    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5491923930

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40