Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_0001081841848634e-119
PHYCA_13159382541455632e-72
PHYCA_504729440671831194295e-53
PHYCA_120807423971341044239e-53
PPTG_0793282891014263e-51
PHYCA_112118416261341044063e-50
PHYCA_49721384681031014017e-50
PHYCA_7065639241113913871e-47
PPTG_1466322920146993736e-45
PHYCA_559326453551821193713e-44
PPTG_2167826348104772932e-33
PPTG_0635119972225712613e-27
PITG_090727528261962407e-24
PHYCA_5302437528269962409e-24
PPTG_033387528260962372e-23
PHYRA_780887528261962372e-23
PHYSO_36201775282731012364e-23
H310_052931489191431012188e-22
PPTG_0379119179108582132e-21
H310_097651498671151042099e-21
PYAP_15403984871141052063e-20
SPRG_0885484121072178e-20
H310_1330668102311042118e-20
SDRG_1367884151072178e-20
H310_083391495022301122101e-19
PPTG_1426468103351012122e-19
H310_046841487961081031993e-19
H310_025611483322561092074e-19
H310_152921516152301112048e-19
PITG_0817268103201012089e-19
H310_14146151053109961932e-18
H257_0615281501101954e-18
H310_069331492172591001971e-17
PHALS_0885768103521011973e-17
PHYCA_51041568103371011964e-17
PHYKE_158868103331011964e-17
PHYSO_38364868103191011964e-17
H310_152911516142341001916e-17
HYAP_1401068103031011947e-17
H310_117551279882591001927e-17
SDRG_1516315173292941911e-16
H257_076411414641871001852e-16
H310_093731497191091021775e-16
SPRG_1416015173319951876e-16
CCA1434668103251281876e-16
H310_04120148668138961788e-16
PHYRA_7865668103471011851e-15
H310_078491493931921001791e-15
H310_131061507792131011793e-15
PYVX_137196810317991823e-15
H310_128941507262571001794e-15
H257_191041475292141221751e-14
H257_15222127988254991724e-14
SPRG_113201279882741021717e-14
H257_094346810257951682e-13
SPRG_060301250931961191642e-13
H310_14738151271255991637e-13
SPRG_085731264412651021533e-11
H310_14414151141169901475e-11
SPRG_059291250402651021515e-11
PHYCA_10416540824231931495e-11
SDRG_174061264412641021506e-11
SDRG_173901384462641021506e-11
SPRG_18521133223291911507e-11
SPRG_05316124701325911491e-10
H310_090711496731121041402e-10
PPTG_249417754380451482e-10
SDRG_06597124701317911472e-10
H310_1058115173241911443e-10
PHYCA_9638540009135931385e-10
H257_15235145259178821405e-10
H257_0625315173237851426e-10
H310_127141506653771181437e-10
PYAP_24609101386405931447e-10
H257_03945139940230921409e-10
H257_15150145202145931361e-09
H257_14013144554217931391e-09
PPTG_11368217821301021342e-09
PHYSO_470381564381451061352e-09
PHYCA_6275139088116981332e-09
PHYSO_373613538831301051332e-09
PHYSO_376280539901381061342e-09
H257_18152150419209921372e-09
H310_12832147529258991373e-09
H257_05648140669172891344e-09
PHYSO_254181462881541061334e-09
H257_18023146763128931314e-09
H257_13170144141198991344e-09
PHYSO_453976559621381061315e-09
H310_14154151059178501335e-09
SDRG_12398126788264971365e-09
SPRG_09172126788265971365e-09
PHYKE_61627528201651336e-09
PYU1_G004359940552371061347e-09
H257_02519139347268911357e-09
H257_16670146013136991307e-09
PHYCA_132727435852611111331e-08
PHYCA_11835042180156911291e-08
H257_148891450601571051282e-08
H257_047781402451471001272e-08
H310_03385148533223921302e-08
PHYSO_435001556281381061263e-08
H310_04124148672811011214e-08
H257_04948140334247871285e-08
PHYCA_5106064455674281205e-08
H257_00956138769202931266e-08
H257_090541421241511001246e-08
PHYSO_32576350528157961247e-08
H257_07657141475212921269e-08
H310_149541513621491011239e-08
PHYSO_380505541561381061221e-07
H310_13569138769205961241e-07
PHYCA_12568642785290991261e-07
CCI4749568102851071261e-07
H257_19436147818199831232e-07
H310_15369151671209481222e-07
PPTG_02416186271251051183e-07
H257_13889144500138841193e-07
PHYSO_5480724947362971234e-07
H257_19019147462229851215e-07
H257_00377138602223921197e-07
PHYSO_330097511352031001197e-07
PPTG_1436622827283991208e-07
H257_17402130747149931141e-06
H257_12325143695191921162e-06
PPTG_1608323457241781162e-06
H257_1397849451721061142e-06
H257_18551147094221841153e-06
H310_12821150692179931133e-06
PHYKE_40014947496921163e-06
H257_08032126788251871153e-06
PPTG_0584319760169931124e-06
PHYSO_378731540801381061104e-06
PHYSO_5364564370212431135e-06
PYIW_25658165168148731105e-06
H257_13434144330236931135e-06
H310_11608150339221991126e-06
H310_15319141984227921111e-05
PYIW_25568165102126621071e-05
H310_04215126788257871111e-05
SDRG_15499137857278851102e-05
H257_03208139630105601042e-05
SDRG_17266138360278851102e-05
H310_118311504104901181102e-05
PHYSO_29581948124193911082e-05
PPTG_0663320057292821092e-05
H257_155301453932371261082e-05
H310_13824150948169551063e-05
PHYRA_758774947406971093e-05
H310_15068151450108941033e-05
PHYCA_14089370601991001073e-05
PYAP_1770012693284951083e-05
PHYCA_5038334947313961083e-05
H257_17235146326186851054e-05
H310_04318148723179421054e-05
PYIW_263631656851441001044e-05
PPTG_0460119419260801064e-05
PPTG_1128321750260791065e-05
PPTG_002724947436921066e-05
PPTG_0411819262274761066e-05
SPRG_00310122252254421056e-05
PYAP_22661100509218701047e-05
PHYSO_25977546736213831047e-05
PPTG_0379719183210801048e-05
PHYCA_3898337995217901048e-05
PHYSO_448112558541151161009e-05
PHYCA_482815173295901031e-04
PHYSO_3771405402410595981e-04
PHYCA_9897140275295901031e-04
PHYSO_492787577291301031001e-04
PYIW_25874165316201871021e-04
PYU1_G00872895482234851021e-04
H257_129981440501411001001e-04
H310_1489815133914064992e-04
H257_14759144959198921002e-04
PITG_1909815173295901013e-04
H257_1449914480717093993e-04
H310_1187515041917273993e-04
PYVX_2388594073261371013e-04
H310_0447414876321090993e-04
H310_04226144050236103993e-04
H257_0787114156520193993e-04
HYAP_006304945432901003e-04
PITG_126861032022390993e-04
H257_0883714198422592994e-04
PYIW_1563716371627287994e-04
H257_0775514151518185984e-04
H310_1516114433023692994e-04
PPTG_06289437024043985e-04
PITG_05827494736497995e-04
PHYCA_124712437020243975e-04
PITG_05131437020045976e-04
SDRG_172941383856844917e-04
PPTG_1578723348126105948e-04
PPTG_085002082528579978e-04
SDRG_0465312770024370978e-04
PHALS_0640912693227119969e-04
H310_1407513860221792950.001
H310_1516015151420091950.001
H257_01534138937176126940.001
PYAR_204499973723189940.002
H257_1854314708932344950.002
H257_0199413911222291940.002
H257_0535614052022492940.002
H257_1321214418115384920.002
HYAP_067781269322497930.002
SPRG_1804513278621542930.002
H310_1186815041711791900.002
PPTG_169642373910481890.002
PPTG_067232008814969910.002
PHYRA_75881494539191940.002
PHYRA_868567330039191930.003
H310_1384315095311852890.003
H257_0718214124720972920.003
H257_1684514612120972920.003
PITG_08385696820437920.003
H257_09254142226141103900.003
PYAR_2470010589115488900.004
PYIW_1505816301413154890.004
PHYSO_4741015665616643900.004
PHYCA_1292304312114143890.004
PPTG_24854151329183920.004
PPTG_197792488231999920.004
H257_1837914698515590890.004
H257_1070714290821344900.005
PHYSO_3892685437810760870.005
PPTG_22223268533718820.005
PPTG_1829612693248127900.005
PHYRA_758844970943291910.005
PHYSO_389597792618898900.005
H257_1454614483418764890.005
H257_0475114022911988870.006
H257_1194214347223284890.007
H257_12985144038182126890.007
H310_1025715001130924900.007
CCA24051156138369111900.008
CCA23866156048369111900.008
H310_1430114224024794890.008
PPTG_1528146288148106870.008
PPTG_1551623240493127890.009
PITG_157381269322799880.011
H310_0626214909022696880.011
H257_1920114761510284840.011
H257_1530212913934440880.012
H257_0016512693434106880.012
PHYCA_50413412693205103870.013
PHYSO_34079052729270112870.013
H257_0610114082536082880.014
H310_0346214309624397870.016
PPTG_20418210521994860.016
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00010

Length=184
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00010                                                            337        4e-119
PHYCA_131593                                                          221        2e-72 
PHYCA_504729                                                          169        5e-53 
PHYCA_120807                                                          167        9e-53 
PPTG_07932                                                            168        3e-51 
PHYCA_112118                                                          160        3e-50 
PHYCA_49721                                                           159        7e-50 
PHYCA_70656                                                           153        1e-47 
PPTG_14663                                                            148        6e-45 
PHYCA_559326                                                          147        3e-44 
PPTG_21678                                                            117        2e-33 
PPTG_06351                                                            105        3e-27 
PITG_09072                                                            97.1       7e-24 
PHYCA_530243                                                          97.1       9e-24 
PPTG_03338                                                            95.9       2e-23 
PHYRA_78088                                                           95.9       2e-23 
PHYSO_362017                                                          95.5       4e-23 
H310_05293                                                            88.6       8e-22 
PPTG_03791                                                            86.7       2e-21 
H310_09765                                                            85.1       9e-21 
PYAP_15403                                                            84.0       3e-20 
SPRG_08854                                                            88.2       8e-20 
H310_13306                                                            85.9       8e-20 
SDRG_13678                                                            88.2       8e-20 
H310_08339                                                            85.5       1e-19 
PPTG_14264                                                            86.3       2e-19 
H310_04684                                                            81.3       3e-19 
H310_02561                                                            84.3       4e-19 
H310_15292                                                            83.2       8e-19 
PITG_08172                                                            84.7       9e-19 
H310_14146                                                            79.0       2e-18 
H257_06152                                                            79.7       4e-18 
H310_06933                                                            80.5       1e-17 
PHALS_08857                                                           80.5       3e-17 
PHYCA_510415                                                          80.1       4e-17 
PHYKE_1588                                                            80.1       4e-17 
PHYSO_383648                                                          80.1       4e-17 
H310_15291                                                            78.2       6e-17 
HYAP_14010                                                            79.3       7e-17 
H310_11755                                                            78.6       7e-17 
SDRG_15163                                                            78.2       1e-16 
H257_07641                                                            75.9       2e-16 
H310_09373                                                            72.8       5e-16 
SPRG_14160                                                            76.6       6e-16 
CCA14346                                                              76.6       6e-16 
H310_04120                                                            73.2       8e-16 
PHYRA_78656                                                           75.9       1e-15 
H310_07849                                                            73.6       1e-15 
H310_13106                                                            73.6       3e-15 
PYVX_13719                                                            74.7       3e-15 
H310_12894                                                            73.6       4e-15 
H257_19104                                                            72.0       1e-14 
H257_15222                                                            70.9       4e-14 
SPRG_11320                                                            70.5       7e-14 
H257_09434                                                            69.3       2e-13 
SPRG_06030                                                            67.8       2e-13 
H310_14738                                                            67.4       7e-13 
SPRG_08573                                                            63.5       3e-11 
H310_14414                                                            61.2       5e-11 
SPRG_05929                                                            62.8       5e-11 
PHYCA_104165                                                          62.0       5e-11 
SDRG_17406                                                            62.4       6e-11 
SDRG_17390                                                            62.4       6e-11 
SPRG_18521                                                            62.4       7e-11 
SPRG_05316                                                            62.0       1e-10 
H310_09071                                                            58.5       2e-10 
PPTG_24941                                                            61.6       2e-10 
SDRG_06597                                                            61.2       2e-10 
H310_10581                                                            60.1       3e-10 
PHYCA_96385                                                           57.8       5e-10 
H257_15235                                                            58.5       5e-10 
H257_06253                                                            59.3       6e-10 
H310_12714                                                            59.7       7e-10 
PYAP_24609                                                            60.1       7e-10 
H257_03945                                                            58.5       9e-10 
H257_15150                                                            57.0       1e-09 
H257_14013                                                            58.2       1e-09 
PPTG_11368                                                            56.2       2e-09 
PHYSO_470381                                                          56.6       2e-09 
PHYCA_62751                                                           55.8       2e-09 
PHYSO_373613                                                          55.8       2e-09 
PHYSO_376280                                                          56.2       2e-09 
H257_18152                                                            57.4       2e-09 
H310_12832                                                            57.4       3e-09 
H257_05648                                                            56.2       4e-09 
PHYSO_254181                                                          55.8       4e-09 
H257_18023                                                            55.1       4e-09 
H257_13170                                                            56.2       4e-09 
PHYSO_453976                                                          55.1       5e-09 
H310_14154                                                            55.8       5e-09 
SDRG_12398                                                            57.0       5e-09 
SPRG_09172                                                            57.0       5e-09 
PHYKE_6162                                                            55.8       6e-09 
PYU1_G004359                                                          56.2       7e-09 
H257_02519                                                            56.6       7e-09 
H257_16670                                                            54.7       7e-09 
PHYCA_132727                                                          55.8       1e-08 
PHYCA_118350                                                          54.3       1e-08 
H257_14889                                                            53.9       2e-08 
H257_04778                                                            53.5       2e-08 
H310_03385                                                            54.7       2e-08 
PHYSO_435001                                                          53.1       3e-08 
H310_04124                                                            51.2       4e-08 
H257_04948                                                            53.9       5e-08 
PHYCA_510606                                                          50.8       5e-08 
H257_00956                                                            53.1       6e-08 
H257_09054                                                            52.4       6e-08 
PHYSO_325763                                                          52.4       7e-08 
H257_07657                                                            53.1       9e-08 
H310_14954                                                            52.0       9e-08 
PHYSO_380505                                                          51.6       1e-07 
H310_13569                                                            52.4       1e-07 
PHYCA_125686                                                          53.1       1e-07 
CCI47495                                                              53.1       1e-07 
H257_19436                                                            52.0       2e-07 
H310_15369                                                            51.6       2e-07 
PPTG_02416                                                            50.1       3e-07 
H257_13889                                                            50.4       3e-07 
PHYSO_548072                                                          52.0       4e-07 
H257_19019                                                            51.2       5e-07 
H257_00377                                                            50.4       7e-07 
PHYSO_330097                                                          50.4       7e-07 
PPTG_14366                                                            50.8       8e-07 
H257_17402                                                            48.5       1e-06 
H257_12325                                                            49.3       2e-06 
PPTG_16083                                                            49.3       2e-06 
H257_13978                                                            48.5       2e-06 
H257_18551                                                            48.9       3e-06 
H310_12821                                                            48.1       3e-06 
PHYKE_4001                                                            49.3       3e-06 
H257_08032                                                            48.9       3e-06 
PPTG_05843                                                            47.8       4e-06 
PHYSO_378731                                                          47.0       4e-06 
PHYSO_536456                                                          48.1       5e-06 
PYIW_25658                                                            47.0       5e-06 
H257_13434                                                            48.1       5e-06 
H310_11608                                                            47.8       6e-06 
H310_15319                                                            47.4       1e-05 
PYIW_25568                                                            45.8       1e-05 
H310_04215                                                            47.4       1e-05 
SDRG_15499                                                            47.0       2e-05 
H257_03208                                                            44.7       2e-05 
SDRG_17266                                                            47.0       2e-05 
H310_11831                                                            47.0       2e-05 
PHYSO_295819                                                          46.2       2e-05 
PPTG_06633                                                            46.6       2e-05 
H257_15530                                                            46.2       2e-05 
H310_13824                                                            45.4       3e-05 
PHYRA_75877                                                           46.6       3e-05 
H310_15068                                                            44.3       3e-05 
PHYCA_14089                                                           45.8       3e-05 
PYAP_17700                                                            46.2       3e-05 
PHYCA_503833                                                          46.2       3e-05 
H257_17235                                                            45.1       4e-05 
H310_04318                                                            45.1       4e-05 
PYIW_26363                                                            44.7       4e-05 
PPTG_04601                                                            45.4       4e-05 
PPTG_11283                                                            45.4       5e-05 
PPTG_00272                                                            45.4       6e-05 
PPTG_04118                                                            45.4       6e-05 
SPRG_00310                                                            45.1       6e-05 
PYAP_22661                                                            44.7       7e-05 
PHYSO_259775                                                          44.7       7e-05 
PPTG_03797                                                            44.7       8e-05 
PHYCA_38983                                                           44.7       8e-05 
PHYSO_448112                                                          43.1       9e-05 
PHYCA_4828                                                            44.3       1e-04 
PHYSO_377140                                                          42.4       1e-04 
PHYCA_98971                                                           44.3       1e-04 
PHYSO_492787                                                          43.1       1e-04 
PYIW_25874                                                            43.9       1e-04 
PYU1_G008728                                                          43.9       1e-04 
H257_12998                                                            43.1       1e-04 
H310_14898                                                            42.7       2e-04 
H257_14759                                                            43.1       2e-04 
PITG_19098                                                            43.5       3e-04 
H257_14499                                                            42.7       3e-04 
H310_11875                                                            42.7       3e-04 
PYVX_23885                                                            43.5       3e-04 
H310_04474                                                            42.7       3e-04 
H310_04226                                                            42.7       3e-04 
H257_07871                                                            42.7       3e-04 
HYAP_00630                                                            43.1       3e-04 
PITG_12686                                                            42.7       3e-04 
H257_08837                                                            42.7       4e-04 
PYIW_15637                                                            42.7       4e-04 
H257_07755                                                            42.4       4e-04 
H310_15161                                                            42.7       4e-04 
PPTG_06289                                                            42.4       5e-04 
PITG_05827                                                            42.7       5e-04 
PHYCA_124712                                                          42.0       5e-04 
PITG_05131                                                            42.0       6e-04 
SDRG_17294                                                            39.7       7e-04 
PPTG_15787                                                            40.8       8e-04 
PPTG_08500                                                            42.0       8e-04 
SDRG_04653                                                            42.0       8e-04 
PHALS_06409                                                           41.6       9e-04 
H310_14075                                                            41.2       0.001 
H310_15160                                                            41.2       0.001 
H257_01534                                                            40.8       0.001 
PYAR_20449                                                            40.8       0.002 
H257_18543                                                            41.2       0.002 
H257_01994                                                            40.8       0.002 
H257_05356                                                            40.8       0.002 
H257_13212                                                            40.0       0.002 
HYAP_06778                                                            40.4       0.002 
SPRG_18045                                                            40.4       0.002 
H310_11868                                                            39.3       0.002 
PPTG_16964                                                            38.9       0.002 
PPTG_06723                                                            39.7       0.002 
PHYRA_75881                                                           40.8       0.002 
PHYRA_86856                                                           40.4       0.003 
H310_13843                                                            38.9       0.003 
H257_07182                                                            40.0       0.003 
H257_16845                                                            40.0       0.003 
PITG_08385                                                            40.0       0.003 
H257_09254                                                            39.3       0.003 
PYAR_24700                                                            39.3       0.004 
PYIW_15058                                                            38.9       0.004 
PHYSO_474101                                                          39.3       0.004 
PHYCA_129230                                                          38.9       0.004 
PPTG_24854                                                            40.0       0.004 
PPTG_19779                                                            40.0       0.004 
H257_18379                                                            38.9       0.004 
H257_10707                                                            39.3       0.005 
PHYSO_389268                                                          38.1       0.005 
PPTG_22223                                                            36.2       0.005 
PPTG_18296                                                            39.3       0.005 
PHYRA_75884                                                           39.7       0.005 
PHYSO_389597                                                          39.3       0.005 
H257_14546                                                            38.9       0.005 
H257_04751                                                            38.1       0.006 
H257_11942                                                            38.9       0.007 
H257_12985                                                            38.9       0.007 
H310_10257                                                            39.3       0.007 
CCA24051                                                              39.3       0.008 
CCA23866                                                              39.3       0.008 
H310_14301                                                            38.9       0.008 
PPTG_15281                                                            38.1       0.008 
PPTG_15516                                                            38.9       0.009 
PITG_15738                                                            38.5       0.011 
H310_06262                                                            38.5       0.011 
H257_19201                                                            37.0       0.011 
H257_15302                                                            38.5       0.012 
H257_00165                                                            38.5       0.012 
PHYCA_504134                                                          38.1       0.013 
PHYSO_340790                                                          38.1       0.013 
H257_06101                                                            38.5       0.014 
H310_03462                                                            38.1       0.016 
PPTG_20418                                                            37.7       0.016 
H257_08839                                                            37.4       0.016 
H257_04666                                                            37.7       0.017 
H257_00966                                                            35.8       0.018 
H257_13222                                                            37.4       0.018 
PHYSO_322347                                                          37.7       0.019 
PYVX_17808                                                            37.7       0.021 
PHYRA_93678                                                           37.4       0.022 
PYIW_22501                                                            37.4       0.024 
PITG_05825                                                            37.7       0.027 
PYIR_20491                                                            37.4       0.027 
H257_18654                                                            36.6       0.028 
H257_01792                                                            36.6       0.028 
PPTG_11144                                                            37.0       0.033 
PHYRA_74884                                                           37.0       0.040 
PHYSO_336240                                                          36.2       0.040 
PYU1_G010696                                                          37.0       0.042 
H257_10436                                                            37.0       0.044 
PPTG_13524                                                            34.3       0.044 
PYIW_27159                                                            35.4       0.046 
PHYRA_86617                                                           36.6       0.046 
H310_04905                                                            36.2       0.046 
CCI48126                                                              37.0       0.046 
PYIW_23282                                                            36.6       0.047 
PYAP_23972                                                            37.0       0.053 
SDRG_08699                                                            35.8       0.059 
PITG_00212                                                            36.2       0.070 
H257_19488                                                            33.5       0.073 
H257_08669                                                            35.8       0.075 
H257_12323                                                            35.4       0.084 
H310_04868                                                            35.8       0.086 
PPTG_10963                                                            36.2       0.086 
H310_03851                                                            34.3       0.097 
HYAP_09695                                                            35.8       0.10  
H257_09293                                                            35.4       0.11  
PHYCA_100220                                                          35.4       0.12  
PYAR_18387                                                            35.8       0.13  
H257_12986                                                            35.4       0.14  
PYAR_22001                                                            34.3       0.15  
PPTG_00270                                                            35.0       0.16  
PHYCA_60915                                                           34.3       0.18  
SPRG_10836                                                            33.1       0.18  
PYIW_24031                                                            35.0       0.18  
H257_13416                                                            34.7       0.20  
PHYRA_84895                                                           34.3       0.21  
PYIW_27365                                                            33.1       0.21  
PPTG_00266                                                            35.0       0.22  
H310_01591                                                            34.7       0.24  
PPTG_15314                                                            33.9       0.25  
PHYSO_560624                                                          34.7       0.26  
H257_09605                                                            33.9       0.32  
PHYCA_14293                                                           33.5       0.33  
H310_10921                                                            33.1       0.34  
H257_02095                                                            33.9       0.36  
H310_14397                                                            32.3       0.37  
PHYKE_2762                                                            34.3       0.37  
PYU1_G003801                                                          33.9       0.38  
H257_10999                                                            33.9       0.38  
H310_03463                                                            31.6       0.39  
H310_10580                                                            33.5       0.48  
SPRG_04833                                                            33.5       0.49  
PYIW_27222                                                            31.6       0.66  
H257_15734                                                            33.1       0.75  
H257_03272                                                            32.3       0.84  
H310_11120                                                            32.7       0.97  
H257_05958                                                            32.7       1.0   
PHYRA_72572                                                           32.7       1.1   
H310_09411                                                            32.0       1.2   
H257_11108                                                            32.3       1.2   
PPTG_07779                                                            31.6       1.2   
H257_06895                                                            32.3       1.3   
PHYSO_516255                                                          32.3       1.3   
PHYRA_78761                                                           32.0       1.4   
PHYSO_317488                                                          32.3       1.5   
H310_04308                                                            31.6       1.7   
PPTG_17030                                                            30.4       1.8   
H310_10351                                                            32.0       2.0   
H310_11951                                                            30.0       2.0   
PYAP_20169                                                            31.6       2.3   
PPTG_07951                                                            31.6       2.4   
SDRG_10998                                                            31.2       2.8   
H257_05753                                                            31.2       3.0   
H257_01598                                                            30.8       3.2   
PITG_02413                                                            31.2       3.2   
H257_16479                                                            30.4       3.3   
H310_09278                                                            30.8       3.3   
SPRG_02266                                                            30.8       4.1   
H310_15181                                                            29.6       4.2   
H310_04289                                                            30.4       4.3   
PPTG_22665                                                            30.4       4.6   
PYAR_21393                                                            30.4       5.0   
H257_09478                                                            30.4       5.2   
PYAR_18059                                                            30.4       6.0   
PYIW_25163                                                            29.3       8.1   
SDRG_10751                                                            29.6       8.1   
PHYKE_8558                                                            28.9       8.9   
PHYSO_309926                                                          29.3       8.9   
PHYSO_253706                                                          29.6       9.2   

>PITG_00010
Length=184

 Score = 337 bits (863),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%), Gaps = 0/184 (0%)

Query  1    MEAGASTLTDEALEATDKDCAPGGDVadtdradgapgdaaddsaQKKRKKAFRFLPSSDV  60
            MEAGASTLTDEALEATDKDCAPGGDVADTDRADGAPGDAADDSAQKKRKKAFRFLPSSDV
Sbjct  1    MEAGASTLTDEALEATDKDCAPGGDVADTDRADGAPGDAADDSAQKKRKKAFRFLPSSDV  60

Query  61   ILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREEL  120
            ILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREEL
Sbjct  61   ILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREEL  120

Query  121  ESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKAVKYGCIARFSRGPR  180
            ESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKAVKYGCIARFSRGPR
Sbjct  121  ESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKAVKYGCIARFSRGPR  180

Query  181  FIAQ  184
            FIAQ
Sbjct  181  FIAQ  184

>PHYCA_131593
Length=254

 Score = 221 bits (563),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 118/145 (81%), Gaps = 10/145 (7%)

Query  1    MEAGASTLTDEALEATDKDCAPGGDVadtdradgapgdaaddsaQKKRKKAFRFLPSSDV  60
            ME GA+TLT E LEAT+KDCAPGG                     KKRKKAFRFLPSSDV
Sbjct  1    METGANTLTVEDLEATNKDCAPGGGGGGGVAGTDT----------KKRKKAFRFLPSSDV  50

Query  61   ILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREEL  120
            ILLKEVIKHTPWAAGH KTEA WG+VASG+KA+LPLCTADGKACRRRFYTLMEVFKREEL
Sbjct  51   ILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACRRRFYTLMEVFKREEL  110

Query  121  ESLRASGTTEDYEEREQLLTDCFEL  145
            ESLRASGTTE YEEREQLLTDCFEL
Sbjct  111  ESLRASGTTEAYEEREQLLTDCFEL  135

>PHYCA_504729
Length=183

 Score = 169 bits (429),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 95/119 (80%), Gaps = 4/119 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KRKKAFRF+PSSD++LLKEV+KH PWAA HG+T AAW  VA+G+KAAL  CTADGKACRR
Sbjct  22   KRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGLKAALTSCTADGKACRR  81

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEK  165
            RF TL+EVF+R+ELESLRASG+ EDYEEREQLLTDC  L       H  + A   +KEK
Sbjct  82   RFNTLLEVFRRDELESLRASGSAEDYEEREQLLTDCMTLYN----EHAQAKADKTEKEK  136

>PHYCA_120807
Length=134

 Score = 167 bits (423),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 0/104 (0%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            Q KRKKAFRF+PSSD++LLKE +KH PWAAGHG+TE +W  VA G+K ALP CTADGKAC
Sbjct  25   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETEVSWSSVAIGLKTALPSCTADGKAC  84

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTI  148
            RRRF  L++VF+R+ELESLRASG+ ED+EEREQLLTDC  L  I
Sbjct  85   RRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMALVRI  128

>PPTG_07932
Length=289

 Score = 168 bits (426),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 87/101 (86%), Gaps = 0/101 (0%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            Q KRKKAFRF+PSSD++LLKE +KH PWAAGHG+T+ +W  VA G+K ALP CTADGKAC
Sbjct  57   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKAC  116

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            RRRF  L++VF+R+ELESLRASGT ED+EEREQLLTDC  L
Sbjct  117  RRRFNALLDVFRRDELESLRASGTAEDFEEREQLLTDCMAL  157

>PHYCA_112118
Length=134

 Score = 160 bits (406),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            Q KRKKAFRF+PSSD++LLKE +KH PWAAGHG+ + +W  VA G+K  LP CT DGKAC
Sbjct  25   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGEAQVSWSSVAIGLKTTLPSCTGDGKAC  84

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTI  148
            RRRF  L++VF+R+ELESLRASG+ ED+EEREQLLTDC  L  I
Sbjct  85   RRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMALVRI  128

>PHYCA_49721
Length=103

 Score = 159 bits (401),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 0/101 (0%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            ++KRKKAFRFL SSDV+LLKEV+KHTPW+AGHG+T+ AW KVASGIK ALP C ADGKAC
Sbjct  3    KQKRKKAFRFLQSSDVVLLKEVVKHTPWSAGHGETQVAWEKVASGIKEALPACIADGKAC  62

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            RRRF  L + F+REE+ESLRA GT+E+Y EREQLLTD  EL
Sbjct  63   RRRFGALYDAFRREEMESLRALGTSEEYTEREQLLTDLTEL  103

>PHYCA_70656
Length=113

 Score = 153 bits (387),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 82/91 (90%), Gaps = 0/91 (0%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KRKKAFRF+PSSD++LLKEV+KH PWAA HG+T AAW  VA+G+KAAL  CTADGKACRR
Sbjct  23   KRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGLKAALTSCTADGKACRR  82

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQ  137
            RF TL+EVF+R+ELESLRASG+ EDYEEREQ
Sbjct  83   RFNTLLEVFRRDELESLRASGSAEDYEEREQ  113

>PPTG_14663
Length=146

 Score = 148 bits (373),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 0/99 (0%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRR  107
            RKKAFRFLPSSDV+LLKEV  HTPWAA HG+T  AW  VA+ +K A+   TAD KACRRR
Sbjct  30   RKKAFRFLPSSDVLLLKEVTAHTPWAAAHGETNTAWTTVANELKNAISASTADDKACRRR  89

Query  108  FYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQ  146
            F  L++ F+REE++SLR SGT E+Y EREQLLTDC EL+
Sbjct  90   FTALLDTFRREEMKSLRVSGTAEEYREREQLLTDCLELE  128

>PHYCA_559326
Length=182

 Score = 147 bits (371),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 86/119 (72%), Gaps = 4/119 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KRKKAF F PSSD++L KEV+K  PWAA HG+T AAW   A+ +KAAL  CTADG ACRR
Sbjct  22   KRKKAFNFGPSSDIMLFKEVLKRRPWAASHGETLAAWTSFATRLKAALTSCTADGNACRR  81

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEK  165
            RF TL+ VF R+ELESLRASG+ EDYEEREQLLTDC  L       H  + A   +KEK
Sbjct  82   RFNTLLGVFCRDELESLRASGSAEDYEEREQLLTDCMTLYN----EHAQAKADKTEKEK  136

>PPTG_21678
Length=104

 Score = 117 bits (293),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 0/77 (0%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            Q KRKKAFRF+PSSD++LLKE +KH PWAAGHG+T+ +    A G+K ALP CTADGKAC
Sbjct  25   QSKRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSLSSFAIGLKTALPSCTADGKAC  84

Query  105  RRRFYTLMEVFKREELE  121
            RRRF   ++VF+R+ELE
Sbjct  85   RRRFNAPLDVFRRDELE  101

>PPTG_06351
Length=225

 Score = 105 bits (261),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 0/71 (0%)

Query  76   HGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEDYEER  135
            HGKT  AW KVASGI AALP CTADGK CRR F  L + F+REE ESLRASGT+E+Y ER
Sbjct  17   HGKTPVAWEKVASGINAALPACTADGKVCRRPFGALHDAFRREEKESLRASGTSEEYTER  76

Query  136  EQLLTDCFELQ  146
            EQLLTD  EL+
Sbjct  77   EQLLTDRTELE  87

>PITG_09072
Length=261

 Score = 97.1 bits (240),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 0/96 (0%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KR KAFRF   +D+ LL+EVI H PWA  HG     W  VA+  K  +P  T DG+AC+R
Sbjct  30   KRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWEVVATAFKRIVPWSTNDGRACKR  89

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            R+  LME +  E+L+ LR +GT     ER +LL  C
Sbjct  90   RYLALMEAYGSEKLQKLRGAGTPAMNAERAKLLMQC  125

>PHYCA_530243
Length=269

 Score = 97.1 bits (240),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 0/96 (0%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KR KAFRF   +D +LL+EV+ H PW+  HG     W  VA G K  +P  T DG+AC+R
Sbjct  40   KRAKAFRFTTVTDTLLLREVLDHKPWSCSHGDMAKTWDVVAVGFKRLVPWSTNDGRACKR  99

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            R+  L E +  E+L+ LR SGT     +RE+LL+ C
Sbjct  100  RYLALAEAYGTEKLQKLRGSGTPAQNAQRERLLSQC  135

>PPTG_03338
Length=260

 Score = 95.9 bits (237),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 59/96 (61%), Gaps = 0/96 (0%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KR KAFRF   +D+ LL+EVI H PWA+ HG     W  VA+  K  +P  T DG+AC+R
Sbjct  29   KRAKAFRFTTVTDIALLREVIDHKPWASSHGDMAKTWEVVAAAFKRIVPWSTNDGRACKR  88

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            R+  L+E +  E+L+ LR +GT     ER +LL  C
Sbjct  89   RYLALIEAYGSEKLQKLRGAGTPAMNAERAKLLAQC  124

>PHYRA_78088
Length=261

 Score = 95.9 bits (237),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 58/96 (60%), Gaps = 0/96 (0%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KR KAFRF   +D+ LL+EVI H PWA  HG     W  VA+  K  +P  T DG+AC+R
Sbjct  32   KRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWDVVATAFKRIVPWSTNDGRACKR  91

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            R+  L E +  ++L  LR SGT +   +RE+LL  C
Sbjct  92   RYLALAEAYGTQKLHKLRGSGTPQMNAQREKLLAQC  127

>PHYSO_362017
Length=273

 Score = 95.5 bits (236),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 59/101 (58%), Gaps = 0/101 (0%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
             +KR KAFRF   +D+ LL+EVI H PWA+ HG     W  VA+  K  +P  T DG+AC
Sbjct  43   HEKRAKAFRFTTVTDIALLREVINHKPWASSHGDMAKTWDVVAAAFKRTVPWSTNDGRAC  102

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +RR+  L E +   +L+ LR SGT     +RE LL  C  +
Sbjct  103  KRRYLALAEAYGTAKLQKLRGSGTPVMNAQRESLLAQCHAM  143

>H310_05293
Length=143

 Score = 88.6 bits (218),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 64/101 (63%), Gaps = 7/101 (7%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---KA  103
            KRK AFRF  +SDV LLKEVI   P+ A +G  ++ W +VA    A + +   DG    +
Sbjct  6    KRKAAFRFKSASDVDLLKEVIHIQPYDAPYGAVKSRWDEVA----ANMCMTYGDGLTSVS  61

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFE  144
            CR+RF  L++ FKR  + SLRASGT E+Y EREQLL D  +
Sbjct  62   CRKRFDDLLDAFKRNTISSLRASGTEEEYNEREQLLQDIVD  102

>PPTG_03791
Length=108

 Score = 86.7 bits (213),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            KRKKAFRF+PSSD++LLKE +KH PWAA HG+T AAW  VA+G+K AL  C AD KAC
Sbjct  19   KRKKAFRFVPSSDIMLLKEALKHRPWAAIHGETLAAWTSVATGLKVALTSCAADDKAC  76

>H310_09765
Length=115

 Score = 85.1 bits (209),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (63%), Gaps = 11/104 (11%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK-----AALPLCTADG  101
            KRK A+RF  ++DV LLKEV+   P+ AG+G+T A W ++   ++     A   +C    
Sbjct  9    KRKPAYRFTIAADVDLLKEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAVTAIC----  64

Query  102  KACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
              CRRRF  L+  FK+  L++LR+SGT E+Y +R+QLL D  +L
Sbjct  65   --CRRRFDELLAAFKKATLKALRSSGTEEEYNDRDQLLQDIVDL  106

>PYAP_15403
Length=114

 Score = 84.0 bits (206),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 64/105 (61%), Gaps = 5/105 (5%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---  101
            Q+  ++ FRF PS DV+LL+E+ +  PWAA HG+T ++W  +       L +   +G   
Sbjct  8    QEANRRTFRFKPSHDVLLLREIARLKPWAALHGETMSSWEAIGQAFNTQLAVVRPNGPEI  67

Query  102  --KACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFE  144
              +AC+RR+  L++ F   +L SLR+SG+ E+  ERE+L+ +  +
Sbjct  68   DARACQRRYKALIDSFLSGDLASLRSSGSAEEINEREELIAEVHQ  112

>SPRG_08854
Length=412

 Score = 88.2 bits (217),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 1/107 (1%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            +KRK AFRF  +SD+ LL+EV+   P+AA HG+T   W KVA+ + A +          R
Sbjct  46   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATQV-AQIHGSGITPNNVR  104

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
            +RF  LM  FK++ L +LRASG+ E+Y+ER  LL D  +  T+S  R
Sbjct  105  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  151

>H310_13306
Length=231

 Score = 85.9 bits (211),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 11/104 (11%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK-----AALPLCTADG  101
            KRK A+RF  ++DV LL EV+   P+ AG+G+T A W ++   ++     A   +C    
Sbjct  9    KRKPAYRFTNTADVDLLNEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAITAIC----  64

Query  102  KACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
              CRRRF  L+  FK+  L++LR+SGT E+Y ER+QLL D  +L
Sbjct  65   --CRRRFDDLLAAFKKATLKALRSSGTEEEYNERDQLLQDIVDL  106

>SDRG_13678
Length=415

 Score = 88.2 bits (217),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 1/107 (1%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            +KRK AFRF  +SD+ LL+EV+   P+AA HG+T   W KVA+ + A +          R
Sbjct  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVR  110

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
            +RF  LM  FK++ L +LRASG+ E+Y+ER  LL D  +  T+S  R
Sbjct  111  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157

>H310_08339
Length=230

 Score = 85.5 bits (210),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 69/112 (62%), Gaps = 11/112 (10%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK-----AALPLCTAD  100
            +++K AFRF  S+D+ LLKEV+   P+ A +G+T A W +V   ++     A   +C   
Sbjct  9    RRKKTAFRFSVSADIDLLKEVVMVVPFDAAYGQTSARWDEVCEHMRQLHGNAMTSVC---  65

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
               CR+RF  L+  FK+  L++LRASGT E+Y ER+QL+ D  ++  I+ LR
Sbjct  66   ---CRKRFDDLLPAFKKSSLKALRASGTEEEYLERDQLMQDISDMMDIALLR  114

>PPTG_14264
Length=335

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 64/101 (63%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--------  99
            +++ FRF P+ DV+L++EVI+  PWAAG+G+T +AW  VAS ++AAL             
Sbjct  33   KRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQAALESMKGVVFTRGSA  92

Query  100  -DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L+E F++ EL +LR SGT E+++ R +LL
Sbjct  93   LDHAIVKRRVDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  133

>H310_04684
Length=108

 Score = 81.3 bits (199),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 66/103 (64%), Gaps = 5/103 (5%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGK  102
             K++K AFR+  S+D+ LLKEV+   P+ A +G+T A W ++   ++      L TA   
Sbjct  8    NKRKKTAFRYSVSADIDLLKEVVMVAPYDARYGQTSARWEEICDHMRQLHGDSLTTA---  64

Query  103  ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +CR+RF  L+  FK+  L++LRASGT E+Y ER+QL+ D  ++
Sbjct  65   SCRKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDM  107

>H310_02561
Length=256

 Score = 84.3 bits (207),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 70/109 (64%), Gaps = 5/109 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL--PLCTADGKA  103
            K++K AFR+  S+D+ LLKEV+   P+ A +G+T A W ++   ++      L TA   +
Sbjct  9    KRKKTAFRYSVSADIDLLKEVVMVAPYDAPYGQTSARWEEICDHMRQLHGDSLTTA---S  65

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
            CR+RF  L+  FK+  L++LRASGT E+Y ER+QL+ D  ++  ++ LR
Sbjct  66   CRKRFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMMDVALLR  114

>H310_15292
Length=230

 Score = 83.2 bits (204),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 63/111 (57%), Gaps = 11/111 (10%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGK----  102
            KRK AF F P+SD  LLK VI   P+ A +   +  W +VA+       +C   G     
Sbjct  6    KRKVAFLFKPASDFDLLKVVIHIQPFDAPYEADKTRWEEVAAN------MCITHGDTLTA  59

Query  103  -ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
             +CR+RF  L+  FK ++L SLRASGT E+Y EREQL+ D  +L   SQ R
Sbjct  60   VSCRKRFDDLIVAFKDDKLNSLRASGTEEEYNEREQLMQDIVDLMNTSQDR  110

>PITG_08172
Length=320

 Score = 84.7 bits (208),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 63/101 (62%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--------  99
            +++ FRF P+ DV+L++EVI+  PWAAG+G+T +AW  VAS ++ AL             
Sbjct  17   KRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQTALESLKGVVFTRGSA  76

Query  100  -DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L+E F++ EL +LR SGT E+++ R +LL
Sbjct  77   LDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  117

>H310_14146
Length=109

 Score = 79.0 bits (193),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 5/96 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL--PLCTADGKA  103
            +++K AFRF  S+D+ LLKEV+   P+ A +G+T A W  +   ++ +    L TA   +
Sbjct  9    RRKKTAFRFSVSADIDLLKEVVMIAPFEAAYGQTGAGWEGICEHMRVSHGDTLTTA---S  65

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
            CR+RF  L   FK+  L++LRASGT E+Y+ER+QLL
Sbjct  66   CRKRFDDLYSAFKKATLKALRASGTEEEYQERDQLL  101

>H257_06152
Length=150

 Score = 79.7 bits (195),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 7/110 (6%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---K  102
            ++ K  FRF   +DV LLKE+I   P+ A HG+    W +V   ++    LC  DG    
Sbjct  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQ---RLC-GDGITVN  68

Query  103  ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
            A R+RF  LM  F  + + +LRASGT E+YEEREQLL D  +L   + +R
Sbjct  69   ATRKRFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIR  118

>H310_06933
Length=259

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 3/100 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL-PLCTADGKACR  105
            KRK A+RF    D+ +LKEV+   P  A +G+T + W +V   ++A L P  +A G  CR
Sbjct  8    KRKAAYRFSIPVDIDMLKEVMFACPHDAPYGQTSSRWQEVGEHMRALLGPELSAGG--CR  65

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +R   LM  FK+E ++S+RASGT E+Y EREQLL D  ++
Sbjct  66   KRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDM  105

>PHALS_08857
Length=352

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 62/101 (61%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--------  99
            +++ FRF P+ DV+L++EVI   PW+AG+G+T +AW  VA+ +++ L             
Sbjct  54   KRRLFRFKPAFDVVLVREVIHDFPWSAGYGRTRSAWMAVATRVQSTLEEMKGVTFTRGSA  113

Query  100  -DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L+E F++ EL +LR SGT E+++ R +LL
Sbjct  114  LDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  154

>PHYCA_510415
Length=337

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 63/101 (62%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL---------CT  98
            +++ FRF P+ DV+L +EVI++ PWAAG+G+T +AW  VA+ +++ L            +
Sbjct  33   KRRLFRFKPAFDVVLAREVIRNFPWAAGYGRTRSAWMAVANRVQSTLESMKGVTFTKGSS  92

Query  99   ADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L+E +++ E+  LR SGT E+++ R +LL
Sbjct  93   LDHAIVKRRVDMLLEAYRKNEMSGLRGSGTPEEFDMRNKLL  133

>PHYKE_1588
Length=333

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 62/101 (61%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL----PLCTADGKA  103
            +++ FRF P  DV+L++EVI   PWAAG+G+T +AW  VA  ++A L     L  + G A
Sbjct  27   KRRLFRFKPRFDVVLVREVICSFPWAAGYGRTRSAWMNVAQRVQAELEDMGSLSFSKGAA  86

Query  104  -----CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
                  +RR   L++ F++ E+  LR SGT ED++ R +LL
Sbjct  87   LDHAIVKRRVDMLLDAFRKNEMSGLRGSGTPEDFDMRNKLL  127

>PHYSO_383648
Length=319

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 62/101 (61%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--------  99
            +++ FRF P+ DV+L++EVI+  PWAAG+G+T +AW  VA+ +++ L             
Sbjct  10   KRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVATRVQSTLESMKGVAFTRGSA  69

Query  100  -DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L+E F++ E+  LR SGT E+++ R +LL
Sbjct  70   LDHAIVKRRVDMLLEAFRKNEMAGLRGSGTPEEFDMRNKLL  110

>H310_15291
Length=234

 Score = 78.2 bits (191),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL-PLCTADGKACR  105
            KRK A+RF    D+ LLKEV+   P  A +G+T A W +V   ++    P  T  G  CR
Sbjct  8    KRKTAYRFTTQVDIDLLKEVMAVRPHDAPYGQTLARWEEVVEHMREMRGPDLTTAG--CR  65

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +R   LM  FK++ ++SLRA+GT E+Y EREQL+ D  ++
Sbjct  66   KRLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDM  105

>HYAP_14010
Length=303

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 62/101 (61%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--------  99
            +++ FRF P+ DV+L +EVI+  PWAAG+G+T +AW  VA+ +++ L             
Sbjct  50   KRRLFRFKPAFDVVLAREVIRCFPWAAGYGRTRSAWMNVAARVQSTLESLKGVAFTRGSA  109

Query  100  -DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L+E F++ E+ SLR +GT E+++ R +LL
Sbjct  110  LDHAIVKRRVDMLLEAFRKHEMSSLRGTGTPEEFDMRNKLL  150

>H310_11755
Length=259

 Score = 78.6 bits (192),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 3/100 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL-PLCTADGKACR  105
            KRK A+RF    D+ LLKEV+   P  A +G+T + W +V   ++A   P  +A G  CR
Sbjct  8    KRKAAYRFSIPVDIDLLKEVMFACPHDAPYGQTSSRWQEVGEHMRALHGPELSAGG--CR  65

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +R   LM  FK+E ++S+RASGT E+Y EREQLL D  ++
Sbjct  66   KRHDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDM  105

>SDRG_15163
Length=292

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 2/94 (2%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRF  108
            A +F    D+++L+ V    PWAA HG   + W  +A  +  A    L    G A + RF
Sbjct  29   ASKFACKHDIVMLRSVGLLEPWAAAHGAVMSTWEAIAESLADASDFGLKNKKGPALKTRF  88

Query  109  YTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
             ++M  FK+ E +SLR SGT E+YEEREQLLTD 
Sbjct  89   ESIMNKFKKSEFQSLRKSGTVEEYEEREQLLTDI  122

>H257_07641
Length=187

 Score = 75.9 bits (185),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 54/100 (54%), Gaps = 7/100 (7%)

Query  49   KKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---KACR  105
            K AFRF   +DV LLKEVI   P+   HG+    W +V       L     DG    A R
Sbjct  16   KTAFRFKGCTDVELLKEVIHVRPYEGPHGEVRKRWTEVTE----HLQRLYGDGITVNATR  71

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +RF  LM  F    + +LRASGT +DYEEREQLL D  +L
Sbjct  72   KRFDDLMTAFHANTMAALRASGTEQDYEEREQLLQDIHDL  111

>H310_09373
Length=109

 Score = 72.8 bits (177),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 5/102 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASG--IKAALPLCTADGKA  103
            +++K AFRF   +D+ LLKEV+   P+ A  G+T A W +      +     L TA   +
Sbjct  9    RRKKTAFRFSVVADIDLLKEVVIIAPFEAASGQTGARWEEFCEHKRVSHGDTLTTA---S  65

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+R   L+  FK+  L++LRASGT E+Y+ER+QLL D  ++
Sbjct  66   CRKRVDDLLSAFKKATLKALRASGTEEEYQERDQLLQDISDM  107

>SPRG_14160
Length=319

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 2/95 (2%)

Query  50   KAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRR  107
             A +F    D+ +L+ V    PWAA HG   + W  +A  +  A    L    G A + R
Sbjct  21   NASKFACKHDIAMLRTVNLLEPWAAAHGAVMSTWDAIAESLADASDFGLKNKKGPALKTR  80

Query  108  FYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            F  +M  FK+ E +SLR SGT E+YEEREQLLTD 
Sbjct  81   FEIIMNRFKKSEFQSLRKSGTVEEYEEREQLLTDI  115

>CCA14346
Length=325

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 62/128 (48%), Gaps = 29/128 (23%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL------------  94
            ++KKAFRF P  D++LL  + +  PWAA HG     W   A     ++            
Sbjct  19   RKKKAFRFKPKHDIVLLNTIKQFMPWAAVHGYVREVWASAADAFSLSMREKFTNLDEYFG  78

Query  95   -----PLCTADGK------------ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQ  137
                  +  A+G             AC+RRF TL++  +R +LESLRASG+ E+  EREQ
Sbjct  79   EEGNNEISPANGLIGSGSTFHVNHIACKRRFDTLIDAHRRGDLESLRASGSEEECCEREQ  138

Query  138  LLTDCFEL  145
            LL D   L
Sbjct  139  LLMDIDRL  146

>H310_04120
Length=138

 Score = 73.2 bits (178),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 56/96 (58%), Gaps = 3/96 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL-PLCTADGKACR  105
            KR+ A+RF+   D+  LKEV+   P  A +G+T A W      ++    P  T  G  CR
Sbjct  8    KRRTAYRFITQVDIDFLKEVMAVCPHDAPYGQTLARWEDFVEHMREMHGPDLTTAG--CR  65

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
            +R   LM  +K+  ++SLRASGT E+Y EREQL+ D
Sbjct  66   KRLDDLMAAYKKNTVQSLRASGTEEEYNEREQLIQD  101

>PHYRA_78656
Length=347

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 61/101 (60%), Gaps = 9/101 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--------  99
            +++ FRF P+ DV+L++EVI+  PWAAG+G+T +AW  VA  ++ AL             
Sbjct  47   KRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVALRVQTALESLKGVAFTRGSA  106

Query  100  -DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
             D    +RR   L++ F++ E+  LR SG+ E+++ R +LL
Sbjct  107  LDHAIVKRRVDMLLDAFRKSEMSGLRGSGSPEEFDLRNKLL  147

>H310_07849
Length=192

 Score = 73.6 bits (179),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL-PLCTADGKACR  105
            K+K A RF    DV L+KEVI  +P  A +G+    W +V   ++A      TA G  C+
Sbjct  5    KKKPAHRFTLQQDVDLIKEVISVSPHDAPYGQLSTRWAEVGQNMQAIYASNLTASG--CQ  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +R   L+  F ++ + SLRASGT E+Y EREQLL D  ++
Sbjct  63   KRCDELLVAFHKDNIASLRASGTEENYNEREQLLQDLSDM  102

>H310_13106
Length=213

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 59/101 (58%), Gaps = 5/101 (5%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKAC  104
            KRK A+RF    D+ LLKEV+   P  A +G+  A W +V   I+      L TA    C
Sbjct  8    KRKTAYRFTTQVDIDLLKEVMAVCPHEAPYGQILARWEEVVEHIREMHGPDLITA---GC  64

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            R+    LM  FK++ ++SLRA+GT E+Y EREQL+ D  ++
Sbjct  65   RKSLDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDM  105

>PYVX_13719
Length=317

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 58/99 (59%), Gaps = 8/99 (8%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL--------CTA  99
            ++  FRF P  D+ LL+EVIK  PW AG+G T AAW  VA+ ++  L           + 
Sbjct  25   KRSMFRFRPRYDIALLREVIKRFPWGAGYGHTRAAWTAVAADVQTELEAQGVAFEQGSSL  84

Query  100  DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQL  138
            D    +RR   L+E F++ ++ESLR +G+  + E+R++L
Sbjct  85   DHTLAKRRADVLLETFRQGDMESLRGTGSPSEVEKRDKL  123

>H310_12894
Length=257

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL-PLCTADGKACR  105
            KRK A+RF    D+ LLKE +   P  A +G+  A W ++A  ++    P  T  G  CR
Sbjct  8    KRKTAYRFTTQVDIDLLKEAMFVCPHDAPYGQASARWEEIAEHMRQLHGPDLTTAG--CR  65

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +R   L+  FK++ ++SLRASGT E+Y ER+QLL D  ++
Sbjct  66   KRLDDLIAAFKKDTVKSLRASGTEEEYNERDQLLQDLADM  105

>H257_19104
Length=214

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 62/122 (51%), Gaps = 17/122 (14%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---K  102
            ++RK AFRF   +DV LLKEVI   P+ A HG+    W +V       L     DG    
Sbjct  13   QRRKTAFRFKGCTDVELLKEVIHVQPYEAPHGEVRKRWTEVTEH----LQRLYGDGITVN  68

Query  103  ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQ  162
            A R+R   L+  F    + +L ASGT E+YEEREQLL D           HG+  A F Q
Sbjct  69   ATRKRSDDLITAFHANTMAALCASGTDEEYEEREQLLQDI----------HGLVDAAFIQ  118

Query  163  KE  164
            K+
Sbjct  119  KQ  120

>H257_15222
Length=254

 Score = 70.9 bits (172),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 58/99 (59%), Gaps = 1/99 (1%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            K+K A  F    DV L+KEV+   P  A +G+T A W +V   ++  + + +     CR+
Sbjct  12   KKKPAHGFTTPQDVDLIKEVMSICPHDAPYGQTSARWAEVGEHMRT-IHVDSLSATGCRK  70

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            R   L+  F++  L SLRASGT E+Y+EREQLL D  ++
Sbjct  71   RCDDLLVAFQKAMLASLRASGTDEEYDEREQLLQDLSDM  109

>SPRG_11320
Length=274

 Score = 70.5 bits (171),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 58/102 (57%), Gaps = 7/102 (7%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVAS---GIKAALPLCTADGKA  103
            K KK FRF  +SDV LLKEVI   P+ A  G+T A W +V     GI       T     
Sbjct  8    KTKKTFRFSVASDVDLLKEVINVAPYDAPFGQTIARWEEVTEHMRGIHGEHVTFTG----  63

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  FK++ L+++RASGT  +  ER+ LL D  +L
Sbjct  64   CRKRFDDLMAAFKKDALKAMRASGTAAEVCERDLLLEDISDL  105

>H257_09434
Length=257

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 1/95 (1%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KRK A RF    DV LLKEV+   P  A +G+T   W +V   ++  +   +     CR+
Sbjct  9    KRKPAHRFTIPQDVDLLKEVLTICPHDAPYGQTSGRWAEVGDRMRT-IHGDSLSATGCRK  67

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
            R   L+  F ++ L SLRASGT E + EREQLL D
Sbjct  68   RCDDLLAAFHKDSLASLRASGTDEQHHEREQLLQD  102

>SPRG_06030
Length=196

 Score = 67.8 bits (164),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 61/119 (51%), Gaps = 21/119 (18%)

Query  49   KKAFRFL------------------PSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGI  90
            KKAFRF                   P SDV LLKE    +P    HG+T   W +VA  +
Sbjct  10   KKAFRFTVSSCGLTSLASLRRSTSGPHSDVDLLKEAKLVSPHDCPHGQTAKRWEEVAEHM  69

Query  91   KAAL-PLCTADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTI  148
            +A    L +  G  CRRRF  L+  FK + + +LRASGT ED ++R++LL D  +L  +
Sbjct  70   RAIHGDLVSIVG--CRRRFDDLLTAFKNDTVNALRASGTEEDVKKRDELLHDIADLMDV  126

>H310_14738
Length=255

 Score = 67.4 bits (163),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 55/99 (56%), Gaps = 5/99 (5%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKAC  104
            K K A RF    D+ LLKEVI   P  A +G+T   W +V   ++A   +   T D   C
Sbjct  8    KLKPAHRFTVQEDIDLLKEVILVRPHDAPYGQTAGRWEEVGDHMRAIHGMTTTTVD---C  64

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            R+R   LM  FK++ ++SLRASGT +   E+EQLL D  
Sbjct  65   RKRHDDLMVAFKQDTIKSLRASGTEKQNSEQEQLLQDLL  103

>SPRG_08573
Length=265

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 5/102 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKA  103
            K +K  +RF   +D+ LL+EVI   P  A +G+T A W +V + ++A     L  A    
Sbjct  7    KSKKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRALHGEHLTVA---G  63

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  FK + +  LRASGT E+  +R  LL +  +L
Sbjct  64   CRKRFDDLMAAFKTDSVNGLRASGTEEEMSQRFVLLEEMSDL  105

>H310_14414
Length=169

 Score = 61.2 bits (147),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL-CTADGKACRRRFYTL  111
            +F    D+ LL ++   +P  A HGK   AW  +A  +  ++       G A + RF  L
Sbjct  24   KFACHHDIKLLLQIAFASPCEADHGKQLQAWSAIADALGQSVTFGLKKKGPAMKARFDVL  83

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTD  141
            M  F R E  SLR SGT E+Y+EREQLL D
Sbjct  84   MSRFVRGESASLRKSGTAEEYKEREQLLQD  113

>SPRG_05929
Length=265

 Score = 62.8 bits (151),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 5/102 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKA  103
            K +K  +RF   +D+ LL+EVI   P  A +G+T A W +V + ++      L  A    
Sbjct  7    KTKKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRTLHGEHLTVA---G  63

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  FK + +  LRASGT E+  +R  LL +  +L
Sbjct  64   CRKRFDDLMAAFKTDNVNGLRASGTEEEMSQRYVLLEEMSDL  105

>PHYCA_104165
Length=231

 Score = 62.0 bits (149),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 3/93 (3%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEA---AWGKVASGIKAALPLCTADGKACRRRFYT  110
            F  + D++LL+ V    PW A  G T     A+  VA+  +A       DG A R RF  
Sbjct  28   FTAADDIVLLRSVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDGPALRTRFDR  87

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L+  F+  +  SLR+SG+TE+Y+ER++LL D  
Sbjct  88   LVRTFREAQRASLRSSGSTEEYKERDELLQDIV  120

>SDRG_17406
Length=264

 Score = 62.4 bits (150),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 5/102 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKA  103
            K +K  +RF   +D+ LL+EVI   P  A +G+T A W  V S ++      L  A    
Sbjct  7    KSKKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVA---G  63

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  FK + ++ LRASGT E+  +R  LL +  +L
Sbjct  64   CRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDL  105

>SDRG_17390
Length=264

 Score = 62.4 bits (150),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 5/102 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKA  103
            K +K  +RF   +D+ LL+EVI   P  A +G+T A W  V S ++      L  A    
Sbjct  7    KSKKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVA---G  63

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  FK + ++ LRASGT E+  +R  LL +  +L
Sbjct  64   CRKRFDDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDL  105

>SPRG_18521
Length=291

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 2/91 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYT  110
            +F  S DV +L+ V++  PW A HG   A W +VA  +  +    L    G A + RF T
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTD  141
            L+  F   +++ LR  GT  ++ ERE LLTD
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>SPRG_05316
Length=325

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 2/91 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYT  110
            +F  S DV +L+ V++  PW A HG   A W +VA  +  +    L    G A + RF T
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTD  141
            L+  F   +++ LR  GT  ++ ERE LLTD
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>H310_09071
Length=112

 Score = 58.5 bits (140),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (56%), Gaps = 7/104 (7%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---  101
             ++RK AFRF   +DV LLKEV    P+ A  G+    W +V   ++  +     DG   
Sbjct  12   NQRRKTAFRFKGCTDVDLLKEVKHVRPFEAPRGEVRKRWTEVTEHLQRII----GDGITV  67

Query  102  KACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
               R+RF  LM  F  + + +LRASGT E+YEEREQLL D  +L
Sbjct  68   NVTRKRFDDLMTAFHEDTMAALRASGTEEEYEEREQLLQDIHDL  111

>PPTG_24941
Length=380

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 3/45 (7%)

Query  104  CRRRFYTLM---EVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            C   +Y  M   + F REELESLRASG  EDYEEREQLLTDCFEL
Sbjct  196  CFLEYYEKMSSADAFTREELESLRASGAAEDYEEREQLLTDCFEL  240

>SDRG_06597
Length=317

 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 2/91 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYT  110
            +F  S DV +L+ V++  PW A HG   A W +VA  +  +    L    G A + RF T
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWERVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTD  141
            L+  F   +++ LR  GT  ++ ERE LLTD
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTD  124

>H310_10581
Length=241

 Score = 60.1 bits (144),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 48/91 (53%), Gaps = 1/91 (1%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGI-KAALPLCTADGKACRRRFYTL  111
            +F    D+ LL ++   + W A HGK   AW  +A  + ++A       G A + RF  L
Sbjct  24   KFACHHDIKLLLQITFASRWEADHGKQLQAWSAIADALGQSATFGLKKTGPAIKTRFDVL  83

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            M  F R E  SLR SGT E+YEE EQL+ D 
Sbjct  84   MSRFVRGESASLRKSGTAEEYEEGEQLMQDI  114

>PHYCA_96385
Length=135

 Score = 57.8 bits (138),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 3/93 (3%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEA---AWGKVASGIKAALPLCTADGKACRRRFYT  110
            F  + D++L + V    PW A  G T     A+  VA+  +A       DG A R RF  
Sbjct  28   FTAADDIVLQRCVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDGPALRTRFDR  87

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L+  F+  +  SLR+SG+TE+Y+ER++LL D  
Sbjct  88   LVRTFREAQRASLRSSGSTEEYKERDELLQDII  120

>H257_15235
Length=178

 Score = 58.5 bits (140),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 1/82 (1%)

Query  64   KEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREELESL  123
            +EVI   P+ A HG+    W KV   ++  L        A R+RF  LM  F  + + +L
Sbjct  8    EEVIHVRPYEAPHGEVRKRWTKVTEHLQR-LHGVGITVNATRKRFDDLMTAFHADSMAAL  66

Query  124  RASGTTEDYEEREQLLTDCFEL  145
            R SGT E+YEER QLL D  +L
Sbjct  67   RVSGTDEEYEERAQLLQDIHDL  88

>H257_06253
Length=237

 Score = 59.3 bits (142),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 3/85 (4%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGK--ACRRRFYTLMEVFK  116
            D+ LLK+V    PW AG+GK  AAW +V   +   +P    + K    + RF  L++   
Sbjct  29   DIQLLKQVNLSKPWEAGYGKVMAAWVEVCREV-IRIPGFKINKKPEGLKTRFDLLIKTHC  87

Query  117  REELESLRASGTTEDYEEREQLLTD  141
              E+ S+R SGT+EDY ER+ LLTD
Sbjct  88   EGEMASMRKSGTSEDYTERDLLLTD  112

>H310_12714
Length=377

 Score = 59.7 bits (143),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 14/118 (12%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            +++K AFRF  S+D  LLKEV+   P+ A +G+T  A G+          +C    K  R
Sbjct  9    RRKKTAFRFSVSADSDLLKEVVMIAPFEAAYGQT-GARGE---------EICEHMRKTIR  58

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQK  163
            R  +++ E   +     LR SGT E+Y+ER QLL D  ++  ++QL+   + +  +++
Sbjct  59   RFAFSVQESHSK----GLRTSGTEEEYQERNQLLQDISDMMDLAQLKKKTAISVQDKR  112

 Score = 37.4 bits (85),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 1/64 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKR  117
            D  LLK+V   TP+AA  G+ + AW  +A  + A        DGK  + RF  L++  ++
Sbjct  272  DYTLLKQVAAGTPFAAEKGQLKRAWQGLADTLMACENFGRVVDGKNLQNRFLALVDEHRK  331

Query  118  EELE  121
            +E E
Sbjct  332  QEKE  335

>PYAP_24609
Length=405

 Score = 60.1 bits (144),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 1/93 (1%)

Query  49   KKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRF  108
            KK + F   +D+ LLKE++   P+ A HGK    +  V   +   L    A  +  + RF
Sbjct  123  KKKYHFTVKADLALLKEMLNIRPFLAEHGKKGEKYETVTENLNEHLETNLA-CRTVKERF  181

Query  109  YTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
              L++ F++ E  S R SG  EDY+E EQLLTD
Sbjct  182  NLLVDKFEKAEASSRRKSGAAEDYDEYEQLLTD  214

>H257_03945
Length=230

 Score = 58.5 bits (140),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 2/92 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            D  LLKEV++  P+  GHGK  A W K A  +    P     G+ C+ R  T++  F R+
Sbjct  16   DEALLKEVVRLGPFEVGHGKVTATWAKAAVAMHEYDP--NLSGRICQARCDTILHDFARD  73

Query  119  ELESLRASGTTEDYEEREQLLTDCFELQTISQ  150
               S+RASG  ED ++  +L  D  +++  S+
Sbjct  74   NQASMRASGVYEDDDDMTKLKQDVLDIREDSK  105

>H257_15150
Length=145

 Score = 57.0 bits (136),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 2/93 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYT  110
            RF    D++LL+E+    P+ A  G+    W  VA  +++         DGK  + RF  
Sbjct  8    RFTEDEDILLLREINGRLPFMAKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTL  67

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L+E  + ++ E  RASGT E Y E+ QLL D  
Sbjct  68   LLEGHRHKDEEGKRASGTDEGYGEKFQLLDDLL  100

>H257_14013
Length=217

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 2/93 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYT  110
            RF    DV+LL+EV    P+ A  G    AW +VA+ + +         D K    RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRARRGAVMDAWAEVAAALLSHEDFDRSVFDAKRAHNRFTL  67

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L+E  + +  ES+RASG  E+Y E+ QLL +  
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDELL  100

>PPTG_11368
Length=130

 Score = 56.2 bits (134),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 49/102 (48%), Gaps = 20/102 (20%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALP----LCTAD--------  100
            +F    DV+LL+ V    PW A  G        + +GI          C AD        
Sbjct  31   KFAAVDDVVLLRAVNAFRPWRAPVG--------IFNGIMKVFEDIAFQCGADPDFGVDKP  82

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            G A R RF TLM+ FKR++  S+R SGT E YEER++L  D 
Sbjct  83   GVALRTRFGTLMKEFKRDQCRSMRKSGTVEQYEERDRLSVDI  124

>PHYSO_470381
Length=145

 Score = 56.6 bits (135),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (51%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+RK   RF    D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR
Sbjct  8    KRRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ ++ ++  S + SG  E+Y  +++ L +  E++ I  L
Sbjct  63   ERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEAL  108

>PHYCA_62751
Length=116

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD---GKA  103
            KRKK   F  + DV LL++V    P+ A  G   A+W  +A+ +K        D   GK+
Sbjct  5    KRKK---FTKTDDVALLRQVQAELPFKAAKGGVMASWDALANNLKTLKDFSKEDTITGKS  61

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
             + RF TL+   ++ + +S RASG  + Y E+ QLL D
Sbjct  62   AQARFNTLVASHRKFDKKSERASGIDQRYAEKRQLLDD  99

>PHYSO_373613
Length=130

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 52/105 (50%), Gaps = 5/105 (5%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            +RK   RF    D  L++E     P+   +GK   AW  VA+ +     +   DG+ CR 
Sbjct  1    RRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAAL-----VVDVDGRRCRE  55

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
            R   L++ ++ +++ S + SG  E+Y  +++ L    E++ I  L
Sbjct  56   RCNQLVDAYEAKQMASEKPSGPCEEYAPKKECLAKLLEMREIEAL  100

>PHYSO_376280
Length=138

 Score = 56.2 bits (134),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (51%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+RK   RF    D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR
Sbjct  8    KRRKTMVRFTDERDFQLIQEAQAINPYGEDYGKKTQAWADVAAALEVDV-----DGRRCR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ ++ ++  S + SG  E+Y  +++ L +  E++ I  L
Sbjct  63   ERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEAL  108

>H257_18152
Length=209

 Score = 57.4 bits (137),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 45/92 (49%), Gaps = 2/92 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYT  110
            RF    DV++L+EV    P+ A  G     W  VA  + +         D K  + RF  
Sbjct  8    RFSEYEDVLILREVNARLPFMAKRGLVMVGWAAVAEAVASQEEFSRPGFDAKRAQNRFTL  67

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            L+E  +  + ES+RASG  EDY E+ QLL + 
Sbjct  68   LLEGHRVRDDESMRASGVAEDYNEKSQLLDEL  99

>H310_12832
Length=258

 Score = 57.4 bits (137),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 1/99 (1%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            +R  AFRF   +DV LLKEV    P+ A +G+    W +V+  ++           A R+
Sbjct  14   RRNTAFRFKGCTDVELLKEVNHVRPFEAPYGEVRKRWTEVSEHLQRIYGTGIT-VNATRK  72

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            RF  LM  F+ E + +LRASGT E+YEEREQLL D  +L
Sbjct  73   RFDDLMTAFQEETMAALRASGTEEEYEEREQLLQDNHDL  111

>H257_05648
Length=172

 Score = 56.2 bits (134),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYT  110
            RF  + D+++L+EV    P+ A  G    AW  VA  +           DGK    RF  
Sbjct  8    RFSDAEDILILREVNARLPFTAKRGSVMLAWNTVADAVSTKHDFARPGFDGKRALNRFTL  67

Query  111  LMEVFKREELESLRASGTTEDYEEREQLL  139
            LME  +     S RASG  ED++E+ QLL
Sbjct  68   LMEGHRANNDVSARASGIDEDHDEKTQLL  96

>PHYSO_254181
Length=154

 Score = 55.8 bits (133),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (51%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+RK   RF    D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR
Sbjct  19   KRRKTMVRFTDELDFQLIQEAQARYPYGEDYGKKTQAWADVAAALEVDV-----DGRRCR  73

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ ++ ++  S + SG  E+Y  +++ L +  E++ I  L
Sbjct  74   ERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEAL  119

>H257_18023
Length=128

 Score = 55.1 bits (131),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 2/93 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYT  110
            RF    DV+LL+EV    P+    G    AW +VA+ + +         D K    RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRVRRGAVMDAWAEVAAALLSHEDFDRPGFDAKRAHNRFTL  67

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L+E  + +  ES+RASG  E+Y E+ QLL +  
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDELL  100

>H257_13170
Length=198

 Score = 56.2 bits (134),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 5/99 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKAC  104
            K++K  F      D++LL++V    P+ A HG   + W  VA  + +        +GK C
Sbjct  8    KRKKSTF----DEDIVLLRQVSADLPFEASHGTIGSNWESVARTLTSCSTFGRNVNGKKC  63

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            + RF  L++  K    E+++ASG +ED  E+ QLL D  
Sbjct  64   QNRFNILLDEQKILRQEAMKASGASEDETEKTQLLDDLL  102

>PHYSO_453976
Length=138

 Score = 55.1 bits (131),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 55/106 (52%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+R+   RF    D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR
Sbjct  8    KRRETIVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ ++ +++ S + SG  E+Y  +++ + +  E++ I  L
Sbjct  63   ERCDQLVDAYEAKQMASEKRSGPCEEYTPKDECVAELLEMREIEAL  108

>H310_14154
Length=178

 Score = 55.8 bits (133),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)

Query  103  ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
            +CR+RF   +  FK ++L SLRASGT E+Y EREQL+ D  +L   SQ R
Sbjct  13   SCRKRFDDFIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLMNTSQDR  62

>SDRG_12398
Length=264

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 3/97 (3%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL-CTADGKACRRRFYTLMEVFKR  117
            DV+L + V    PW A  G+    W ++A  +          DG AC+ RF  ++ +   
Sbjct  46   DVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKILRMTIG  105

Query  118  EELESLRASGTTEDYEEREQLLTDCFELQTISQLRHG  154
             E E LR +GT ++Y+ERE+LL + +E   I Q R G
Sbjct  106  GEKEMLRKTGTDDEYDERERLLRNMYE--QIDQYRDG  140

>SPRG_09172
Length=265

 Score = 57.0 bits (136),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 3/97 (3%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL-CTADGKACRRRFYTLMEVFKR  117
            DV+L + V    PW A  G+    W ++A  +          DG AC+ RF  ++ +   
Sbjct  47   DVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKILRMTIG  106

Query  118  EELESLRASGTTEDYEEREQLLTDCFELQTISQLRHG  154
             E E LR +GT ++Y+ERE+LL + +E   I Q R G
Sbjct  107  GEKEMLRKTGTDDEYDERERLLRNMYE--QIDQYRDG  141

>PHYKE_6162
Length=201

 Score = 55.8 bits (133),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            +KR+KAFRF  +SD++LL++V+  TPW+  HG+T  AW  VA   +  L  C  +    R
Sbjct  25   EKRRKAFRFQTASDIVLLRQVMARTPWSCPHGETGPAWDAVAER-EQLLARCQFNTDDYR  83

Query  106  RRFYT  110
            RR  T
Sbjct  84   RRKTT  88

>PYU1_G004359
Length=237

 Score = 56.2 bits (134),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 7/106 (7%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            +K+RK  FRF  + D  LL E +   P+AA HG+  A W +VA  +         D + C
Sbjct  19   KKQRKVQFRFSHADDARLLTETVAVNPFAAPHGRVAARWAQVADNMG-----VDVDARRC  73

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYE--EREQLLTDCFELQTI  148
            R R   L+  F+    +  RA+ +  + E    +QLL D   L++I
Sbjct  74   RERVILLLSQFRERGADDSRATDSANEGEADSMQQLLADVATLESI  119

>H257_02519
Length=268

 Score = 56.6 bits (135),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (54%), Gaps = 3/91 (3%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYT  110
            +F    D++LL++V    PW   +G     W +VA+ +       +    G A + RF  
Sbjct  17   KFARCHDIMLLQQVSLSRPWEGEYGTVMTIWAEVATELNRMPGFSMVKKPG-ALKTRFEY  75

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTD  141
            L+   ++ E  SLR SGTTE+Y ER+QLLTD
Sbjct  76   LLAKHEKGESASLRKSGTTEEYSERDQLLTD  106

>H257_16670
Length=136

 Score = 54.7 bits (130),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 46/99 (46%), Gaps = 31/99 (31%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            K+K A RF    DV LLKEV+   P  A +G+T A W + A+                  
Sbjct  12   KKKPAHRFTTPQDVDLLKEVMSICPHDAPYGQTSARWAEKAT------------------  53

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
                         L SLRASGT E+Y+EREQLL D  ++
Sbjct  54   -------------LASLRASGTDEEYDEREQLLQDLSDM  79

>PHYCA_132727
Length=261

 Score = 55.8 bits (133),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 16/111 (14%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYT  110
             FRF    D  LL+E+I+  P+AA  G T   W  VA+ + +A  +   + K  R R   
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAIRGTTLRVWSDVAASLSSAFSV-EVNVKQIRDRLTL  60

Query  111  LMEVFKREELESLRASGTTED---------YEEREQL------LTDCFELQ  146
            L ++FK  E+ S R SG  E          Y+ERE+L      L D F+L+
Sbjct  61   LKQIFKDSEVASARGSGVEEKADAVNIQSHYDEREELVREYVALEDHFKLE  111

>PHYCA_118350
Length=156

 Score = 54.3 bits (129),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (54%), Gaps = 3/91 (3%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEA---AWGKVASGIKAALPLCTADGKACRRRFYT  110
            F  + D++LL+ V    PW A  G T     A+  VA+  +A       D  A R RF  
Sbjct  28   FTAADDIVLLRCVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDDPALRTRFDR  87

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTD  141
            L+  F+  +  SLR+SG+T++Y+E ++LL D
Sbjct  88   LVRTFREAQRASLRSSGSTQEYKEHDELLQD  118

>H257_14889
Length=157

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (48%), Gaps = 2/105 (2%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            +K +K   +    D  LLKEV++  P+  GH K  A W K A  +    P     G  C+
Sbjct  3    RKDRKQILWTDEMDEALLKEVVRLGPFEVGHDKVTATWAKAAVAMHEYDP--NLSGCICQ  60

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQ  150
             R  T++  F R+   S+RASG  ED ++      D  +++  S+
Sbjct  61   ARCDTILHDFARDIQASMRASGVYEDDDDMTMFKQDLLDMREYSK  105

>H257_04778
Length=147

 Score = 53.5 bits (127),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 3/100 (3%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            QK R +   +    D  LL+EV++  P+  GHGK  A W K A  +    P  +A  +AC
Sbjct  3    QKDRNQVM-WTEDMDEALLREVVRLGPYEVGHGKVTATWTKAALAMHEFDPNISA--RAC  59

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFE  144
            +    TL+  F ++   S+RASG  ED ++  +L  D  +
Sbjct  60   QTGCDTLLHEFSQDNQRSVRASGVEEDDDDIVKLKQDILD  99

>H310_03385
Length=223

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKACRRRFYTL  111
            F    DV+LL++V    P+ A HG     W  VA  + ++      D  GK    RF  L
Sbjct  10   FSKEEDVLLLRQVASEMPFLARHGLIMDKWTAVAHALASSDEFGRPDFDGKKASNRFSAL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            +E  K+++ E  RASG  ED  E++ L+ D  
Sbjct  70   IEAHKKKKNEFARASGVAEDMTEKDALMDDLI  101

>PHYSO_435001
Length=138

 Score = 53.1 bits (126),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+RK   R     D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR
Sbjct  8    KRRKMMVRVTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ +K ++  S + SG  E+Y  +++   +  E++ I  L
Sbjct  63   ERCNQLVDAYKAKQKASEKQSGPCEEYTPKDECRAELLEMREIEAL  108

>H310_04124
Length=81

 Score = 51.2 bits (121),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 44/101 (44%), Gaps = 41/101 (41%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KRK AFRF  +SDV LLKE                                         
Sbjct  6    KRKVAFRFKSASDVDLLKE-----------------------------------------  24

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQT  147
            RF  L+  FK ++L SLRASGT E+Y EREQL+ D  +L +
Sbjct  25   RFDDLIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLMS  65

>H257_04948
Length=247

 Score = 53.9 bits (128),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query  57   SSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCT-ADGKACRRRFYTLMEVF  115
            S D+ LL EV    PW +       AW K+A  +     L     G A R+R   L++  
Sbjct  24   SDDIALLNEVSFSRPWESRRSAAGLAWEKIAKKLTTDTSLSAFKSGPALRKRTEFLLKKH  83

Query  116  KREELESLRASGTTEDYEEREQLLTDC  142
               E  SLR SG+TE+Y+ R QLLTD 
Sbjct  84   AANEHASLRKSGSTEEYDVRTQLLTDV  110

>PHYCA_510606
Length=74

 Score = 50.8 bits (120),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)

Query  86   VASGIKAALPLCTADGKACRRRFYTLME  113
            VA+G+KAAL  CTADGKACRRRF TL+E
Sbjct  1    VATGLKAALTSCTADGKACRRRFNTLLE  28

>H257_00956
Length=202

 Score = 53.1 bits (126),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 43/93 (46%), Gaps = 2/93 (2%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYT  110
            RF  + D+++L+EV    P+ A  G    AW  VA  +           DGK    RF  
Sbjct  8    RFSDTEDILILREVNARLPFNAKRGSVMLAWNAVADAVSTNHDFAWPGFDGKRALNRFTL  67

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            LME        S RASG  ED++E+ QLL +  
Sbjct  68   LMEGHCANNDVSARASGIDEDHDEKTQLLDELL  100

>H257_09054
Length=151

 Score = 52.4 bits (124),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query  57   SSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL-CTADGKACRRRFYTLMEVF  115
            S ++ LL  V    PW A  G     W  +AS +KA        DG+ C+ RF  L + +
Sbjct  37   SDNITLLIAVNDAKPWTASSGSLMKTWTDIASDLKANRRFKVDKDGQGCKTRFDKLTKAY  96

Query  116  KREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGV  155
                L ++R SGT E++ E +Q L D      +SQ+ + V
Sbjct  97   MERTLTAMRGSGTDEEFGECKQPLEDI-----LSQVNNFV  131

>PHYSO_325763
Length=157

 Score = 52.4 bits (124),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 5/96 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+RK   RF    D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR
Sbjct  19   KRRKTMVRFTDELDFQLIQEAQARNPYGKDYGKKTQAWADVAAALEVDV-----DGRRCR  73

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
             R   L++ ++ ++  S + SG  E+Y  +++ L +
Sbjct  74   ERCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAE  109

>H257_07657
Length=212

 Score = 53.1 bits (126),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 44/92 (48%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR--RRFYTL  111
            F    DV+LL++V    P+ A  G     W  VAS ++ A     +D  A R   RF  L
Sbjct  10   FTEDDDVMLLRQVSLEMPFQARRGHVMERWADVASALEMADDFRRSDIDAKRACNRFMLL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            ++  ++   +S RASG  ED  E+  LL D  
Sbjct  70   LDAHRKANNQSQRASGVAEDVSEKTVLLDDLL  101

>H310_14954
Length=149

 Score = 52.0 bits (123),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 49/101 (49%), Gaps = 5/101 (5%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKAC  104
            Q KR+    F    D++LL++V    P+   HG+    W  VAS ++ +      D  A 
Sbjct  4    QTKRRN---FTEQEDIMLLRQVSLEMPFQTRHGQVMERWAAVASALQGSGEFTRDDIDAK  60

Query  105  R--RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            R   RF  L++  +R   ES RASG +E+  E+  LL D  
Sbjct  61   RACNRFMLLLDGHRRINKESQRASGVSEEVGEKTILLDDLM  101

>PHYSO_380505
Length=138

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 52/106 (49%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K RK   RF    D  L++E     P+   +GK    W  VA+ ++  +     DG+  R
Sbjct  8    KPRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQTWADVAAALEVDV-----DGRRYR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R+  L++ ++ ++  S + SG  E+Y  +++ L +  E++ I  L
Sbjct  63   ERYNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEAL  108

>H310_13569
Length=205

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 44/96 (46%), Gaps = 2/96 (2%)

Query  49   KKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRR  106
            K   RF  + DV+L +EV    P+ A  G     W +VA  + +         DGK    
Sbjct  4    KDKLRFTDAEDVLLPREVNAKLPFKAKRGTVIIVWNEVADAVNSNEEFNRVGIDGKRALN  63

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            RF  LM+        S RASG  E+Y+E+ QLL + 
Sbjct  64   RFTLLMDNNHSSNEASSRASGIEEEYDEKTQLLDEL  99

>PHYCA_125686
Length=290

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 5/99 (5%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKAC  104
            KRKK   F    D++LL++V    P+A+  G    AW  +A+ +K        +  GK+ 
Sbjct  33   KRKK---FSKHDDLVLLRQVNADQPFASVRGSLMDAWTSLANKVKVVEGFSKQEITGKSA  89

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            + RF  L+E  +  + +S  ASG +EDY E +QLL +  
Sbjct  90   QARFNVLVENHREADKKSAAASGVSEDYTESQQLLDEIV  128

>CCI47495
Length=285

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 46/107 (43%), Gaps = 35/107 (33%)

Query  71   PWAAGHGKTEAAWGKVA--------------------------------SGIKAALPLCT  98
            PWAA HG     W   A                                SGI A   +  
Sbjct  2    PWAAVHGYVREVWASAADAFSLSMREKFTKLDQCFGEDGNKDFASISALSGIGAVFHV--  59

Query  99   ADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
             +  AC+RRF TL++  +R +L+SLRASG+ E+  EREQLL D   L
Sbjct  60   -NHIACKRRFDTLLDAHRRRDLDSLRASGSEEECCEREQLLLDIDRL  105

>H257_19436
Length=199

 Score = 52.0 bits (123),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 3/83 (4%)

Query  62   LLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGK--ACRRRFYTLMEVFKREE  119
            LLK+V    PW AG+ K  AAW +V   +   +P    + K    + RF  L++     E
Sbjct  1    LLKQVNLSKPWEAGYDKVMAAWVEVCREVNR-IPGYKINKKPEGLKTRFDLLIKTHCEGE  59

Query  120  LESLRASGTTEDYEEREQLLTDC  142
            + S+R SGT+EDY E++ LLTD 
Sbjct  60   VASMRKSGTSEDYTEKDLLLTDI  82

>H310_15369
Length=209

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)

Query  98   TADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            T    +CR+RF  L+  FK+  L++LRASGT E+Y ER+QLL D  ++
Sbjct  8    TITASSCRKRFDDLLSAFKKATLKALRASGTEEEYNERDQLLQDIVDM  55

>PPTG_02416
Length=125

 Score = 50.1 bits (118),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 49/105 (47%), Gaps = 10/105 (10%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYT  110
             FRF    D  LL+E+I+  P+AA  G T   W  VA+ + +A  +   + K  R R   
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAVRGTTLRVWSDVAASLSSAFGV-EVNVKQIRDRLTL  60

Query  111  LMEVFKREELESLRASGTTED---------YEEREQLLTDCFELQ  146
            L + FK  E  S R SG  E          Y+ERE L+ +   L+
Sbjct  61   LKQSFKDSEATSARGSGIEESVDAVNVQSHYDEREGLVREYVALE  105

>H257_13889
Length=138

 Score = 50.4 bits (119),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 2/84 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            ++ +L+E I+  P+AA HG+  A W  VA+ +    P  T   +A R   Y L++ FK +
Sbjct  20   ELAILREAIRVEPFAADHGELLARWTLVAAAVAEQEPRVT--PRAAREHVYMLLKKFKAD  77

Query  119  ELESLRASGTTEDYEEREQLLTDC  142
            +     +SGT E+  E+ QLL D 
Sbjct  78   DQAQRLSSGTAEEVTEKVQLLQDI  101

>PHYSO_548072
Length=362

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 53/97 (55%), Gaps = 5/97 (5%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACR  105
            R +  +F+ + D++LL +V++  PWA  H      W +V   ++  +   L    G AC+
Sbjct  139  RSQRRQFVSADDILLLTQVLETKPWAYPH--VMDGWQEVCDRLRGHSEFHLDKTAG-ACQ  195

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
             R   L++  K   + +LR SGT+E+YE + +LLTD 
Sbjct  196  ARVALLLDHLKAGNIAALRKSGTSEEYERKRELLTDV  232

>H257_19019
Length=229

 Score = 51.2 bits (121),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 2/85 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            +V LL+EV +  P+AA HG     W  VASG+ A  P     G   R     +++ FK+E
Sbjct  27   EVELLREVSRIEPFAADHGDLLQRWKLVASGLSAHEPKINYRG--AREHVDAMLKQFKQE  84

Query  119  ELESLRASGTTEDYEEREQLLTDCF  143
            +     +SGT ED  E+ QLL D  
Sbjct  85   DKVQQLSSGTDEDVTEKVQLLQDLI  109

>H257_00377
Length=223

 Score = 50.4 bits (119),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (49%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR--RRFYTL  111
            F    D++LL++V    P+ A  G     W  VA+ ++ A     +D  A R   RF  L
Sbjct  10   FSEEDDIMLLRQVSLEMPFQARRGLVMERWNSVAASLRTAEDFSRSDIDAKRSCNRFMLL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            ++  ++ + +S RASG  E+  E+  LL D  
Sbjct  70   LDAHRKSDKQSERASGIDEEVTEKSMLLDDLL  101

>PHYSO_330097
Length=203

 Score = 50.4 bits (119),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 5/100 (5%)

Query  52   FRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTL  111
             RF    D  L++E     P+   +GK   AW  VA+ ++  +     DG+ CR R   L
Sbjct  2    VRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALEVDV-----DGRRCRERCNQL  56

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
            ++ ++ ++  S + SG  E+Y  +++ L +  E++ I  L
Sbjct  57   VDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREIEAL  96

>PPTG_14366
Length=283

 Score = 50.8 bits (120),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 6/99 (6%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD---GKA  103
            KRKK   F  + DV LL++V    P+ A  G   A+W  +A+ +K        D   GK+
Sbjct  122  KRKK---FTNADDVALLRQVQADMPFKAAKGGVMASWDSLANNLKTLKNFSKKDTISGKS  178

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
             + RF TL+  +++ + +S  AS   + Y E+ QLL D 
Sbjct  179  AQARFNTLVISYRKFDRKSEGASDIDQRYAEKRQLLDDL  217

>H257_17402
Length=149

 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 9/93 (10%)

Query  58   SDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-----TADGKACRRRFYTLM  112
             D+ LLK+V   TP+AA  G+   AW     G+   L  C       DGK  + RF  L+
Sbjct  14   DDLTLLKQVTADTPFAAEKGQLRKAW----QGLAETLMSCENFGRVVDGKKVQNRFQALV  69

Query  113  EVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +  ++ +  S R SG+ ++ +E+  LL D   L
Sbjct  70   DEHRKFDATSARLSGSDQEEKEKHMLLDDIITL  102

>H257_12325
Length=191

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR--RRFYTL  111
            F    D++LL++V     + A  G     W  VA+ ++ +     +D  A R   RF  L
Sbjct  10   FSEEDDIMLLRQVSLEMQFQARRGLVMERWNSVAASLRTSEDFSRSDIDAKRLCNRFMLL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            ++ +++ + +S RASG  E++ E+  LL D  
Sbjct  70   LDAYRKSDKQSERASGIDEEFTEKSMLLDDLL  101

>PPTG_16083
Length=241

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 7/78 (9%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            KKR++ F F   +D+ LLKE++ + P+A GHGK  A +  VA  + A L L   D K  +
Sbjct  160  KKRRRKFFFDQKADLALLKEMLANEPFAGGHGKIGARYQLVADNLSAHLKL---DQKLSK  216

Query  106  R----RFYTLMEVFKREE  119
            R    RF  L++ FK+ +
Sbjct  217  RTVQERFALLLDEFKQND  234

>H257_13978
Length=172

 Score = 48.5 bits (114),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 2/106 (2%)

Query  71   PWAAGHGKTEAAWGKVASGIKAALPL-CTADGKACRRRFYTLMEVFKREELESLRASGTT  129
            PW A  G+    W  +A  ++       T DG AC+ RF  L++    + L ++R SGT 
Sbjct  28   PWEAPSGQVMNTWADLAKDLRDNRRFRLTKDGAACKSRFENLIKAHCGDSLAAMRRSGTD  87

Query  130  EDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKAV-KYGCIAR  174
            E++ E +QLL D        ++   V  A   +K+  + K G I R
Sbjct  88   EEFGECDQLLEDISSQVEDHRVLKEVGRAVDAKKKNGIEKSGVIMR  133

>H257_18551
Length=221

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 2/84 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            ++ +L+E I+  P+AA HG+  A W  VA+ +    P  T   +A R   + L++ FK +
Sbjct  20   ELAILREAIRVEPFAADHGELLARWTLVAAAVAEQEPRVTP--RAAREHVHMLLKKFKAD  77

Query  119  ELESLRASGTTEDYEEREQLLTDC  142
            +     +SGT E+  E+ QLL D 
Sbjct  78   DQAQRLSSGTAEEVTEKVQLLQDI  101

>H310_12821
Length=179

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query  56   PSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEV  114
            P  D+ LL +V    P+AA  G+ + AW  +A  + A        DGK  + RF  L+E 
Sbjct  12   PEEDITLLIQVAADRPFAAEKGQLKKAWQALADTLMACDHFGRVVDGKKVQNRFLALVEE  71

Query  115  FKREELESLRASGTTEDYEEREQ--LLTDCFEL  145
             K  + ES R SG   D EERE+  LL D   L
Sbjct  72   HKIFDAESARLSGV--DAEEREKHVLLDDIVNL  102

>PHYKE_4001
Length=496

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKACRRRFYT  110
            +F  + D++LL EV+   PWA  H      W +VA  ++  L  C  +    AC+ R   
Sbjct  267  QFSSADDIVLLTEVLSMKPWAFAHEMD--GWQQVALNLRE-LTACRLEKTAGACQSRIML  323

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            L+E  +   + +LR SGT +++  + +LLT+ 
Sbjct  324  LLEHLRAGNIAALRKSGTEDEFSRKHELLTEV  355

>H257_08032
Length=251

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 45/87 (52%), Gaps = 1/87 (1%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCT-ADGKACRRRFYTLM  112
            F    D++L + V +  PWAA  G+    W  +A  +          DG AC+ RF  ++
Sbjct  30   FCARDDILLCEAVNEVKPWAARSGEIMMYWANIADKLMHTRGFALRKDGPACKTRFEKIV  89

Query  113  EVFKREELESLRASGTTEDYEEREQLL  139
            ++    E + LR SG+ +++ ERE+L+
Sbjct  90   KMITGGEQDVLRKSGSEDEFAERERLV  116

>PPTG_05843
Length=169

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 10/93 (11%)

Query  65   EVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREELESLR  124
            E+I+  P++A  G T   W +VA G+ +A+     + K  R R   L   FK +EL S R
Sbjct  3    ELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQ-VQLNVKQVRDRLNLLKAKFKADELSSAR  61

Query  125  ASGTTED---------YEEREQLLTDCFELQTI  148
            ASG  ED         Y +   L+ D  EL+ +
Sbjct  62   ASGVEEDLHAVNIQSHYNDLNGLVRDYIELERM  94

>PHYSO_378731
Length=138

 Score = 47.0 bits (110),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+RK   RF       L++E     P+   +GK   AW  VA+  +  +     DG+  R
Sbjct  8    KRRKTMVRFTDELHFQLIQEAQARNPYGEDYGKKSQAWADVAAAFEVDV-----DGRRYR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ ++ ++    + SG  E+Y  +++ L +  E++ I  L
Sbjct  63   ERCNQLLDAYEAKQKAGEKRSGPCEEYTPKDECLAELLEMREIEAL  108

>PHYSO_536456
Length=212

 Score = 48.1 bits (113),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            G A R RF TLM  FK ++ +S+R SGT E+YEERE LL +  
Sbjct  23   GPAMRTRFTTLMSQFKADQYQSMRKSGTVEEYEEREVLLQNIL  65

>PYIW_25658
Length=148

 Score = 47.0 bits (110),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query  71   PWAAGHGKTEAAWGKVASGIKAALP-LCTADGKACRRRFYTLMEVFKREELESLRASGTT  129
            PW +        W  +AS ++     +    G A + RF   M++F  ++L SLR SGT 
Sbjct  4    PWESSRNSIMKNWETIASTLRDNQSFIANKGGLAIKTRFEKTMKLFVSQDLASLRKSGTQ  63

Query  130  EDYEEREQLLTDC  142
            E Y+ RE LL D 
Sbjct  64   EKYQRRELLLKDI  76

>H257_13434
Length=236

 Score = 48.1 bits (113),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 9/93 (10%)

Query  58   SDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-----TADGKACRRRFYTLM  112
             D+ LLK+V   TP+AA  G+   AW     G+   L  C       DGK  + RF  L+
Sbjct  14   DDLTLLKQVAADTPFAAEKGQLRKAW----QGLAETLMPCENFGRVVDGKKVQNRFLALV  69

Query  113  EVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +  ++ +  S R SG+ ++ +E+  LL D   L
Sbjct  70   DEHRKFDATSARLSGSDQEEKEKHMLLDDIITL  102

>H310_11608
Length=221

 Score = 47.8 bits (112),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 42/99 (42%), Gaps = 36/99 (36%)

Query  47   KRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR  106
            KRK AFRF  +SD+ LLKE  +  P A                                 
Sbjct  6    KRKAAFRFKSASDIDLLKE--RFVPQA---------------------------------  30

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
             F    + FKR  + SLRASGT E+Y EREQ L D  +L
Sbjct  31   -FRRSTDAFKRNTISSLRASGTEEEYSEREQFLQDIVDL  68

>H310_15319
Length=227

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (46%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKACRRRFYTL  111
            +    D++LL++V    P+ A HG     W  VA  + A       D   K    RF  L
Sbjct  10   YTDEEDLMLLRQVAYEMPFLARHGLIMDKWASVAQALAADENFSRPDFDAKKANNRFAAL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            ++  K+   E+ +ASG +E+  E+  LL D  
Sbjct  70   LDAHKKRNKEAEQASGVSEEVTEKVTLLDDLL  101

>PYIW_25568
Length=126

 Score = 45.8 bits (107),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  82   AWGKVASGIKAALP-LCTADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLT  140
             W  +AS ++     +    G A + RF  +M++F  ++L SLR SGT E+Y+ERE LL 
Sbjct  22   GWKTIASILRENQSFIADKGGPALKTRFEKIMKLFMSQDLASLRKSGTQEEYQERELLLG  81

Query  141  DC  142
            D 
Sbjct  82   DI  83

>H310_04215
Length=257

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCT-ADGKACRRRFYTLM  112
            F    D++L   V +  PW A  G+   +W  +A  +          DG AC+ RF  ++
Sbjct  24   FCARDDILLCLAVKEIKPWEAPSGEIMMSWAHIAEKLLHTRGFALRKDGPACKTRFEKIL  83

Query  113  EVFKREELESLRASGTTEDYEEREQLL  139
            ++    E + LR SG  E++ ERE+L+
Sbjct  84   KMITGGESDVLRKSGNDEEFAERERLV  110

>SDRG_15499
Length=278

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKR  117
            DV+LL+++    P+A  HG+   AW KVA+ + +        D K  + RF  L+E  K 
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMSCEEFTREVDAKKIQNRFSALLEAHKA  96

Query  118  EELESLRASGTTEDYEEREQLLTDC  142
                S   SG  ED  E+  LL D 
Sbjct  97   FNKGSAAKSGVDEDETEKIMLLDDL  121

>H257_03208
Length=105

 Score = 44.7 bits (104),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (2%)

Query  83   WGKVASGIKAALPL-CTADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
            W  +A G++       T DG AC+ RF  L++    + L ++R SGT E++ ER+QLL D
Sbjct  4    WADLAKGLRDNRRFRLTKDGPACKSRFEKLIKAHSGDSLAAMRRSGTGEEFGERDQLLED  63

>SDRG_17266
Length=278

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKR  117
            DV+LL+++    P+A  HG+   AW KVA+ + +        D K  + RF  L+E  K 
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMSCEEFTREVDAKKIQNRFSALLEAHKA  96

Query  118  EELESLRASGTTEDYEEREQLLTDC  142
                S   SG  ED  E+  LL D 
Sbjct  97   FNKGSAAKSGVDEDETEKIMLLDDL  121

>H310_11831
Length=490

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 56/118 (47%), Gaps = 2/118 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKR  117
            D++ L +     P+A G G+   AW  +A  +  +       DGK  + RF  L++  +R
Sbjct  15   DMMRLVQAAADQPFATGKGQVSKAWQALAETLMTSDAFTRVVDGKKVQYRFGLLIDEHRR  74

Query  118  EELESLRASGTTEDYEEREQLLTDCF-ELQTISQLRHGVSYATFNQKEKAVKYGCIAR  174
             ++ S + SG  E+  E+  +L D    L+ +  L    S  T  +K+KA + G + R
Sbjct  75   FDVASAKLSGVDEEDSEKHMILDDLLARLEEVRLLAASRSTKTSQEKDKAEQGGLVVR  132

>PHYSO_295819
Length=193

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 46/91 (51%), Gaps = 1/91 (1%)

Query  52   FRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTL  111
            F F   +D+ L KE++   P+AA HG  +  + +VA  +   L +   D +  + R   L
Sbjct  87   FFFTQEADLALFKEMLSLEPYAAEHGFKKQRYQQVADNLSEHLKVKLLD-RTVKDRLELL  145

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            +  FK ++    + SG +E Y E ++LL D 
Sbjct  146  LAEFKLDDQSYRKKSGGSEQYTEHKRLLQDI  176

>PPTG_06633
Length=292

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query  52   FRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTL  111
            FRF   +D  L++E I   P+AA +G +   W  VA  + AA+ +   + K  R R   L
Sbjct  3    FRFTNENDKELMREAIAQKPFAAKYGDSARVWATVAERMSAAIQIVVLE-KQVRDRVRLL  61

Query  112  MEVFKREELESLRASGTTEDYE  133
             ++++  EL S   SG  E  E
Sbjct  62   KKIWRAGELRSALGSGIEETLE  83

>H257_15530
Length=237

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 57/126 (45%), Gaps = 9/126 (7%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYTLMEVFK  116
            D++LL+++    P+ A HG+   AW  VA  + A +       DGK  + RF  L+   +
Sbjct  15   DLMLLRQISDDKPFLARHGRIMEAWESVARALAAQVDFDRPHFDGKKAQSRFAILLRDHR  74

Query  117  REELESLRASG--TTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKAVKYGCIAR  174
                  +RA    T ED  E+  LL D   L+  S L      A+ NQ ++A +   + R
Sbjct  75   DNNNAPMRAVSACTGEDSAEKMDLLEDISRLERSSTL-----AASGNQVDEAKEANDVPR  129

Query  175  FSRGPR  180
             +   R
Sbjct  130  STTDDR  135

>H310_13824
Length=169

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 6/55 (11%)

Query  91   KAALPLCTADGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            K  L +C      CRRRF  L+  FK+  L++L +SGT E+Y E +QLL D  +L
Sbjct  3    KQLLAIC------CRRRFDDLLAAFKKATLKALHSSGTEEEYNELDQLLQDIVDL  51

>PHYRA_75877
Length=406

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 52/97 (54%), Gaps = 5/97 (5%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYT  110
            +F+ + D++LL +V++  PWA  H      W +V+  ++A     L    G AC+ R   
Sbjct  188  QFVSADDILLLTQVLQTKPWAFQH--VMDGWQQVSDQLRAHDEFRLEKTAG-ACQARVVL  244

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCFELQT  147
            L++  +     +LR +GT+++YE + +LL +    QT
Sbjct  245  LLDHLRAGNAAALRKAGTSDEYERKRELLVEVQAKQT  281

>H310_15068
Length=108

 Score = 44.3 bits (103),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 2/94 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKACRRRFYTL  111
            F    D++LL++V    P+ A  G     W + A  +         D   K    RF  L
Sbjct  10   FTDEEDLLLLRQVSADMPFLARRGFVMDKWAQTAQALAGCEEFGRPDFDAKKANNRFNAL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +E  ++   ES RASG +E+  E+  LL  C  L
Sbjct  70   IEAHRKSNQESSRASGISEEVTEKVMLLNCCRPL  103

>PHYCA_14089
Length=199

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 48/100 (48%), Gaps = 5/100 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            KKRK   RF    D  LLKEV+   P+    G   AAW  VAS +         D + CR
Sbjct  8    KKRKTQVRFDEDDDDALLKEVLAANPFEVERGGKTAAWAAVASALA-----LDVDARRCR  62

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
             R   L+  FK +   S  ASG  E++ ER+ LL D  EL
Sbjct  63   ERCSLLLTDFKAKMARSEAASGIDEEHTERDDLLADVLEL  102

>PYAP_17700
Length=284

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---KAC  104
            R +  +F    DV+LL+ +  H P+ A HG     W ++A+ +  AL L   +      C
Sbjct  53   RGRYAKFTAGMDVLLLEAMRTHNPFTAKHGTRLQMWQQIAATVGEAL-LKNPEAFSWHTC  111

Query  105  RRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
            R R  TLM++F   + + L   GT E+   +E +L
Sbjct  112  RDRVTTLMKLFADGKHDKLFKHGTVEENTRKEAIL  146

>PHYCA_503833
Length=313

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPL-CTADGKACRRRFYTL  111
            +F+ + D++LL +V+   PWA  + +    W +V   ++            AC+ R   L
Sbjct  131  QFVSADDILLLTQVLITKPWA--YPQLMDGWQEVCEQLREHNDFNLEKTAGACQARMLLL  188

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCFELQT  147
            ++ F    + +LR SGT+E+YE + +LL +    QT
Sbjct  189  LDHFHAGNVAALRKSGTSEEYERKRELLIEVHAKQT  224

>H257_17235
Length=186

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            +V LL+EV +  P+AA HG     W  V SG+    P     G   R     +++ FK+E
Sbjct  20   EVELLREVSRIEPFAADHGDLLQRWKLVESGLSDHEPKLNYRG--AREHVDAMLKEFKQE  77

Query  119  ELESLRASGTTEDYEEREQLLTDCF  143
            +      SGT ED  E+ QLL D  
Sbjct  78   DKVQQLLSGTDEDVTEKVQLLQDLV  102

>H310_04318
Length=179

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CRRRF  L+  FK+  L++LR+SGT E+Y +R+QLL    +L
Sbjct  14   CRRRFDDLLAAFKQATLKALRSSGTEEEYNKRDQLLQGIVDL  55

>PYIW_26363
Length=144

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query  45   QKKRKKAFRFLPSSDVI-LLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADG  101
            ++  K     LP+     L +EV    P+ AG+     AW  VA+ +K    L + +   
Sbjct  5    ERPHKPPSALLPTKTCFSLAREVNAKLPYRAGYNGVMNAWTAVAAALKIIPDLGMASVTA  64

Query  102  KACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTD  141
            K+C  RF  L+E+ +    ES RAS  +E+  E   +L D
Sbjct  65   KSCHSRFKALIELHRCSNRESARASDVSEEITELACVLGD  104

>PPTG_04601
Length=260

 Score = 45.4 bits (106),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (49%), Gaps = 1/80 (1%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYT  110
             FRF    D+ +L+E+I+  P+AA  G T   W  VA+ + +AL       K  R R   
Sbjct  2    VFRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALK-KEIKVKQIRDRLNL  60

Query  111  LMEVFKREELESLRASGTTE  130
            L   FK +E  S  ASG  E
Sbjct  61   LKTRFKEKEQLSALASGVEE  80

>PPTG_11283
Length=260

 Score = 45.4 bits (106),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query  52   FRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTL  111
            FRF    D+ +L+E+I+  P+AA  G T   W  VA+ + +AL       K  R R   L
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALK-KEIKVKQIRDRLNLL  61

Query  112  MEVFKREELESLRASGTTE  130
               FK +E  S  ASG  E
Sbjct  62   KTRFKEKEQLSALASGVEE  80

>PPTG_00272
Length=436

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 52/92 (57%), Gaps = 5/92 (5%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYT  110
            +F+ + D++LL +V++  PWA  + +    W +V   ++  +   L    G AC+ R   
Sbjct  219  QFVSADDILLLSQVLETKPWA--YPQLMDGWQEVCDQLRQHSDFNLDKTAG-ACQARVVL  275

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            L++  +   + +LR SGT+++YE + +LLT+ 
Sbjct  276  LLDHLRAGNVAALRKSGTSQEYERKRELLTEV  307

>PPTG_04118
Length=274

 Score = 45.4 bits (106),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 40/76 (53%), Gaps = 7/76 (9%)

Query  71   PWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRR----RFYTLMEVFKREELESLRAS  126
            P+A GHGK  A +  +A  +   L L   D K  +R    RF  L++ FK+ +    + +
Sbjct  6    PFAGGHGKIGARYQLMADNLSVHLKL---DPKLSKRTVQERFTLLLDEFKQNDQAYRKKT  62

Query  127  GTTEDYEEREQLLTDC  142
            G  E+YEE +QLL D 
Sbjct  63   GVAENYEEHKQLLQDL  78

>SPRG_00310
Length=254

 Score = 45.1 bits (105),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  F+++ ++++RASGT E+  ER+ LL D  +L
Sbjct  14   CRKRFDDLMAAFEKDAVKAMRASGTEEEVSERDMLLQDISDL  55

>PYAP_22661
Length=218

 Score = 44.7 bits (104),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query  71   PWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKREELESLRASGTT  129
            PWA    K   AW +VAS + A        D ++CR RF  L++ FK     +LR + T 
Sbjct  28   PWA--QAKIMDAWSRVASALGADDAFNGERDARSCRSRFLLLVKHFKESNHTALRRTATD  85

Query  130  EDYEEREQLL  139
            +++E++ QLL
Sbjct  86   DEFEDKMQLL  95

>PHYSO_259775
Length=213

 Score = 44.7 bits (104),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 43/83 (52%), Gaps = 5/83 (6%)

Query  69   HTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREELESLRASGT  128
              P+   +GK   AW  VA+ ++  +     DG+ CR R   L++ ++ ++  S + SG 
Sbjct  29   RNPYGEDYGKKTPAWADVAADLEVDV-----DGRRCRERCNQLVDAYEAKQKASEKRSGP  83

Query  129  TEDYEEREQLLTDCFELQTISQL  151
             E+Y  +++ L +  EL+ I  L
Sbjct  84   CEEYTPKDECLVELLELREIEAL  106

>PPTG_03797
Length=210

 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 1/80 (1%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYT  110
             FRF    D  L+ EVIK  P+AA +G+T   W +VA+ + A++ +   D K  + R   
Sbjct  2    VFRFSEDMDKELMCEVIKQRPFAAKYGETGTVWVQVATRVSASIKVVVID-KQVQDRVRL  60

Query  111  LMEVFKREELESLRASGTTE  130
            L + ++  EL +   SG  E
Sbjct  61   LKKNWRAGELRATLGSGIEE  80

>PHYCA_38983
Length=217

 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (46%), Gaps = 10/90 (11%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLME  113
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNEMAGFVRD----------KQGPALRTRFDKLIR  86

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCF  143
              +  ++ S R+SGTTE+Y ER++LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIV  116

>PHYSO_448112
Length=115

 Score = 43.1 bits (100),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 10/116 (9%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLM  112
            RF  +SD  LL EV+   P+AA        W  VA+ + A L    +  +ACR R   L+
Sbjct  3    RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFS-FRACRDRTSLLL  61

Query  113  EVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKAVK  168
              +   +  +  ASGT+E + E + +      L+ + QL++    A   Q+EK  K
Sbjct  62   RKYAVRKARNEAASGTSEVHTENDDI------LEQLQQLKNA---AVAEQQEKKTK  108

>PHYCA_4828
Length=295

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (46%), Gaps = 10/90 (11%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLME  113
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNEMAGFVRD----------KQGPALRTRFDKLIR  86

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCF  143
              +  ++ S R+SGTTE+Y ER++LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIV  116

>PHYSO_377140
Length=105

 Score = 42.4 bits (98),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLM  112
            RF  +SD  LL EV+   P+AA        W  VA+ + A L    +  +ACR R   L+
Sbjct  3    RFNATSDKALLSEVLATLPFAADRKTVTGVWKGVANRLNATLSEAFS-FRACRDRTRLLL  61

Query  113  EVFKREELESLRASGTTEDYEEREQLLTDCFELQT  147
              +   +  +  ASGT+E + E + +L    +L+ 
Sbjct  62   RKYVVRKARNEAASGTSEVHTENDDILEQLQQLKN  96

>PHYCA_98971
Length=295

 Score = 44.3 bits (103),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (46%), Gaps = 10/90 (11%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLME  113
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNEMAGFVRD----------KQGPALRTRFDKLIR  86

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCF  143
              +  ++ S R+SGTTE+Y ER++LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDELLQDIV  116

>PHYSO_492787
Length=130

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 7/103 (7%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLM  112
            RF  +SD  LL EV+   P+AA        W  VA+ + A L    +  +ACR R   L+
Sbjct  3    RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFS-FRACRDRTSLLL  61

Query  113  EVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGV  155
              +   +  +  ASGT+E + E + +      L+ + QL++ V
Sbjct  62   RKYAVRKARNEAASGTSEVHTENDDI------LEQLQQLKNAV  98

>PYIW_25874
Length=201

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/87 (28%), Positives = 43/87 (49%), Gaps = 13/87 (15%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            ++ LL++++   P+  GHGK  AA  K++             GK  + RF  L+   + E
Sbjct  22   NLALLRQILSVRPFQNGHGKVMAARSKLS-------------GKNAQSRFSQLIHSRRSE  68

Query  119  ELESLRASGTTEDYEEREQLLTDCFEL  145
             +E +  SG +E   E +++L +  EL
Sbjct  69   NMEVMTLSGVSETVSESDEILDELIEL  95

>PYU1_G008728
Length=234

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG------KACRRR  107
            F   +DVILL  V +H P  AGHG    AW  +A    + L L +AD       K  R R
Sbjct  16   FRTENDVILLDLVRRHAPHTAGHGNVAGAWQSIAREYNSRLGL-SADAETAVAWKVLRNR  74

Query  108  FYTLMEVFKREELESLRASGTTEDY  132
               L++ F +  + S+R  G  + Y
Sbjct  75   TGLLLDKFAKGAMHSVRKLGRADMY  99

>H257_12998
Length=141

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 6/100 (6%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGK  102
            QK+R+    F    D++ L ++    P+ A  GK    W  VA  +           DGK
Sbjct  5    QKRRQ----FTERQDILFLTQIRVEMPFLARRGKIMDVWDSVARNLATVGGFDRPQFDGK  60

Query  103  ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
              + RF  L+   + +   S+RAS  +ED  E+  +L D 
Sbjct  61   KAQARFAILLRDHREDNRASMRASCVSEDVTEKAIMLDDI  100

>H310_14898
Length=140

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 0/64 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATF  160
             K CR+R   L   F+++ + SLRAS T E Y ER+QLL D  ++    Q +   +    
Sbjct  11   AKGCRKRCDDLHSAFQQDSVASLRASRTDEQYAERDQLLQDLADMIEAEQCKRRANKDDK  70

Query  161  NQKE  164
            ++KE
Sbjct  71   SKKE  74

>H257_14759
Length=198

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGI--KAALPLCTADGKACRRRFYTL  111
            +    D++LL++V    P+ A  G+    WG VA  +           D K  + RF  +
Sbjct  10   YTEQEDIMLLRQVNAERPFEAKKGEFMKVWGLVAKALADHEGFARPQFDAKKAQNRFSAV  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            M+       ES  ASG  E Y+ER  LL +  
Sbjct  70   MDNHVHYNRESAMASGVAETYDERIALLDELL  101

>PITG_19098
Length=295

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLME  113
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAEDICNETAGFVRD----------KQGPALRTRFDKLIR  86

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCF  143
              +  ++ S R+SGTTE+Y ER+ LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDVLLQDIV  116

>H257_14499
Length=170

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD---GKACRRRFYT  110
            F    D++LL++V     + A   +    W +VASG+  A      D    KAC   F  
Sbjct  10   FTEGEDIMLLRQVTLEMLFEARRDQVMERWAEVASGLNTADEFRRTDIDAKKACNH-FIL  68

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L++  ++   +S +ASG  ED  E+  LL D  
Sbjct  69   LLDAHRKANNQSQQASGVAEDVGEKVVLLDDLL  101

>H310_11875
Length=172

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 36/73 (49%), Gaps = 0/73 (0%)

Query  100  DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYAT  159
            DGK  + RF  L+   K   LES RASG +ED  E+ +LL D   L   + ++  +S   
Sbjct  17   DGKRAQNRFLLLVRQHKASNLESARASGVSEDETEKSKLLDDLVPLYNDTLVKKKLSAQP  76

Query  160  FNQKEKAVKYGCI  172
               +EKA     I
Sbjct  77   TEAEEKAANIKFI  89

>PYVX_23885
Length=326

 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 55/137 (40%), Gaps = 9/137 (7%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYT  110
            RF    D +L  +V    P+ A HG    AW +VA  +   +   + T  G   + RF T
Sbjct  58   RFGDEEDYLLAVQVNADLPFTAKHGSLGKAWDEVAKKLNECSKFMMRTIKGTTAKARFET  117

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKEKA----  166
            L+E  +  E+ S   SGT E+  E   L+T+   L               N  E+A    
Sbjct  118  LIENHRAWEMTSKAKSGTQEEESEYIVLMTELVNLVDDHSDAKKSQVEENNDDERAKTAS  177

Query  167  ---VKYGCIARFSRGPR  180
               V+   ++R  R  R
Sbjct  178  GEVVRSAAVSRLKRNKR  194

>H310_04474
Length=210

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 39/90 (43%), Gaps = 0/90 (0%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLME  113
            F    DV+LL +     P+ A  G+    W  VA  +         DG+  + RF  L+ 
Sbjct  10   FSEREDVLLLTQFSAEMPFLARRGQIMDVWDSVARNLATLFDRPQFDGEKAQGRFLILLR  69

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCF  143
              +  +  S RASG  E+  E+  LL D +
Sbjct  70   DNRDNKNASRRASGAPENVTEKTILLDDLY  99

>H310_04226
Length=236

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 42/103 (41%), Gaps = 3/103 (3%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYTL  111
            F    DV+LL +V    P+ A  GK    W  VA  +           DGK  + RF  L
Sbjct  10   FTEREDVLLLTQVSVEMPFLAHRGKIMDVWESVARNLATIGEFDRPNFDGKKAQARFLIL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTD-CFELQTISQLRH  153
            +   +     S RASG  E   E+  LL D C ++    Q  H
Sbjct  70   LRDHRDSNNASQRASGAAEHVTEKTVLLDDLCNQVDEAKQEEH  112

>H257_07871
Length=201

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 7/93 (8%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYT  110
            +F    D+ LLK+V    PW   +GK    W ++A+ +       +    G + + RF  
Sbjct  17   KFACCHDITLLKQVSLSRPWEGEYGKVMTIWAEIAAELNRMPGFSMVKKPG-SLKTRFEY  75

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            L+   ++ E  SLR SGTTE++    QL  D F
Sbjct  76   LLAKHEKGESASLRKSGTTEEH----QLRVDDF  104

>HYAP_00630
Length=432

 Score = 43.1 bits (100),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 5/90 (6%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYT  110
            +F+ + D++LL +V    PWA  H      W  V S ++  +   L    G AC+ R   
Sbjct  215  QFVSADDILLLTQVKVTKPWAYPH--LMDGWQAVCSELRKHSNFNLEKTAG-ACQARVAL  271

Query  111  LMEVFKREELESLRASGTTEDYEEREQLLT  140
            L++  +   + +LR SGT E+YE++ +LL 
Sbjct  272  LLDHLRAGNVAALRKSGTLEEYEQKRELLV  301

>PITG_12686
Length=223

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLME  113
            F  + D+ILL+ V    PW +         G V              G A R RF  L+ 
Sbjct  37   FTTADDLILLRAVNTIKPWESAKDICNETAGFVRD----------KQGPALRTRFDKLIR  86

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCF  143
              +  ++ S R+SGTTE+Y ER+ LL D  
Sbjct  87   QHRDAQVVSRRSSGTTEEYNERDVLLQDIV  116

>H257_08837
Length=225

 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKACRRRFYTL  111
            F    D++LL++V    P+ A  G     W  +A  + A       D   K    RF  L
Sbjct  10   FTEEEDIMLLRQVSADMPFLARRGLIMDNWTAIAETLAANEDFGRPDFDAKKANNRFIAL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
             E  ++    S RASG +ED  E+  LL D  
Sbjct  70   AEAHRKIHRVSARASGISEDVGEKVALLDDIL  101

>PYIW_15637
Length=272

 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTLMEVFK  116
            D++LL +V    P+++  G    +W +V +      A  L   DGK  + RF+ LME  +
Sbjct  37   DIMLLCQVSADMPFSSRRGSAIDSWEEVVAKFSTLDAFALPQFDGKKAQNRFFALMEEHR  96

Query  117  REELESLRASGTTEDYEEREQLLTDCF  143
            +    S   SG +  Y E+ ++L D  
Sbjct  97   KYNTASATKSGVSGFYNEKHEVLDDLL  123

>H257_07755
Length=181

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 44/85 (52%), Gaps = 5/85 (6%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKRE  118
            +V LL+EV +  P+AA + +    W  VASG      +   + ++ R     +++ FK++
Sbjct  21   EVALLREVTRIKPFAADNSELLQRWKLVASG-----QVPKINYRSAREHVDVMLKDFKKD  75

Query  119  ELESLRASGTTEDYEEREQLLTDCF  143
            +    R+SGT E   ER QLL D  
Sbjct  76   DDAQKRSSGTEEYVTERVQLLQDLV  100

>H310_15161
Length=236

 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (48%), Gaps = 9/92 (10%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-----TADGKACRRRFYTLME  113
            D+ LL +V    P+AA  G+ + AW     G+   L  C       DGK  + RF  L E
Sbjct  19   DIALLIQVAADRPFAAEKGQLKKAW----QGLAETLVACEHFGRVVDGKKVQNRFLFLAE  74

Query  114  VFKREELESLRASGTTEDYEEREQLLTDCFEL  145
              ++ + +S + SG  E+ +E+  LL D   +
Sbjct  75   EHRKFDAQSAKLSGVAEEEKEKHVLLDDILNV  106

>PPTG_06289
Length=240

 Score = 42.4 bits (98),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 0/43 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            G A R RF TL+  FKR++ +S+R S T E + ER++LL D  
Sbjct  23   GAALRTRFATLLREFKRDQCQSMRMSETVEQFRERDRLLLDII  65

>PITG_05827
Length=364

 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 52/97 (54%), Gaps = 5/97 (5%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACR  105
            R +  +F+ + D++LL +V++  PWA  + +    W +V   ++  +   L    G AC+
Sbjct  142  RSQRTQFVSADDILLLSQVLETKPWA--YPQIMDGWQEVCRQLRQHSNFNLDKTAG-ACQ  198

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
             R   L++  +     +LR SGT+++YE + +LL + 
Sbjct  199  ARVVLLLDHLRAGNSIALRKSGTSQEYERKRELLAEV  235

>PHYCA_124712
Length=202

 Score = 42.0 bits (97),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 0/43 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            G A R RF  L+  FK ++ +S+R SGT E+Y ERE LL D  
Sbjct  23   GTAMRTRFTNLVSQFKTDQCQSMRKSGTVEEYAEREVLLQDIV  65

>PITG_05131
Length=200

 Score = 42.0 bits (97),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            G A R RF  L+  +K ++ +S+R SGTTE+Y ERE LL +   L
Sbjct  23   GTAMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREVLLQNIVTL  67

>SDRG_17294
Length=68

 Score = 39.7 bits (91),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  49  KKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA  92
           KKAFRF  +SDV LLKEV+  +P+   +G+    W +VA  ++ 
Sbjct  10  KKAFRFTVASDVDLLKEVMFVSPYDCQYGQVAKRWEEVAEHMRV  53

>PPTG_15787
Length=126

 Score = 40.8 bits (94),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 46/105 (44%), Gaps = 10/105 (10%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYT  110
             FRF    D  LL+E+I   P+AA  G T   W  +A+ + +A  +     + C  R   
Sbjct  2    VFRFTNDWDKELLRELIHLKPFAAVRGTTLRVWSDIAASLSSAFGVEVNVKQVC-DRLTL  60

Query  111  LMEVFKREEL---------ESLRASGTTEDYEEREQLLTDCFELQ  146
            L ++ K  E          ES+ A      Y+ERE L+ +   L+
Sbjct  61   LKQMLKDSEAAAALGSGIEESVDAVNVQSHYDEREGLVREFVALE  105

>PPTG_08500
Length=285

 Score = 42.0 bits (97),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query  52   FRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTL  111
            FRF    D  L++E IK  P+ A +G+  A W +VA  + AA+ +   D K  + R   L
Sbjct  3    FRFSEDIDKELMREAIKQKPYTAKYGEAAAVWVQVAKCVSAAVKVSLVD-KQVQDRVRLL  61

Query  112  MEVFKREELESLRASGTTE  130
             + +   EL +   SG  E
Sbjct  62   KKNWSAGELRAALGSGIEE  80

>SDRG_04653
Length=243

 Score = 42.0 bits (97),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 11/70 (16%)

Query  49   KKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGK-----A  103
            KK F+F    D+ LL+ V+KH P+ A HG     W ++ +       LC   GK     A
Sbjct  13   KKRFKFNYEEDMELLRLVLKHEPYNAVHGSVAEKWEQIRTT------LCAYVGKQFSARA  66

Query  104  CRRRFYTLME  113
            C+ R+  LM+
Sbjct  67   CKDRYGILMQ  76

>PHALS_06409
Length=227

 Score = 41.6 bits (96),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 56/119 (47%), Gaps = 9/119 (8%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG----KACRRRF  108
            +F  S DV+LL+ +  + P+ A HG     W  +A  +   L +           CR R 
Sbjct  22   KFNGSMDVVLLQALQLNNPFTAKHGTRLQMWQHIAEAV--GLQIFNNPNAFSWHTCRDRV  79

Query  109  YTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVS-YATFNQKEKA  166
              LM+++   + + L   GT E+  ++E +L +  E  T+ +  H ++  A  N KEKA
Sbjct  80   TALMKMYTDGKHDKLFKHGTMEENAQKESILREINE--TLLRKNHKMAGQADGNGKEKA  136

>H310_14075
Length=217

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (45%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR--RRFYTL  111
            F    D++LL++V    P+ A  G+    W  VAS +  +      D  A R   RF  L
Sbjct  10   FTEQEDIMLLRQVSLEMPFQARRGQVMERWADVASALLGSGEFTRDDIDAKRACNRFMLL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            ++   R   ES  ASG +++  E+   L D  
Sbjct  70   LDGHHRINKESQCASGVSDEVGEKTNFLDDLM  101

>H310_15160
Length=200

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 38/91 (42%), Gaps = 2/91 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYTL  111
            F    D++LL +V    P  A  G+    W  VA  +           DGK  + RF  L
Sbjct  10   FNEREDILLLTQVSVERPHIARRGRIMDVWDSVARNLNTLDEFNRRHFDGKRAQARFNLL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            +   K   + S R SG+ E  +ER  LL D 
Sbjct  70   LRDHKERNVASNRPSGSDEVVDERVVLLDDL  100

>H257_01534
Length=176

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 54/126 (43%), Gaps = 5/126 (4%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYTLMEVFK  116
            D ILL ++    P+    G T  AW  +A+ +K          DGK  + RF  L+   K
Sbjct  22   DKILLTQINNTRPFLQRKG-TRKAWDTMAATLKDVDGFTRPGIDGKKAQNRFLRLVRRHK  80

Query  117  REELESLRASGTTEDYEEREQLLTDCFEL--QTISQLRHGVSYATFNQKEKAVKYGCIAR  174
                E+ R SG TED   + +LL D   L     ++ R     +  ++K  ++K+     
Sbjct  81   SNNNEAARLSGATEDETPKSRLLDDLVPLYNDAATKKRAATPLSEADEKAASIKFIREQA  140

Query  175  FSRGPR  180
              RG R
Sbjct  141  MLRGKR  146

>PYAR_20449
Length=231

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (51%), Gaps = 7/89 (8%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC---TADGKACRRRFYT  110
            F    DV+LL+     TPW A   +   AW  +A  +    P C     D +A R RF+ 
Sbjct  7    FSCGDDVLLLRAASAATPWQAA--RVMDAWDALAQRL-GGYP-CFPRDKDARAVRTRFHL  62

Query  111  LMEVFKREELESLRASGTTEDYEEREQLL  139
            L++  +  +L S+R +G +++   RE+LL
Sbjct  63   LLKKHRANKLASMRTTGDSDELLHRERLL  91

>H257_18543
Length=323

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 0/44 (0%)

Query  100  DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            DG+ C  RF  L + +K   L S+R SGT E+++E EQLL D  
Sbjct  68   DGQGCTTRFDKLAKAYKERSLVSIRRSGTDEEFKECEQLLEDIL  111

>H257_01994
Length=222

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 48/91 (53%), Gaps = 2/91 (2%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFK-R  117
            D+ LL+EV++  P+   +G     W  +AS + +    CT   ++ R  F  ++E FK  
Sbjct  16   DLALLREVLRVEPYDGEYGTLTVRWKTIASKLSSCFE-CTIPYRSARDHFEVMLEGFKVT  74

Query  118  EELESLRASGTTEDYEEREQLLTDCFELQTI  148
            ++ + +  +G+ E+  E+ Q+L D  + + +
Sbjct  75   DKAQRMFGTGSEEEVTEQVQILQDIVDRRAV  105

>H257_05356
Length=224

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 38/92 (41%), Gaps = 2/92 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTAD--GKACRRRFYTL  111
            F    ++ LL++V    P+ A  G     W  +A  + A     + D   K    RF  L
Sbjct  10   FTEEEEITLLRQVSADMPFLARRGLIMDKWVAIAETLAANEDFGSPDFDAKKANNRFIAL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCF  143
             E  ++    S RASG +ED  E   LL D  
Sbjct  70   AEAHRKSNRVSARASGISEDVGENVALLDDIL  101

>H257_13212
Length=153

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYTL  111
            +    DV+LL++V    P+ A  G     W  VA  + A+        D K    RF  L
Sbjct  10   YTDKEDVMLLRQVSLELPFLARRGIIMEKWTAVARALVASDEFTRTDLDAKKANNRFNLL  69

Query  112  MEVFKREELESLRASGTTEDYEER  135
            ++  ++   +S RASG +E+  E+
Sbjct  70   IDSHRKHNKDSERASGVSEEVSEK  93

>HYAP_06778
Length=224

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVAS--GIKAALPLCTADGKACR  105
            R +  +F  S DV+LL+ + ++ P+ A HG     W  VA   G++            CR
Sbjct  8    RGRYAKFNGSMDVLLLEALQENNPFTAKHGTRLQMWQNVAETVGLQGFKNPAAFSWHTCR  67

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
             R   LM+++   + + L   GT E+   +E +L + 
Sbjct  68   DRVTALMKMYTDGKHDKLFKHGTMEENSRKESILREI  104

>SPRG_18045
Length=215

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            CR+RF  LM  FK + +  LRASGT E+  ER  LL +  +L
Sbjct  14   CRKRFDDLMAAFKTDNVNGLRASGTEEEMRERYVLLEEMSDL  55

>H310_11868
Length=117

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 37/91 (41%), Gaps = 2/91 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYTL  111
            F    DV+LL +V    P+ A  GK    W  VA  +           DGK  + RF  L
Sbjct  10   FTEREDVLLLTQVSAEMPFLARRGKIMDVWDSVARNLATIGEFDRPQFDGKKAQARFLIL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            +   +     S  ASG  E+  E+  LL + 
Sbjct  70   LRDHRDNSNASRHASGAAENVTEKTILLDNL  100

>PPTG_16964
Length=104

 Score = 38.9 bits (89),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAA-GHGKTEAAWGKVASGIKAALPLCTADGKACRRRFY  109
             FRF    D+ +L E+I+  P+AA   G T   W  V + + +AL     + K  R RF 
Sbjct  2    VFRFTTMEDLEMLWELIRQKPFAAKKRGSTLEMWDSVVAALGSALK-KEINVKQIRDRFN  60

Query  110  TLMEVFKREELESLRASGTTE  130
             L   FK +E  S  ASG  E
Sbjct  61   LLKARFKEKEQLSALASGVEE  81

>PPTG_06723
Length=149

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (57%), Gaps = 1/69 (1%)

Query  62   LLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREELE  121
            L++EVIK  P+AA +G+T   W +VA+ + A++ +   D K  + R   L + ++  EL 
Sbjct  5    LMREVIKQRPFAAKYGETGTVWVQVATCVSASIKVVEID-KQVQDRVRLLKKNWRAGELR  63

Query  122  SLRASGTTE  130
            +   SG  E
Sbjct  64   ATLGSGIEE  72

>PHYRA_75881
Length=391

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTL  111
            F+ S D++LL  V+   PW A +      W  V   ++A  +  L    G AC+ R + L
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAG-ACQARLHLL  275

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            +   K   L +LR +GT +++E +  LL + 
Sbjct  276  LSHLKAANLTALRKAGTEDEFERKCALLREV  306

>PHYRA_86856
Length=391

 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTL  111
            F+ S D++LL  V+   PW A +      W  V   ++A  +  L    G AC+ R + L
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAG-ACQARLHLL  275

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            +   K   L +LR +GT +++E +  LL + 
Sbjct  276  LSHLKAANLTALRKAGTEDEFERKCALLREV  306

>H310_13843
Length=118

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (52%), Gaps = 6/52 (12%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152
            G+ CR        V  R  + SLRASGT E+Y E EQLL D  +L   S  R
Sbjct  2    GRGCRE------HVHDRNTISSLRASGTEEEYSEHEQLLQDIVDLIDQSHSR  47

>H257_07182
Length=209

 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 2/72 (3%)

Query  74   AGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTLMEVFKREELESLRASGTTED  131
            A  G+    W  VA  +++         DGK  + RF  L+E  + ++ E  RASGT E 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  132  YEEREQLLTDCF  143
            Y E+ QLL D  
Sbjct  62   YGEKFQLLDDLL  73

>H257_16845
Length=209

 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 2/72 (3%)

Query  74   AGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTLMEVFKREELESLRASGTTED  131
            A  G+    W  VA  +++         DGK  + RF  L+E  + ++ E  RASGT E 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  132  YEEREQLLTDCF  143
            Y E+ QLL D  
Sbjct  62   YGEKFQLLDDLL  73

>PITG_08385
Length=204

 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQ  137
            G A R RF  L+  +K ++ +S+R SGTTE+Y EREQ
Sbjct  23   GTAMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREQ  59

>H257_09254
Length=141

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 51/103 (50%), Gaps = 8/103 (8%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---K  102
            K  +   ++    D+ LL+EV++  P+   HG     W +VA    A+L L +  G   +
Sbjct  3    KPNQAQLKWTDDLDLALLREVLRVEPYDCEHGTLIQRWKEVA----ASLSLYSNQGIPHR  58

Query  103  ACRRRFYTLMEVFK-REELESLRASGTTEDYEEREQLLTDCFE  144
            + R  +  L++ FK  ++ +    +G+ ED  E+ QLL D  +
Sbjct  59   SARDHYEGLIQAFKATDKSQRQWGTGSDEDVPEKVQLLQDLVD  101

>PYAR_24700
Length=154

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (6%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIK--AALPLCTADGKACRRRFYTL  111
            F  + D+ LL+E   H PWA        AW  +A  ++  A+ P    DGKA   RF  L
Sbjct  9    FTCADDINLLREASFHRPWA--QPWLMRAWETLAQRLRTYASFP-QDKDGKALSTRFNLL  65

Query  112  MEVFKREELESLRASGTTEDYEEREQLL  139
            ++ ++   + S+R SG  E++ EREQLL
Sbjct  66   VKKYRENAVHSMRKSGREEEFFEREQLL  93

>PYIW_15058
Length=131

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 7/54 (13%)

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLL-------TDCFELQTISQLRH  153
            RF  ++++F  ++L SLR SGT E+Y+ERE LL       TD  EL  + + R 
Sbjct  2    RFEKIVKLFVSQDLASLRKSGTQEEYQERELLLENIRQRTTDFAELADVQRARE  55

>PHYSO_474101
Length=166

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 0/43 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            G A R R  TL+   KR++  S+R SGT E Y+ER++LL D  
Sbjct  23   GLALRTRSSTLVMNCKRDQCRSMRKSGTVEQYQERDRLLLDIL  65

>PHYCA_129230
Length=141

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 0/43 (0%)

Query  101  GKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            G A R RF  L+   +  ++ S R+SGTTE+Y ER++LL D  
Sbjct  27   GPALRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDELLQDIV  69

>PPTG_24854
Length=291

 Score = 40.0 bits (92),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 38/83 (46%), Gaps = 1/83 (1%)

Query  51   AFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYT  110
             FRF    D  L++E I   P+AA +G+   AW  VA  + +A+     + K  R R   
Sbjct  2    VFRFTEDHDKELMREAIAQKPFAAKYGEAARAWASVAEHVSSAIKERVLE-KQVRDRVRL  60

Query  111  LMEVFKREELESLRASGTTEDYE  133
            L + +   EL S   SG  E  E
Sbjct  61   LKKNWHAGELRSSLGSGIEETLE  83

>PPTG_19779
Length=319

 Score = 40.0 bits (92),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (51%), Gaps = 7/99 (7%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K ++  F+    + ++L+  V +   +AA HGK +  W  VA  + A +   +   +ACR
Sbjct  14   KNKRSRFQLCDLTKLMLI--VTRRKSFAAPHGKGDEEWQAVADELNA-VDTTSFSLRACR  70

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFE  144
             +   L++  K+E   S RASG  E++     +L+D  E
Sbjct  71   DKVAALIKKHKQESAASRRASGVAEEH----TMLSDLIE  105

>H257_18379
Length=155

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 8/90 (9%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---KACRRRFYTLMEVF  115
            D+ LL+EV++  P+   HG     W +VA    A+L L +  G   ++ R  +  L++ F
Sbjct  16   DLALLREVLRVKPYDGEHGTLIQRWKEVA----ASLSLYSNQGIPHRSARDHYEGLVQAF  71

Query  116  K-REELESLRASGTTEDYEEREQLLTDCFE  144
            K  ++ +    +G+ ED  E+ QLL D  +
Sbjct  72   KATDKSQRQWGTGSDEDVPEQVQLLQDLVD  101

>H257_10707
Length=213

 Score = 39.3 bits (90),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  100  DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCF  143
            DG+ C+ RF  L +  K     ++R SGT E++ E EQLL D  
Sbjct  158  DGQGCKTRFNKLAKANKERSFSAMRRSGTDEEFNECEQLLGDIL  201

>PHYSO_389268
Length=107

 Score = 38.1 bits (87),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 1/60 (2%)

Query  71   PWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKREELESLRASGTTE  130
            P+AA  G T + W +VA G+ +A+ +   + K  R R   L   FK +EL S RAS   E
Sbjct  2    PFAAKRGSTGSVWEEVAKGVSSAIKV-QLNAKQVRDRLNLLEAKFKADELCSSRASDVEE  60

>PPTG_22223
Length=37

 Score = 36.2 bits (82),  Expect = 0.005, Method: Composition-based stats.
 Identities = 15/18 (83%), Positives = 18/18 (100%), Gaps = 0/18 (0%)

Query  47  KRKKAFRFLPSSDVILLK  64
           KRKKAFRF+PSSD++LLK
Sbjct  20  KRKKAFRFVPSSDIMLLK  37

>PPTG_18296
Length=248

 Score = 39.3 bits (90),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 58/127 (46%), Gaps = 11/127 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG----KA  103
            R +  +F  + DV+LL+ +  + P+ A HG     W  VA  I   + +    G      
Sbjct  35   RGRYAKFNGTMDVMLLEALQVNNPFTAKHGTRLQMWQNVAESI--GMQVFKNPGAFSWHT  92

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATF---  160
            CR R   LM+++   + + L   GT E+   +E +L +  E  T+ +  H ++  T    
Sbjct  93   CRDRVTALMKMYTDGKHDKLFKHGTMEENARKETILREINE--TLLRKNHKMAGQTVGDG  150

Query  161  NQKEKAV  167
            N KE+ +
Sbjct  151  NGKERVI  157

>PHYRA_75884
Length=432

 Score = 39.7 bits (91),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTL  111
            F+ S D++LL  V+   PW A +      W  V   ++A  +  L    G AC+ R + L
Sbjct  219  FVASDDILLLTHVLAAKPWEAPYAMD--GWLHVVEQMRADASFRLEKTAG-ACQARLHLL  275

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDC  142
            +   K   L +LR +GT +++E +  LL + 
Sbjct  276  LGHLKAANLTALRKAGTEDEFERKCALLREV  306

>PHYSO_389597
Length=188

 Score = 39.3 bits (90),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 47/98 (48%), Gaps = 6/98 (6%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA------DGKACRRR  107
            F    D+ LL++ + + P+    GKT AAW  +A+ + +      +       GK  + R
Sbjct  6    FSAEEDLALLRQALSNRPFLKERGKTMAAWDALAAQLVSDANFSRSASRGKLSGKTAQAR  65

Query  108  FYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            F  L+   +++   +L ASG  E+  E++ LL +   L
Sbjct  66   FDKLVTQKRQQNAAALAASGVDEEETEKDVLLDELIAL  103

>H257_14546
Length=187

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query  82   AWGKVASGIKAALPLCTA--DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
            AW  VA  +           DGK    RF  LME  +     S RASG  ED++E+ QLL
Sbjct  3    AWNAVADAVSTNHDFARPGFDGKRALNRFTLLMEGHRANNDVSARASGIEEDHDEKTQLL  62

Query  140  TDCF  143
             +  
Sbjct  63   DELL  66

>H257_04751
Length=119

 Score = 38.1 bits (87),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 41/88 (47%), Gaps = 1/88 (1%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKR  117
            D +LL +     P+AA  G+   AW  +A+ + A        DG+  + RF  L+E  +R
Sbjct  15   DKVLLIQPATDKPFAAEKGQLTKAWQALANTLLACDHFTRVVDGRKVQNRFSALVEEHRR  74

Query  118  EELESLRASGTTEDYEEREQLLTDCFEL  145
                S + SG  E+  E+  LL D   L
Sbjct  75   FNKASAKLSGDDEEETEKHILLDDIVAL  102

>H257_11942
Length=232

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRRRFYTL  111
            +    D++LL++V    P+ A  G     W  VA  + A+        D K    RF  L
Sbjct  10   YTDEEDLMLLRQVSLELPFLARRGLIMDKWTAVARALVASDEFTRTDLDAKKANNRFNAL  69

Query  112  MEVFKREELESLRASGTTEDYEER  135
            ++  ++   +S RASG +E+  E+
Sbjct  70   IDSHRKHNKDSERASGVSEEVSEK  93

>H257_12985
Length=182

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 53/126 (42%), Gaps = 5/126 (4%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACRRRFYTLMEVFK  116
            D ILL ++    P+      T  AW  +A+ +K          DGK  + RF   +   K
Sbjct  22   DKILLTQINNTRPFLQ-RKDTRKAWDTMAATLKDVDGFTRPGIDGKKAKNRFLLFVRQHK  80

Query  117  REELESLRASGTTEDYEEREQLLTDCFEL--QTISQLRHGVSYATFNQKEKAVKYGCIAR  174
                E+ R SG TED   + +LL D   L     ++ R     +  ++K+ ++K+     
Sbjct  81   SNNNEAARLSGATEDETPKSRLLDDLVPLYNDAATKKRATTPLSEADEKDASIKFIREQA  140

Query  175  FSRGPR  180
              RG R
Sbjct  141  MLRGKR  146

>H310_10257
Length=309

 Score = 39.3 bits (90),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)

Query  122  SLRASGTTEDYEEREQLLTDCFEL  145
            SLRASGT E+YEEREQLL D  ++
Sbjct  3    SLRASGTDEEYEEREQLLQDIHDM  26

 Score = 33.1 bits (74),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query  67   IKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG---KACRRRFYTLMEVFKREELESL  123
            +K     A H   E A  K+   ++        DG    A R+RF  LM  F    + +L
Sbjct  113  VKADEAQAQHKSNELAQQKLE--LEEKRYRIVGDGITVNATRKRFDDLMTAFHEITMAAL  170

Query  124  RASGTTEDYEEREQLLTDCFEL  145
            RASGT E+YEEREQLL D  +L
Sbjct  171  RASGTEEEYEEREQLLQDIHDL  192

>CCA24051
Length=369

 Score = 39.3 bits (90),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 55/111 (50%), Gaps = 10/111 (9%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHG-KTEAAWGKVASG-IKAALPLCTADGKA  103
            K RK  F F    D+I+LKEV++H+     +G   +  W  ++   IK  +      G  
Sbjct  161  KARKPRFCFSEEHDLIVLKEVLQHSELFQPNGVHRQQIWQSISDNVIKQGV---NVSGYR  217

Query  104  CRRRFYTLMEVFKREELESLRASGTT----EDYEEREQLLTD-CFELQTIS  149
             R R   L+E+ ++E  ++L   G++    ED  E++QLL   C  L+ +S
Sbjct  218  VRLRLQRLVELHEQEINKTLSIIGSSGTCAEDTTEKKQLLQQYCDRLRAVS  268

>CCA23866
Length=369

 Score = 39.3 bits (90),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 55/111 (50%), Gaps = 10/111 (9%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHG-KTEAAWGKVASG-IKAALPLCTADGKA  103
            K RK  F F    D+I+LKEV++H+     +G   +  W  ++   IK  +      G  
Sbjct  161  KARKPRFCFSEEHDLIVLKEVLQHSELFQPNGVHRQQIWQSISDNVIKQGV---NVSGYR  217

Query  104  CRRRFYTLMEVFKREELESLRASGTT----EDYEEREQLLTD-CFELQTIS  149
             R R   L+E+ ++E  ++L   G++    ED  E++QLL   C  L+ +S
Sbjct  218  VRLRLQRLVELHEQEINKTLSIIGSSGTCAEDTTEKKQLLQQYCDRLRAVS  268

>H310_14301
Length=247

 Score = 38.9 bits (89),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 44/94 (47%), Gaps = 3/94 (3%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKA--ALPLCTADGKACRRRFYTL  111
            +L   DV+LL ++    P+       +A W  +A+ +++  +    T DG+  + RF  L
Sbjct  26   WLEDDDVMLLTQINNDRPFMQRKDAMKA-WEALAATLRSHPSFSRRTLDGRKAQNRFLLL  84

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +   K     S R SG +ED   + +LL D   L
Sbjct  85   IRQHKSSSNASARLSGVSEDESAKTRLLDDIMPL  118

>PPTG_15281
Length=148

 Score = 38.1 bits (87),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 5/106 (5%)

Query  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105
            K+R    RF    D  L++E     P+   +G+   A   VA+ +   +  C      CR
Sbjct  23   KRRNPMVRFTDELDFQLIEEAQARNPFGEDYGEKTQARADVAAAVAVVVDGCL-----CR  77

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQL  151
             R   L++ ++ ++  S R SG  EDY  +++ L +  E++ +  L
Sbjct  78   ERCNHLLDAYQAKKKASERRSGPCEDYTPKDECLAEVLEMRKMEML  123

>PPTG_15516
Length=493

 Score = 38.9 bits (89),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 58/127 (46%), Gaps = 11/127 (9%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADG----KA  103
            R +  +F  + DV+LL+ +  + P+ A HG     W  VA  I   + +    G      
Sbjct  280  RGRYAKFNGTMDVMLLEALQVNNPFTAKHGTRLQMWQNVAESI--GMQVFKNPGAFSWHT  337

Query  104  CRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATF---  160
            CR R   LM+++   + + L   GT E+   +E +L +  E  T+ +  H ++  T    
Sbjct  338  CRDRVTALMKMYTDGKHDKLFKHGTMEENARKETILREINE--TLLRKNHKMAGQTVGDG  395

Query  161  NQKEKAV  167
            N KE+ +
Sbjct  396  NGKERVI  402

>PITG_15738
Length=227

 Score = 38.5 bits (88),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 2/99 (2%)

Query  48   RKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTA--DGKACR  105
            R +  +F  + DV+LL+ +  + P+ A HG     W  VA  I   +    A      CR
Sbjct  35   RGRYAKFNGTMDVMLLEALQINNPFTAKHGTRLQMWQNVAEAIGMQVFKNPAAFSWHTCR  94

Query  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFE  144
             R   LM+++   + + L   GT E+   +E +L +  E
Sbjct  95   DRVTALMKMYTDGKHDKLFKHGTMEENARKETILREINE  133

>H310_06262
Length=226

 Score = 38.5 bits (88),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 39/96 (41%), Gaps = 2/96 (2%)

Query  49   KKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAA--LPLCTADGKACRR  106
            KK   F    DV+LL +V     + A  GK    W  VA  +           DGK  + 
Sbjct  6    KKRRVFTEREDVLLLTQVSVEMLFLARRGKIMDVWDSVARNLATIGEFDRPQFDGKKAQA  65

Query  107  RFYTLMEVFKREELESLRASGTTEDYEEREQLLTDC  142
            RF  L+   +     S RASG  E+  E+  LL D 
Sbjct  66   RFIILLRDHRDNNNASRRASGAAENVTEKTILLDDL  101

>H257_19201
Length=102

 Score = 37.0 bits (84),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query  60   VILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLMEVFKR-E  118
            + LL+EVI+  P+   +G   + W  +A+ +           ++ R  F  ++E FK  +
Sbjct  17   LTLLREVIRVEPYDGEYGTLTSRWKPIATNLSTCFE-APVPHRSARDHFEAMLEAFKSTD  75

Query  119  ELESLRASGTTEDYEEREQLLTDC  142
            + + L  +G+ E+  E+ QLL D 
Sbjct  76   KAQRLWGTGSEEEVTEQVQLLQDL  99

>H257_15302
Length=344

 Score = 38.5 bits (88),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  100  DGKACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLL  139
            D K  + RF  L+E  +  + ES+RASG  EDY E+ QLL
Sbjct  192  DAKRTQSRFTLLLEGHRVRDDESMRASGVAEDYSEKSQLL  231

>H257_00165
Length=434

 Score = 38.5 bits (88),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 42/106 (40%), Gaps = 2/106 (2%)

Query  45   QKKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAAL--PLCTADGK  102
            Q  R K  +F  + DV LL+ +  H P AA HG   A W +VA    A +         +
Sbjct  12   QPVRVKYIKFTSAMDVALLELIQVHNPIAAKHGTRLAMWERVARDFGAQIFDNRTACKWQ  71

Query  103  ACRRRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTI  148
             CR R   LM  F  E  + L    +      +E LL       T+
Sbjct  72   ICRDRGNLLMRWFDEERFDKLFKDESEARNRRKEALLQSLRHASTL  117

>PHYCA_504134
Length=205

 Score = 38.1 bits (87),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 47/103 (46%), Gaps = 4/103 (4%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVAS--GIKAALPLCTADGKACRRRFYTLMEVFK  116
            DV+LL+ +  + P+ A HG     W  VA   G++            CR R   LM+++ 
Sbjct  2    DVLLLEALQLNNPFTAKHGTRLQMWQNVAEAVGMQVFKNPSAFSWHTCRDRVTALMKMYT  61

Query  117  REELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYAT  159
              + + L   GT E+   +E +L +  E  T+ +  H ++  T
Sbjct  62   DGKHDKLFKHGTMEENARKESILREINE--TLVRKNHKMAVQT  102

>PHYSO_340790
Length=270

 Score = 38.1 bits (87),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 52/112 (46%), Gaps = 1/112 (1%)

Query  53   RFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACRRRFYTLM  112
            RF  +SD  LL EV+   P+AA        W  VA+ + A L    +  + CR R   L+
Sbjct  65   RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFS-FRECRDRTSLLL  123

Query  113  EVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLRHGVSYATFNQKE  164
              +   +  +  ASGT E + E + +L    +L+  ++ +   + +T   +E
Sbjct  124  RKYAVRKARNEAASGTCELHTESDDILEQLQQLKNAAEQQKNKAKSTSKTQE  175

>H257_06101
Length=360

 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 36/82 (44%), Gaps = 1/82 (1%)

Query  57   SSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCT-ADGKACRRRFYTLMEVF  115
            S D+ LL EV    PW +       AW ++A  +     L     G A R+R   L++  
Sbjct  24   SDDIALLNEVSFTRPWESRRSAARLAWEEIAKKLTTDASLSAFKSGPARRKRTEFLLKKH  83

Query  116  KREELESLRASGTTEDYEEREQ  137
               E  SLR SG+TED    + 
Sbjct  84   VANEHASLRKSGSTEDISSSDN  105

>H310_03462
Length=243

 Score = 38.1 bits (87),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query  59   DVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLC-TADGKACRRRFYTLMEVFKR  117
            DV LL +V    P+AA  G+   +W  +A  +  +       D +  + RF  L++   +
Sbjct  15   DVALLIQVAADQPFAATKGQLTKSWQLLAETLMQSDNFTRVVDSRKVQNRFSLLVDEHIK  74

Query  118  EELESLRASGTTEDYEEREQLLTDCFELQTISQLRHG  154
               ES + SG  E++ E+  LL D   L  +  L+ G
Sbjct  75   FNSESAKLSGVDEEHREKHILLDDMVTL--LEDLKRG  109

>PPTG_20418
Length=219

 Score = 37.7 bits (86),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 39/94 (41%), Gaps = 2/94 (2%)

Query  54   FLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASG--IKAALPLCTADGKACRRRFYTL  111
            F    D+  L+++    P+    G   AAW  +A+   +    P     GK    RF  L
Sbjct  10   FTDDEDLAQLRQIHADRPFLRQRGGIMAAWDALATKLVVDENFPRNKVSGKTASGRFDKL  69

Query  112  MEVFKREELESLRASGTTEDYEEREQLLTDCFEL  145
            +E  +    E  +ASG  ED  E+  LL D   +
Sbjct  70   VEAHRAAAEEPAKASGVDEDESEKVILLDDLVAM  103

Lambda      K        H        a         alpha
   0.318    0.132    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7555698900

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40