Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_00009741841818580.0
PPTG_1667470777217953916e-44
PPTG_1667372581943851e-42
PHYSO_4865219314239992624e-25
PPTG_1667693152401442608e-25
PPTG_16677236502401442591e-24
PHYSO_3256079315241742475e-23
PHYSO_48431670777241742475e-23
PHALS_0897993152161082421e-22
PHYRA_8727093152371132405e-22
PHYRA_78821236502371132405e-22
PHYCA_50470393152331132342e-21
PITG_113009315241742212e-19
PHYSO_29655271351012081e-18
HYAP_015149315297642073e-17
PHYKE_572173171112032e-16
PPTG_1668193122301061956e-16
PHYKE_572493122241011912e-15
PITG_112979312190881855e-15
PHYCA_5424439313239941851e-14
PPTG_166799313225941805e-14
PITG_112989313231941798e-14
PPTG_1669692992181001779e-14
PHYCA_60359312183881751e-13
PHYCA_1045019299180651741e-13
PHYRA_7883392992201001761e-13
PHYRA_7882393138341011842e-13
PITG_1128492992161001752e-13
PPTG_1668050506237731753e-13
PHYSO_4815779313240941735e-13
PHYSO_325601505062461091727e-13
PHYKE_572350506227911655e-12
PHYCA_50470193142471301631e-11
PHYSO_47997056983253981612e-11
PHYSO_4781519312197851583e-11
PHYKE_5722569834001291633e-11
PHYSO_48133492992201001574e-11
PHYRA_78822569832581371579e-11
PHYRA_78820707772581371579e-11
PPTG_1667856983247761542e-10
PYIR_2121850506281991437e-09
PYU1_G00322350506282621357e-08
PYAP_2040050506242561275e-07
PYIW_1527250506297611214e-06
PYAR_1881750506462561083e-04
PHYRA_788269307233781053e-04
PHYRA_7884848167234411053e-04
PITG_11299931410861950.001
PYVX_158759307275821000.002
PHYKE_57259306886491010.002
PYIR_145008196922253980.002
PHYCA_562391930720450970.002
PITG_11292930725650980.003
PYAP_19821930735048990.003
PYVX_15872931210135920.003
PPTG_16686930726050980.003
PHALS_08964930724982960.004
PHYSO_2965284816723150950.005
CCA187851060834673970.005
PYIW_15275930730944940.010
PHYSO_484450930721450920.011
PPTG_16675931410761870.013
PHYSO_532084433919467900.017
PYIR_225204816724352910.019
PYIW_192264816726341910.021
PYIR_24418930728958910.025
PYVX_15652927616379880.028
CCI480941060834752900.031
PPTG_167154816722750890.032
PHYKE_2278715948078900.046
PYU1_G0032348196720569870.047
PYU1_G01393782252214155870.049
PPTG_16701929322981870.065
H257_0086812356524299860.091
PYIW_2544516502725059850.10
PYVX_2176881967307102850.12
PYU1_G0139514816723741840.14
PYIW_248848196721454840.14
PITG_130591060727266840.15
PITG_130601060830166840.16
PITG_130618377628366840.17
HYAP_015344816722651820.26
PHALS_127464122110299840.28
H257_139381091525448820.29
PYAR_254099368622965790.58
PHYKE_7012927643980800.61
PYU1_G003220930735342790.70
PYAP_198319962125848780.90
PHYKE_7014927418278761.1
PYIR_15855927320574761.1
PYVX_158737854655228781.2
PHYCA_5329265857233781771.4
PPTG_123531060829569761.5
PYVX_15645927319080751.6
PYVX_158779368524054742.2
PYIR_215555857223353742.4
PYIR_215549368520654742.5
PITG_08603715918377732.6
PITG_11258927618979732.6
PHALS_13173590334851743.1
PYAP_189668377631965743.4
PYU1_G0032029368523862724.0
PYIW_2544616502820658724.4
SDRG_121881091525656724.4
PYU1_G0032015857223866724.5
PYIW_187649273213100714.8
PHYRA_860895386219666715.3
PYU1_G003215929420860715.7
PHYSO_3153551267119077705.8
H310_08756293635386725.9
PHYRA_78852433939966716.8
PHYCA_121843715918379707.0
H257_12581196121353707.2
PYAR_23128927322556707.2
PHYRA_96703715867178727.3
SPRG_117701091525956708.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00009

Length=418
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00009                                                            720        0.0  
PPTG_16674                                                            155        6e-44
PPTG_16673                                                            152        1e-42
PHYSO_486521                                                          105        4e-25
PPTG_16676                                                            104        8e-25
PPTG_16677                                                            104        1e-24
PHYSO_325607                                                          99.8       5e-23
PHYSO_484316                                                          99.8       5e-23
PHALS_08979                                                           97.8       1e-22
PHYRA_87270                                                           97.1       5e-22
PHYRA_78821                                                           97.1       5e-22
PHYCA_504703                                                          94.7       2e-21
PITG_11300                                                            89.7       2e-19
PHYSO_296552                                                          84.7       1e-18
HYAP_01514                                                            84.3       3e-17
PHYKE_5721                                                            82.8       2e-16
PPTG_16681                                                            79.7       6e-16
PHYKE_5724                                                            78.2       2e-15
PITG_11297                                                            75.9       5e-15
PHYCA_542443                                                          75.9       1e-14
PPTG_16679                                                            73.9       5e-14
PITG_11298                                                            73.6       8e-14
PPTG_16696                                                            72.8       9e-14
PHYCA_6035                                                            72.0       1e-13
PHYCA_104501                                                          71.6       1e-13
PHYRA_78833                                                           72.4       1e-13
PHYRA_78823                                                           75.5       2e-13
PITG_11284                                                            72.0       2e-13
PPTG_16680                                                            72.0       3e-13
PHYSO_481577                                                          71.2       5e-13
PHYSO_325601                                                          70.9       7e-13
PHYKE_5723                                                            68.2       5e-12
PHYCA_504701                                                          67.4       1e-11
PHYSO_479970                                                          66.6       2e-11
PHYSO_478151                                                          65.5       3e-11
PHYKE_5722                                                            67.4       3e-11
PHYSO_481334                                                          65.1       4e-11
PHYRA_78822                                                           65.1       9e-11
PHYRA_78820                                                           65.1       9e-11
PPTG_16678                                                            63.9       2e-10
PYIR_21218                                                            59.7       7e-09
PYU1_G003223                                                          56.6       7e-08
PYAP_20400                                                            53.5       5e-07
PYIW_15272                                                            51.2       4e-06
PYAR_18817                                                            46.2       3e-04
PHYRA_78826                                                           45.1       3e-04
PHYRA_78848                                                           45.1       3e-04
PITG_11299                                                            41.2       0.001
PYVX_15875                                                            43.1       0.002
PHYKE_5725                                                            43.5       0.002
PYIR_14500                                                            42.4       0.002
PHYCA_562391                                                          42.0       0.002
PITG_11292                                                            42.4       0.003
PYAP_19821                                                            42.7       0.003
PYVX_15872                                                            40.0       0.003
PPTG_16686                                                            42.4       0.003
PHALS_08964                                                           41.6       0.004
PHYSO_296528                                                          41.2       0.005
CCA18785                                                              42.0       0.005
PYIW_15275                                                            40.8       0.010
PHYSO_484450                                                          40.0       0.011
PPTG_16675                                                            38.1       0.013
PHYSO_532084                                                          39.3       0.017
PYIR_22520                                                            39.7       0.019
PYIW_19226                                                            39.7       0.021
PYIR_24418                                                            39.7       0.025
PYVX_15652                                                            38.5       0.028
CCI48094                                                              39.3       0.031
PPTG_16715                                                            38.9       0.032
PHYKE_2278                                                            39.3       0.046
PYU1_G003234                                                          38.1       0.047
PYU1_G013937                                                          38.1       0.049
PPTG_16701                                                            38.1       0.065
H257_00868                                                            37.7       0.091
PYIW_25445                                                            37.4       0.10 
PYVX_21768                                                            37.4       0.12 
PYU1_G013951                                                          37.0       0.14 
PYIW_24884                                                            37.0       0.14 
PITG_13059                                                            37.0       0.15 
PITG_13060                                                            37.0       0.16 
PITG_13061                                                            37.0       0.17 
HYAP_01534                                                            36.2       0.26 
PHALS_12746                                                           37.0       0.28 
H257_13938                                                            36.2       0.29 
PYAR_25409                                                            35.0       0.58 
PHYKE_7012                                                            35.4       0.61 
PYU1_G003220                                                          35.0       0.70 
PYAP_19831                                                            34.7       0.90 
PHYKE_7014                                                            33.9       1.1  
PYIR_15855                                                            33.9       1.1  
PYVX_15873                                                            34.7       1.2  
PHYCA_532926                                                          34.3       1.4  
PPTG_12353                                                            33.9       1.5  
PYVX_15645                                                            33.5       1.6  
PYVX_15877                                                            33.1       2.2  
PYIR_21555                                                            33.1       2.4  
PYIR_21554                                                            33.1       2.5  
PITG_08603                                                            32.7       2.6  
PITG_11258                                                            32.7       2.6  
PHALS_13173                                                           33.1       3.1  
PYAP_18966                                                            33.1       3.4  
PYU1_G003202                                                          32.3       4.0  
PYIW_25446                                                            32.3       4.4  
SDRG_12188                                                            32.3       4.4  
PYU1_G003201                                                          32.3       4.5  
PYIW_18764                                                            32.0       4.8  
PHYRA_86089                                                           32.0       5.3  
PYU1_G003215                                                          32.0       5.7  
PHYSO_315355                                                          31.6       5.8  
H310_08756                                                            32.3       5.9  
PHYRA_78852                                                           32.0       6.8  
PHYCA_121843                                                          31.6       7.0  
H257_12581                                                            31.6       7.2  
PYAR_23128                                                            31.6       7.2  
PHYRA_96703                                                           32.3       7.3  
SPRG_11770                                                            31.6       8.6  

>PITG_00009
Length=418

 Score = 720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/418 (100%), Positives = 418/418 (100%), Gaps = 0/418 (0%)

Query  1    MSDLYMFGSPWTASQRDVEVPGHFDELggaqqqagrsagsYEKHFLAENFllglllQENS  60
            MSDLYMFGSPWTASQRDVEVPGHFDELGGAQQQAGRSAGSYEKHFLAENFLLGLLLQENS
Sbjct  1    MSDLYMFGSPWTASQRDVEVPGHFDELGGAQQQAGRSAGSYEKHFLAENFLLGLLLQENS  60

Query  61   SWRRTTRTKSPKLIQTNADLVCYFGYFTPFWFTLPPVWIGKGVDVFMQSTLKGIAKKSKC  120
            SWRRTTRTKSPKLIQTNADLVCYFGYFTPFWFTLPPVWIGKGVDVFMQSTLKGIAKKSKC
Sbjct  61   SWRRTTRTKSPKLIQTNADLVCYFGYFTPFWFTLPPVWIGKGVDVFMQSTLKGIAKKSKC  120

Query  121  STDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRF  180
            STDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRF
Sbjct  121  STDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRF  180

Query  181  PNHNSIATVMGVHDYLDQLENPSNVAKLNSLRCGSSSRVPQAPYTQTPSVEFAMRNSRPI  240
            PNHNSIATVMGVHDYLDQLENPSNVAKLNSLRCGSSSRVPQAPYTQTPSVEFAMRNSRPI
Sbjct  181  PNHNSIATVMGVHDYLDQLENPSNVAKLNSLRCGSSSRVPQAPYTQTPSVEFAMRNSRPI  240

Query  241  SPPTFFKGARACSDRLGLTMSMRSFRAQDPVQIAKNDQkklrkaleraakqerkearkkq  300
            SPPTFFKGARACSDRLGLTMSMRSFRAQDPVQIAKNDQKKLRKALERAAKQERKEARKKQ
Sbjct  241  SPPTFFKGARACSDRLGLTMSMRSFRAQDPVQIAKNDQKKLRKALERAAKQERKEARKKQ  300

Query  301  klarkSHRSLRERGSSSNRIALLSASSVYDCSITSNEEILAEIWAMRSSFTaqvsdedvs  360
            KLARKSHRSLRERGSSSNRIALLSASSVYDCSITSNEEILAEIWAMRSSFTAQVSDEDVS
Sbjct  301  KLARKSHRSLRERGSSSNRIALLSASSVYDCSITSNEEILAEIWAMRSSFTAQVSDEDVS  360

Query  361  aaddkaassaPIEFLFFMGCPDDSSREIGYLRARPKSRSARNTATPSFATAIATTIPQ  418
            AADDKAASSAPIEFLFFMGCPDDSSREIGYLRARPKSRSARNTATPSFATAIATTIPQ
Sbjct  361  AADDKAASSAPIEFLFFMGCPDDSSREIGYLRARPKSRSARNTATPSFATAIATTIPQ  418

>PPTG_16674
Length=217

 Score = 155 bits (391),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)

Query  102  GVDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWC  161
             ++VF+QST KGIAKK+KC+TDDR+PDY VEHRYSAFR LR+ IS+ V + KDKSHARWC
Sbjct  68   ALEVFLQSTPKGIAKKNKCTTDDRSPDYSVEHRYSAFRTLRECISEAVNIPKDKSHARWC  127

Query  162  PYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
            PYCSRVRELVHSS+FPPRFP+ NSI    G+HDYL
Sbjct  128  PYCSRVRELVHSSVFPPRFPS-NSITIATGLHDYL  161

>PPTG_16673
Length=258

 Score = 152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 148/194 (76%), Gaps = 0/194 (0%)

Query  219  VPQAPYTQTPSVEFAMRNSRPISPPTFFKGARACSDRLGLTMSMRSFRAQDPVQIAKNDQ  278
            V   PY +  SVEF +R++R IS   + KG+ AC D  GL  S+RSFRAQ PV++AK +Q
Sbjct  47   VVHIPYMEATSVEFDIRSNRSISSSFYVKGSAACPDHRGLMNSLRSFRAQGPVEVAKKEQ  106

Query  279  kklrkaleraakqerkearkkqklarkSHRSLRERGSSSNRIALLSASSVYDCSITSNEE  338
            KKLRKALERA KQERKEARK QKLA+KS RS+RERG S NRIALLS ++V DCS+ S++E
Sbjct  107  KKLRKALERAVKQERKEARKMQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQE  166

Query  339  ILAEIWAMRSSFTaqvsdedvsaaddkaassaPIEFLFFMGCPDDSSREIGYLRARPKSR  398
            ILAEIWAMRSS   +VSDE +   DDK A +AP+EFLFF GCPDD+S ++ + RAR K+R
Sbjct  167  ILAEIWAMRSSSMGRVSDESMPVVDDKLADTAPMEFLFFTGCPDDNSLDVRHRRARSKAR  226

Query  399  SARNTATPSFATAI  412
             AR +ATPSF T +
Sbjct  227  LARYSATPSFTTTV  240

>PHYSO_486521
Length=239

 Score = 105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 66/99 (67%), Gaps = 4/99 (4%)

Query  102  GVDVFMQSTLKGIAKKSK----CSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSH  157
             +DVF+QSTL G+  KSK      +D     Y V +RYS+FR LR+ I +VV+  KDKSH
Sbjct  70   ALDVFVQSTLTGVVSKSKKLIKGESDSGRIAYQVAYRYSSFRTLRQRIGEVVKEPKDKSH  129

Query  158  ARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
            ++WCPYCSRVR +  SS+FPPRFP+  ++  V G  D +
Sbjct  130  SKWCPYCSRVRGITKSSVFPPRFPSGGAVGIVTGFRDLV  168

>PPTG_16676
Length=240

 Score = 104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 82/144 (57%), Gaps = 33/144 (23%)

Query  103  VDVFMQSTLKG----IAKKSKCSTDDRT-------------------PDYCVEHRYSAFR  139
            +DVF+QS  +G    IA  S  +T  R                     DY VEHRYS FR
Sbjct  68   LDVFLQSAPRGLPSCIATTSASTTQHRHKESKRERRRRELREKDELRADYQVEHRYSTFR  127

Query  140  ALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL---  196
            ALR+ I +VV   KDKSH +WCPYC+RVRELV+S +FP RFPN  S+ATV+G+H  L   
Sbjct  128  ALRERIGEVVAAPKDKSHPQWCPYCTRVRELVNSGVFPSRFPN-GSVATVIGLHKLLVRN  186

Query  197  --DQLENPSNV----AKLNSLRCG  214
              D+LE+  N+    AK  S R G
Sbjct  187  REDRLESFVNLLLRAAKDVSYRSG  210

>PPTG_16677
Length=240

 Score = 104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 82/144 (57%), Gaps = 33/144 (23%)

Query  103  VDVFMQSTLKG----IAKKSKCSTDDRT-------------------PDYCVEHRYSAFR  139
            +DVF+QS  +G    IA  S  +T  R                     DY VEHRYS FR
Sbjct  68   LDVFLQSAPRGLPSCIATTSASTTQHRHKESKRERRRRELREKDELRADYQVEHRYSTFR  127

Query  140  ALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL---  196
            ALR+ I +VV   KDKSH +WCPYC+RVRELV+S +FP RFPN  S+ATV+G+H  L   
Sbjct  128  ALRERIGEVVVAPKDKSHPQWCPYCTRVRELVNSGVFPSRFPN-GSVATVIGLHKLLVRN  186

Query  197  --DQLENPSNV----AKLNSLRCG  214
              D+LE+  N+    AK  S R G
Sbjct  187  REDRLESFVNLLLRAAKDVSYRSG  210

>PHYSO_325607
Length=241

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPN  182
            D+   DY VEHRYS FRALR+ I   V   KDKSH +WCPYC+RVRELV S +FP RFP+
Sbjct  111  DELRADYQVEHRYSTFRALRERIGAAVAAPKDKSHPQWCPYCTRVRELVSSGVFPSRFPS  170

Query  183  HNSIATVMGVHDYL  196
               +A  +G+HDY+
Sbjct  171  RGRVAVAVGLHDYV  184

>PHYSO_484316
Length=241

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 0/74 (0%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPN  182
            D+   DY VEHRYS FRALR+ I   V   KDKSH +WCPYC+RVRELV S +FP RFP+
Sbjct  111  DELRADYQVEHRYSTFRALRERIGAAVAAPKDKSHPQWCPYCTRVRELVSSGVFPSRFPS  170

Query  183  HNSIATVMGVHDYL  196
               +A  +G+HDY+
Sbjct  171  RGRVAVAVGLHDYV  184

>PHALS_08979
Length=216

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 69/108 (64%), Gaps = 16/108 (15%)

Query  103  VDVFMQSTLKGI-------------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVV  149
            +DVF+QS  +G+              + S    +  +PD+ VEHRYS+FR+LRK I + V
Sbjct  54   LDVFLQSAPRGLLSQNATVLVTKSAQRNSVLEREIHSPDFQVEHRYSSFRSLRKRIREAV  113

Query  150  RVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHN-SIATVMGVHDYL  196
             V  DKSH++WCPYCSRVRE+V S +FP RFPN N +IAT  G+ D L
Sbjct  114  AVPSDKSHSQWCPYCSRVREIVTSRVFPSRFPNGNWAIAT--GLRDVL  159

>PHYRA_87270
Length=237

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 19/113 (17%)

Query  103  VDVFMQSTLKGIAKKSKCST-------------------DDRTPDYCVEHRYSAFRALRK  143
            +DVF+Q+  +G+++ +  ++                   DD   DY VEHRYS FRALR+
Sbjct  68   LDVFLQAPPRGLSRTAAPASAKPPRLSRSERRRRELRQQDDLRADYQVEHRYSTFRALRE  127

Query  144  AISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
             I + V   KDKSH +WC YC+RVRELV S +FP R PN   +A   G+HD L
Sbjct  128  RIGEAVAAPKDKSHPQWCAYCTRVRELVSSGVFPSRCPNRGRVAIATGLHDLL  180

>PHYRA_78821
Length=237

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 19/113 (17%)

Query  103  VDVFMQSTLKGIAKKSKCST-------------------DDRTPDYCVEHRYSAFRALRK  143
            +DVF+Q+  +G+++ +  ++                   DD   DY VEHRYS FRALR+
Sbjct  68   LDVFLQAPPRGLSRTAAPASAKPPRLSRSERRRRELRQQDDLRADYQVEHRYSTFRALRE  127

Query  144  AISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
             I + V   KDKSH +WC YC+RVRELV S +FP R PN   +A   G+HD L
Sbjct  128  RIGEAVAAPKDKSHPQWCAYCTRVRELVSSGVFPSRCPNRGRVAIATGLHDLL  180

>PHYCA_504703
Length=233

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 65/113 (58%), Gaps = 20/113 (18%)

Query  103  VDVFMQSTLKGIAKKSKC-------------------STDDRTPDYCVEHRYSAFRALRK  143
            +DVF+Q+  +G+  +S                     + DD   DY VEHRY  FR LR+
Sbjct  64   LDVFLQTPPRGLPSRSGAVPTTQKLVKKSERRRRELRAKDDLRADYQVEHRYLTFRMLRE  123

Query  144  AISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
             I + V   KD+SH +WCPYC+RVRELV+S +FP RFPN  S+A VMG+   L
Sbjct  124  RIGEAVVAPKDRSHPQWCPYCTRVRELVNSGMFPSRFPN-GSVAIVMGLRKIL  175

>PITG_11300
Length=241

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 1/74 (1%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPN  182
            D+   DY VEHRY  FR LR+ I + V   KDKSH +WCPYC+RVREL +S +FP RFPN
Sbjct  112  DELRADYQVEHRYLTFRVLRERIGEAVAAPKDKSHPQWCPYCTRVRELANSGVFPSRFPN  171

Query  183  HNSIATVMGVHDYL  196
              S+A  +G+ D +
Sbjct  172  -GSMAIAIGLRDLV  184

>PHYSO_296552
Length=135

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 67/101 (66%), Gaps = 3/101 (3%)

Query  315  SSSNRIALLSASSVYDCSITSNEEILAEIWAMRSSFTaqvsdedvsaaddkaassaPIEF  374
              S RIA+LS  +V DCS TS+E+ILAEIWAMRS      S +D+   DD+ + +AP+EF
Sbjct  16   GGSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDLPEVDDELSETAPMEF  75

Query  375  LFFMGCPDDSS---REIGYLRARPKSRSARNTATPSFATAI  412
            LFF GCPDD +    ++GY R R   R+ R   TPS+AT++
Sbjct  76   LFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSV  116

>HYAP_01514
Length=297

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 44/64 (69%), Gaps = 0/64 (0%)

Query  128  DYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIA  187
            DY VEHRYSAFR LR+ + + V   KDKSH  WCPYCSRVRE++ S  FP R PN   +A
Sbjct  107  DYQVEHRYSAFRELRERVGEAVAAPKDKSHPYWCPYCSRVREVLRSVAFPSRCPNRGRLA  166

Query  188  TVMG  191
             V G
Sbjct  167  LVTG  170

>PHYKE_5721
Length=317

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%), Gaps = 7/111 (6%)

Query  306  SHRSLRERGSS-SNRIALLSASSVYDCSITSNEEILAEIWAMRSSFTaqvsdedvsaadd  364
            ++++ R+RGSS SNRIALLSA     CSI S+E+ILAEIWA RS     ++D+D+   D+
Sbjct  174  ANKAARQRGSSGSNRIALLSAGV---CSIASDEDILAEIWASRSPSCDGIADDDLPEVDE  230

Query  365  kaassaPIEFLFFMGCPDDSS-RE--IGYLRARPKSRSARNTATPSFATAI  412
              + SAP+EF+FF GCPDD + RE  +GY R R  +R+AR  +T S+AT I
Sbjct  231  DFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNTRAARCPSTSSYATTI  281

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 11/54 (20%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRT-----------PDYCVEHRYSAFRALRKAI  145
            +DVF+QS  +GI K  K S  +R            PDY VE+RYS FRALR+ +
Sbjct  65   LDVFLQSAPRGIPKPVKESKRERKKRELREKDELRPDYQVEYRYSTFRALRQRV  118

>PPTG_16681
Length=230

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 58/106 (55%), Gaps = 12/106 (11%)

Query  103  VDVFMQSTLKGI----------AKKSKC--STDDRTPDYCVEHRYSAFRALRKAISDVVR  150
            VDV++Q + KG+          A+K +     D   P+  V+HRYS FRALR+ I +VV 
Sbjct  61   VDVYLQRSQKGLPSSNSSESVRARKRRLLHEQDAERPECQVQHRYSDFRALREKICEVVD  120

Query  151  VSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
            V  D+ H  WC YC+RV  L+    FP RFPN   +AT  G H  L
Sbjct  121  VKDDQMHPVWCSYCNRVLWLMTFGGFPSRFPNRGVVATYTGWHRLL  166

>PHYKE_5724
Length=224

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 56/101 (55%), Gaps = 12/101 (12%)

Query  103  VDVFMQSTLKGI--AKKSKCSTDDRT----------PDYCVEHRYSAFRALRKAISDVVR  150
            +DV++  T KG+  A   +  TD +           P+Y VEHRYS FRALR+ I D+V 
Sbjct  60   MDVYIHKTQKGLPTANAGESKTDRKRRLQHQQESERPEYDVEHRYSDFRALRQRIYDIVD  119

Query  151  VSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
             ++D+ H  WC YC R+  L     FP RFPN  ++AT  G
Sbjct  120  CTEDQLHPVWCAYCCRMLWLATYGGFPSRFPNKGAVATYTG  160

>PITG_11297
Length=190

 Score = 75.9 bits (185),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 0/88 (0%)

Query  109  STLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVR  168
            +T+  + ++     D   P+  V+HRYS FRALR+ I +VV V  D+ H  WC YC+RV 
Sbjct  40   ATIYVVDRRLLHEQDAERPECHVQHRYSDFRALREKICEVVDVKDDQMHPVWCSYCNRVL  99

Query  169  ELVHSSIFPPRFPNHNSIATVMGVHDYL  196
             L+    FP RFPN  ++AT  G H  L
Sbjct  100  WLMKFGGFPSRFPNRGAVATFTGWHRLL  127

>PHYCA_542443
Length=239

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 12/94 (13%)

Query  103  VDVFMQSTLKGI-----AKKSKC----STDDRTPDYCVEHRYSAFRALRKAISDVVRVSK  153
            ++VF+++T KG+       + +C        +TPDY VEHRYS FRA+ K++SDVV    
Sbjct  67   LNVFLRTTQKGLPTLETLDQRRCRLRRENKGQTPDYQVEHRYSDFRAMVKSVSDVV---N  123

Query  154  DKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIA  187
            D  H R+C YCSRV  +  ++ FPPR PN   +A
Sbjct  124  DHDHFRFCAYCSRVGTMESAAGFPPRVPNRGPLA  157

>PPTG_16679
Length=225

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 12/94 (13%)

Query  103  VDVFMQSTLKGI---------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSK  153
            V+VF+++T KG+          ++ +      TPDY VEHRYS FRA+ K+ISDVV    
Sbjct  66   VNVFLRTTQKGLPTVETLDQRRRRLRREYKGLTPDYQVEHRYSDFRAMVKSISDVV---N  122

Query  154  DKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIA  187
            D  H R+C YCSRV  +  ++ FPPR PN   +A
Sbjct  123  DHDHFRFCAYCSRVGIIESAAGFPPRVPNRGPLA  156

>PITG_11298
Length=231

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 56/94 (60%), Gaps = 12/94 (13%)

Query  103  VDVFMQSTLKGI---------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSK  153
            V+VF+++T KG+          ++ +     +TPDY VEHRYS FRA+ K+IS+VV    
Sbjct  68   VNVFLRTTQKGLPTMETLDQRRRRLRREYQGQTPDYQVEHRYSDFRAMVKSISNVV---N  124

Query  154  DKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIA  187
            D  H R+C YCSRV     ++ FPPR PN   +A
Sbjct  125  DHDHFRFCAYCSRVGTTESAAGFPPRIPNRGPLA  158

>PPTG_16696
Length=218

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 52/100 (52%), Gaps = 14/100 (14%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDR-----------TPDYCVEHRYSAFRALRKAISDVVRV  151
            +DV++Q   +G+      +T +R            P+Y VEHRYSAFR LRK I+ +V  
Sbjct  60   LDVYLQYVQRGLPTTPGKTTSERRSRLQQEKEETEPEYQVEHRYSAFRELRKRITAIV--  117

Query  152  SKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
              D+ H +WC YCSRV  +     FP RFPN    A   G
Sbjct  118  -HDREHMQWCAYCSRVTWITSVEGFPSRFPNRGRWAVYTG  156

>PHYCA_6035
Length=183

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 0/88 (0%)

Query  109  STLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVR  168
            +T+  + ++     D   P+  V+ RYS FRALR+ I +VV V  D+ H  WC YC+RV 
Sbjct  40   ATMYVVDRRLLHEQDAERPECQVQRRYSDFRALREKIFEVVDVKDDQMHPAWCAYCNRVL  99

Query  169  ELVHSSIFPPRFPNHNSIATVMGVHDYL  196
             L+    FP RFPN   +AT  G H  L
Sbjct  100  WLMLYGGFPSRFPNRGVVATYTGWHSLL  127

>PHYCA_104501
Length=180

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 39/65 (60%), Gaps = 3/65 (5%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            P+Y VEHRYSAFR LRK I+ +V    D+ H RWC YCSRV  L     FP RFPN    
Sbjct  57   PEYQVEHRYSAFRELRKRITKIV---NDRKHMRWCAYCSRVAWLTSVEGFPSRFPNRGWW  113

Query  187  ATVMG  191
            A   G
Sbjct  114  AIYTG  118

>PHYRA_78833
Length=220

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 14/100 (14%)

Query  103  VDVFMQSTLKGI-----------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRV  151
            +DV++Q   +G+             + +   ++  P+Y VEHRYSAFR LRK IS +V  
Sbjct  62   LDVYLQYVQRGLPVTPGETKSERRSRLQLEKEETEPEYQVEHRYSAFRELRKRISKIV--  119

Query  152  SKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
              D+ H RWC YCSRV  +     FP R P+    A+ +G
Sbjct  120  -HDREHMRWCAYCSRVTWIASIQSFPSRLPHRGRWASCIG  158

>PHYRA_78823
Length=834

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 53/101 (52%), Gaps = 12/101 (12%)

Query  103  VDVFMQSTLKGIAK-----------KSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRV  151
            +DVF+Q   KG+ K           + K        +Y VEHRYSAFR LR+ I DVV  
Sbjct  280  LDVFVQDVQKGLPKTPTQHNFKLTWRPKRDKPSERAEYQVEHRYSAFRLLRQRIVDVVNA  339

Query  152  -SKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
             S+   H +WC YCSRV  LV    FP R+PN   +AT  G
Sbjct  340  PSESDQHPQWCAYCSRVLWLVTVGDFPSRYPNQGPVATYTG  380

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 12/94 (13%)

Query  103  VDVFMQSTLKGI---------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSK  153
            VDVF+++T KG+          ++ +     +TPDY VEHRYS FRA+ K+ISDVV    
Sbjct  671  VDVFLRTTQKGLPTVETLDQRRRRLRLENQSQTPDYQVEHRYSDFRAMVKSISDVV---N  727

Query  154  DKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIA  187
            D  H R+C YCSRV     ++ FP R PN   +A
Sbjct  728  DHDHFRFCAYCSRVGTTESAAGFPSRVPNRGPLA  761

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  103  VDVFMQSTLKGI----AKKSKCSTDDRT-PDYCVEHRYSAFRALRKAISDVVRVSKDKSH  157
            V+V++Q   +G+    AK+      +R  P+  V HRYS FRALR  I DVV V+ D+ H
Sbjct  56   VEVYLQKAQQGLPKSNAKRQLLREQERERPECHVVHRYSDFRALRHEIYDVVDVTDDQMH  115

Query  158  ARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG-----VHDYLDQLENPSN----VAKL  208
              WC YC RV  L+    FP R PN   +A + G         + +LEN  N     AK 
Sbjct  116  PVWCSYCCRVLWLMTYGSFPSRLPNRGVVARISGWSGLLARHRMHKLENFINELLTAAKD  175

Query  209  NSLRCGS  215
             S R G+
Sbjct  176  QSYRHGN  182

>PITG_11284
Length=216

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 14/100 (14%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDR-----------TPDYCVEHRYSAFRALRKAISDVVRV  151
            +DV++Q   +G+      +T +R            P+Y VEHRYSAFR LRK ++ +V  
Sbjct  58   LDVYLQYVQRGLPTTPGETTSERRSRLQQEKEEAEPEYQVEHRYSAFRELRKRVTAIV--  115

Query  152  SKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
              D+ H +WC YCSRV  +     FP RFPN    A   G
Sbjct  116  -HDRKHMQWCAYCSRVTWITSVEGFPSRFPNRGRWAVYTG  154

>PPTG_16680
Length=237

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSK---DKSHARWCPYCSRVRELVHSSIFPPRFPNH  183
            P+Y VEHRYSAFR LR+ I DVV  +    D++H + CPYCSRV  LV +  FP R+PN 
Sbjct  103  PEYQVEHRYSAFRLLRQRILDVVSATPPDVDQNHPQCCPYCSRVLWLVTARDFPSRYPNG  162

Query  184  NSIATVMGVHDYL  196
             ++AT  G    L
Sbjct  163  GALATYTGWRQLL  175

>PHYSO_481577
Length=240

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 12/94 (13%)

Query  103  VDVFMQSTLKGI---------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSK  153
            V VF+++T KG+          ++ +     +TPDY VEHRYS FRA+ K+IS+VV    
Sbjct  70   VSVFLRTTQKGLPTMETLDQRRRRLRREYQGQTPDYHVEHRYSDFRAMVKSISNVV---N  126

Query  154  DKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIA  187
            D  H R+C YCSRV     ++ FPPR PN   ++
Sbjct  127  DHDHFRFCAYCSRVGTTESAAGFPPRVPNRGPLS  160

>PHYSO_325601
Length=246

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  96   PVWIGKGVDVFMQSTLKGIAK------------KSKCSTDDRTPDYCVEHRYSAFRALRK  143
            PV     +DVF+Q  LKG+ K            + K        DY VEHRYS+FR LR+
Sbjct  71   PVVTVYVMDVFLQDVLKGLPKSAANRDKHKRTWRQKPEKRSEHVDYQVEHRYSSFRLLRQ  130

Query  144  AISDVVRV-SKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
             I +VV   S+  SH  WC YCSRV  LV +  FP  +P+   +AT  G
Sbjct  131  RILNVVSAPSESDSHPLWCAYCSRVLWLVTAGDFPSPYPSKGPVATYTG  179

>PHYKE_5723
Length=227

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 51/91 (56%), Gaps = 2/91 (2%)

Query  103  VDVFMQSTLKGIAKKS-KCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDK-SHARW  160
            VDVF+Q   KG+ K   K       P Y V+HRYS FR LR+ I DVV    D  +H   
Sbjct  70   VDVFLQRMQKGLPKTDRKREQQSEHPAYRVQHRYSEFRLLRQHIEDVVGDPGDDDAHPLL  129

Query  161  CPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
            CPYCSRV  LV +  FP R+PN   +AT  G
Sbjct  130  CPYCSRVLWLVTAGSFPSRYPNQGPVATCTG  160

>PHYCA_504701
Length=247

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query  98   WIGKGVD---VFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKD  154
            +I KG+    V +  T K   ++ +   +   P Y VEHRYSAFR LR+ I   V    +
Sbjct  89   YIQKGLPPACVLLGETDKQRRQRLQLERELERPVYQVEHRYSAFRDLRRRIMKTVSARSE  148

Query  155  KSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG-----VHDYLDQLENPSN----V  205
              + + C YCSRV+ +  S+ FPPR PN   +AT  G      H    QLE+  N     
Sbjct  149  NRYHQLCTYCSRVKFIDSSTNFPPRIPNRGVVATCTGWRKLCTHFRKRQLESFVNQLLRA  208

Query  206  AKLNSLRCGS  215
            AK  S R GS
Sbjct  209  AKDMSYRTGS  218

>PHYSO_479970
Length=253

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 50/98 (51%), Gaps = 9/98 (9%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            P Y VEHRYSAFR LR+ I   V    D  + + C YCSR++ +  S+ FPPR PN   +
Sbjct  127  PVYQVEHRYSAFRELRRRIMKTVNARSDNRYHQQCAYCSRIKFIDSSTSFPPRVPNRGLV  186

Query  187  ATVMG-----VHDYLDQLENPSN----VAKLNSLRCGS  215
            AT  G      H    QLE   N     AK  S R GS
Sbjct  187  ATCTGWRQLCTHFRKRQLEGFLNQLLRAAKDLSYRTGS  224

>PHYSO_478151
Length=197

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 45/85 (53%), Gaps = 0/85 (0%)

Query  109  STLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVR  168
            +T+  + ++     D   P+   + RYS FRALR+ I +VV V+ D+ H  WC YC RV 
Sbjct  57   ATMYVVDRRLLHEQDQERPECRAQRRYSDFRALRRQICEVVDVADDQMHPVWCSYCCRVL  116

Query  169  ELVHSSIFPPRFPNHNSIATVMGVH  193
             L     FP R PN   +AT  G H
Sbjct  117  WLATYGGFPSRVPNRGVVATCTGWH  141

>PHYKE_5722
Length=400

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 65/129 (50%), Gaps = 21/129 (16%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDR---------TPDYCVEHRYSAFRALRKAISDVVRVSK  153
            V+VF++ T KG+      S   R          PDY VEHRYS FRA+ K+IS VV    
Sbjct  26   VNVFLKKTQKGLPTVETLSQRKRRLRHEQKLMAPDYQVEHRYSDFRAMVKSISAVV---N  82

Query  154  DKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG------VHDYLDQLENPSNVAK  207
            D  H R+C YCSRV     ++ FP R P+   +  ++       +  +++Q+      AK
Sbjct  83   DHDHFRFCAYCSRVGTTKSAAGFPSRVPSRGPVRQLVTRIRKSRLEHFVNQM---LKAAK  139

Query  208  LNSLRCGSS  216
             NS R GSS
Sbjct  140  DNSYRSGSS  148

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  116  KKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSI  175
            K+ +   D   P Y VEHRYSAFR L++ I   V    +  H   C YCSRV+ +  S+ 
Sbjct  265  KRLQLQRDTERPMYQVEHRYSAFRELKRHIVKTVNARGEHRHLMQCAYCSRVKFIDSSAT  324

Query  176  FPPRFPNHNSIATVMG  191
            FPPR  +   +A V G
Sbjct  325  FPPRVLSRGLVAKVTG  340

>PHYSO_481334
Length=220

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 14/100 (14%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDR-----------TPDYCVEHRYSAFRALRKAISDVVRV  151
            +DV++Q   +G+      +  +R            P+Y VEHRYSAFR LRK I+ +V  
Sbjct  62   LDVYLQYVQRGLPTTPGETKSERRSRLEQEKEEAEPEYQVEHRYSAFRELRKRIAKIV--  119

Query  152  SKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
              D+   RWC YCSRV  +     FP RFPN  S A   G
Sbjct  120  -HDREPLRWCAYCSRVTWIASVESFPSRFPNRGSWAQWTG  158

>PHYRA_78822
Length=258

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 23/137 (17%)

Query  103  VDVFMQSTLKGI--------------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDV  148
            V+V+++   KG+               K+ +   +   P Y VEHRYS FR LR+ +   
Sbjct  94   VNVYLRYMQKGLPPASLLLGESESQRKKRLQLEREMERPMYQVEHRYSVFRELRRRVMKT  153

Query  149  VRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG-----VHDYLDQLENPS  203
            V    D  + + C YCSRV+ +  S+ FPPR PN   +AT  G      H    QLE+  
Sbjct  154  VSARDDHRNHQQCAYCSRVKFIDSSTGFPPRMPNRGLVATCTGWRQICTHFRKRQLESFV  213

Query  204  N----VAKLNSLRCGSS  216
            N     AK  S R GS 
Sbjct  214  NQLLKAAKDLSYRTGSG  230

>PHYRA_78820
Length=258

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 23/137 (17%)

Query  103  VDVFMQSTLKGI--------------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDV  148
            V+V+++   KG+               K+ +   +   P Y VEHRYS FR LR+ +   
Sbjct  94   VNVYLRYMQKGLPPASLLLGESESQRKKRLQLEREMERPMYQVEHRYSVFRELRRRVMKT  153

Query  149  VRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG-----VHDYLDQLENPS  203
            V    D  + + C YCSRV+ +  S+ FPPR PN   +AT  G      H    QLE+  
Sbjct  154  VSARDDHRNHQQCAYCSRVKFIDSSTGFPPRMPNRGLVATCTGWRQICTHFRKRQLESFV  213

Query  204  N----VAKLNSLRCGSS  216
            N     AK  S R GS 
Sbjct  214  NQLLKAAKDLSYRTGSG  230

>PPTG_16678
Length=247

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 1/76 (1%)

Query  116  KKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSI  175
            K+ +   +   P Y VEHRYS FR LR+ I + VR    + H   C YCSRV+ +  S+ 
Sbjct  111  KRLRLEREMECPLYQVEHRYSEFRELRRRIMETVRARGGRYHQH-CSYCSRVKFIDSSTS  169

Query  176  FPPRFPNHNSIATVMG  191
            FPPR PN   +AT  G
Sbjct  170  FPPRVPNRGLMATCTG  185

>PYIR_21218
Length=281

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 1/99 (1%)

Query  115  AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSS  174
            ++  K ++  + P Y +EHRYSAFR LRK + + V  S D+ H +WC YCS+++ L    
Sbjct  139  SESKKHASASKPPRYQIEHRYSAFRELRKRLREAVEES-DRHHVKWCWYCSKMQWLTMFG  197

Query  175  IFPPRFPNHNSIATVMGVHDYLDQLENPSNVAKLNSLRC  213
             FP R P    +AT     + L++      + +   L C
Sbjct  198  SFPSRHPLLRLLATYSHCGETLERAVLSKALRRRRKLEC  236

>PYU1_G003223
Length=282

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDK-SHARWCPYCSRVRELVHSSIFPPRFPNHNS  185
            P Y + HR+SAFRALRK +  VV    D   H +WC YCSR++       FP R P  ++
Sbjct  146  PQYHIVHRFSAFRALRKRLRKVVEADVDNWQHVKWCCYCSRIQYFTVFGAFPSRHPIASA  205

Query  186  IA  187
            +A
Sbjct  206  VA  207

>PYAP_20400
Length=242

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPR  179
            +  P Y + +R+S F  LR+ + + V  + D  HA+WC YCSR+  LVH + FP R
Sbjct  113  EEKPHYRMAYRFSEFYELRRQLQEAVTPTDDVLHAKWCRYCSRIDGLVHGAPFPSR  168

>PYIW_15272
Length=297

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (56%), Gaps = 1/61 (2%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            P Y +E+RYSAF  LR  + D V    D+ H +WC YCS+V+       FP R P   SI
Sbjct  164  PHYQIEYRYSAFCELRARLRDAVE-DNDRHHLKWCWYCSKVQWAATFGAFPSRHPLLKSI  222

Query  187  A  187
            A
Sbjct  223  A  223

>PYAR_18817
Length=462

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 3/56 (5%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPR  179
            ++ P Y + +R+S F  LRK + DVV   ++  H++WC YC  +  +V+ S FP R
Sbjct  119  EKNPHYRIAYRFSEFFELRKELRDVV---EESLHSKWCAYCGSLDWIVNDSPFPSR  171

>PHYRA_78826
Length=233

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 10/78 (13%)

Query  103  VDVFMQSTLKGI----AKKSKCSTD----DRTPDYCVEHRYSAFRALRKAISDVVRVSKD  154
            +DV+     KG+    +++ K S D    DR PDY +E RYS+F  LR  ++ + R    
Sbjct  89   LDVYRYRLQKGLPCTRSRRRKLSADREPEDRGPDYQIEQRYSSFARLRSNVAHIARKRHP  148

Query  155  KSHARWCPYCSRVRELVH  172
            K  A  C YCS + + +H
Sbjct  149  KGKA--CGYCSGLLDFLH  164

>PHYRA_78848
Length=234

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 2/41 (5%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC  164
            +R P+Y VEHR+S FR LR +++ +VR S  ++HA+ C  C
Sbjct  112  EREPNYSVEHRFSEFRELRDSVAGLVRAS--EAHAKSCAAC  150

>PITG_11299
Length=108

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query  149  VRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG-----VHDYLDQLENPS  203
            V+   D  + + C YCSRV+ +  S+ FPPR PN   +AT +G      H    QLE+  
Sbjct  4    VKARGDSRYHQHCSYCSRVKFIDSSTSFPPRVPNRGVVATCIGWRRVCTHFRKRQLESFV  63

Query  204  N  204
            N
Sbjct  64   N  64

>PYVX_15875
Length=275

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (48%), Gaps = 12/82 (15%)

Query  103  VDVFMQSTLKGIAKKSKCS----------TDDRTPDYCVEHRYSAFRALRKAISDVVRVS  152
            VD++     KGI  + K +            DR PDY +E RYS+F  LR  ++++ R  
Sbjct  128  VDLYRYQQQKGIPTRRKSAPPTPRSASPAGQDRRPDYQIEQRYSSFARLRHNVANIAR--  185

Query  153  KDKSHARWCPYCSRVRELVHSS  174
            K     R C YC  + + + ++
Sbjct  186  KRHPRGRACAYCDSLLDFLQTT  207

>PHYKE_5725
Length=886

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH  172
            DR PDY +E RYS+F  LR  ++ + R  K     + C YCS + + +H
Sbjct  159  DRAPDYQIEQRYSSFARLRSNVAHIAR--KHHPKCKTCAYCSGLLDFLH  205

>PYIR_14500
Length=222

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  128  DYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRF  180
            +Y V+HR+S F  LR  +  +  +   K+H + C YC  +   V  SI+ P F
Sbjct  108  NYQVDHRFSDFAKLRHMLQYISHLQGGKAHTKQCKYCKDMLSFVEHSIWQPGF  160

>PHYCA_562391
Length=204

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH  172
            +DR PDY +E RYS+F  LR  ++ + R  K     + C YCS + + +H
Sbjct  88   EDRGPDYQIEQRYSSFARLRSNVAHIAR--KHHPKCKSCAYCSGLLDFLH  135

>PITG_11292
Length=256

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH  172
            +DR PDY +E RYS F  LR  ++ + R    K  A  C YCS + + +H
Sbjct  140  EDRAPDYQIEQRYSNFARLRSNVAHIARKHHPKRKA--CAYCSSLLDFLH  187

>PYAP_19821
Length=350

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query  125  RTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW-----CPYCSRV  167
            R PDY ++HR+S F  LR  + +  RV  +    RW     C YC RV
Sbjct  214  RAPDYQIQHRFSNFIQLRNKVLEATRVKHNDGRGRWSKRNPCEYCRRV  261

>PYVX_15872
Length=101

 Score = 40.0 bits (92),  Expect = 0.003, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  157  HARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG  191
            HA+WC YCSRV  L     FP R PN  ++A   G
Sbjct  2    HAKWCAYCSRVAWLADYGGFPSRLPNGGALAVHSG  36

>PPTG_16686
Length=260

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH  172
            +DR PDY +E RYS+F  LR  ++ + R  K     + C YCS + + +H
Sbjct  144  EDRGPDYQIEQRYSSFARLRSNVAHIAR--KHHPKRKTCAYCSSLLDFLH  191

>PHALS_08964
Length=249

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 14/82 (17%)

Query  103  VDVFMQSTLKGI------------AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVR  150
            +DV++    KG+             + + C   +R PDY +E RYS+F  LR  +S   R
Sbjct  101  LDVYLYRQQKGLPSSRRKLFSNSSKRLADCEPQNRKPDYHIEQRYSSFARLRSNVSHSAR  160

Query  151  VSKDKSHARWCPYCSRVRELVH  172
              K     + C YC+ V + +H
Sbjct  161  --KHHPLCKACAYCTSVLDFLH  180

>PHYSO_296528
Length=231

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHS  173
            +R PDY VEHR+S FR LR  ++ +VR   + +H+  C  C  ++ ++ S
Sbjct  105  EREPDYVVEHRFSEFRELRACVAALVRA--NCAHSVECAGCQNLQRVMVS  152

>CCA18785
Length=346

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 32/73 (44%), Gaps = 0/73 (0%)

Query  108  QSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRV  167
            QS   G         D +   + V  RYS FRAL + I  VV  +K       CPYC  +
Sbjct  45   QSRRNGDLTTDTSDEDSQINHWFVARRYSEFRALYEQIQFVVTNTKATKRNISCPYCEAL  104

Query  168  RELVHSSIFPPRF  180
             +  H+  FP RF
Sbjct  105  AQFHHNFTFPQRF  117

>PYIW_15275
Length=309

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (55%), Gaps = 2/44 (5%)

Query  121  STDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC  164
            S   R PDY +EHR+S+F  LR  +  + R  K     R CPYC
Sbjct  191  SVTGREPDYQIEHRFSSFARLRSNVWQIAR--KRHQRGRACPYC  232

>PHYSO_484450
Length=214

 Score = 40.0 bits (92),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH  172
             +R PDY +E RYS+F  LR  ++ + R    K  A  C YCS + + +H
Sbjct  98   QNRGPDYQIEQRYSSFARLRSNVAHIARKHHPKCQA--CAYCSGLLDFLH  145

>PPTG_16675
Length=107

 Score = 38.1 bits (87),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 30/61 (49%), Gaps = 6/61 (10%)

Query  149  VRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMG-----VHDYLDQLENPS  203
            VR    + H   C YCSRV+ +  S+ FPPR PN   +AT  G      H    QLE+  
Sbjct  4    VRARGGRYHQH-CSYCSRVKFIDSSTSFPPRVPNRGLMATCTGWRQICTHFRKRQLESFV  62

Query  204  N  204
            N
Sbjct  63   N  63

>PHYSO_532084
Length=194

 Score = 39.3 bits (90),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 34/67 (51%), Gaps = 5/67 (7%)

Query  103  VDVFMQSTLKGIAKKSKCSTD-DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWC  161
            V+V+++  +  I    K  +D +R PDY V+ R+S F  LR+ +    R    +     C
Sbjct  58   VEVYLKHQVNRIPTNVKSESDPNRKPDYVVKRRFSDFDLLRRHVGQHAR----REIVGAC  113

Query  162  PYCSRVR  168
            PYC R R
Sbjct  114  PYCDRFR  120

>PYIR_22520
Length=243

 Score = 39.7 bits (91),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 6/52 (12%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRE-LVHS  173
            ++R PDY VEHR++ FR L+ A+  V      + HA  C +C  +   L HS
Sbjct  130  NEREPDYHVEHRFADFRELKNALQVVA-----QQHADQCVHCQTLHAYLTHS  176

>PYIW_19226
Length=263

 Score = 39.7 bits (91),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 5/41 (12%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC  164
            +R PDY VEHR++ FR L+ A+  V      ++HA  C +C
Sbjct  151  EREPDYQVEHRFADFRELKNALQVVA-----EAHADQCAHC  186

>PYIR_24418
Length=289

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 30/58 (52%), Gaps = 3/58 (5%)

Query  121  STDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC-SRVRELVHSSIFP  177
            S+  R PDY +EHRYS+F  LR  +  + R  K     R C YC S V+  V S   P
Sbjct  171  SSQSREPDYQIEHRYSSFARLRSNVWQIAR--KRHRRGRPCAYCGSLVKFFVESDAQP  226

>PYVX_15652
Length=163

 Score = 38.5 bits (88),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (46%), Gaps = 5/79 (6%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDR-TPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWC  161
            +DV+ +  L  I    +   + R  PDY +E RYS F +LR      V +   + H + C
Sbjct  30   LDVYRKQQLHRIPSNFRLGLERREKPDYQLEKRYSEFESLRYN----VWLYAQRRHGKHC  85

Query  162  PYCSRVRELVHSSIFPPRF  180
             YC    + + +S   PR 
Sbjct  86   KYCEHYMDYIVTSFAQPRL  104

>CCI48094
Length=347

 Score = 39.3 bits (90),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 0/52 (0%)

Query  129  YCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRF  180
            + V  RYS FRAL + I  VV  SK       CPYC  + +   +  FP RF
Sbjct  66   WFVARRYSEFRALYEQIQFVVAKSKTTKRNTACPYCEALAQFHRNFTFPQRF  117

>PPTG_16715
Length=227

 Score = 38.9 bits (89),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHS  173
            +R PD+ VE R+S FR LR  ++ +VR   D +H + C  C  +  +V S
Sbjct  107  ERQPDFVVERRFSEFRQLRDRVTALVRA--DAAHVKTCVDCQDLLRVVLS  154

>PHYKE_2278
Length=480

 Score = 39.3 bits (90),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (44%), Gaps = 2/78 (3%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCP  162
            +D+F+      I   +  +  D  PDY VEHR+S F  LR       +   +  H   C 
Sbjct  51   LDIFLLHHTSRIPTHNMPTASDSQPDYQVEHRFSDFADLRYQAWAYAQRKHEDGHI--CK  108

Query  163  YCSRVRELVHSSIFPPRF  180
            YCS+    +  S+  PR 
Sbjct  109  YCSKYMHFILYSLSQPRL  126

>PYU1_G003234
Length=205

 Score = 38.1 bits (87),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 4/69 (6%)

Query  115  AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHA----RWCPYCSRVREL  170
            A+ S  S     PDY VEHR+  F  LR AI + V VS   S        C +C  + + 
Sbjct  73   ARDSMLSQPFEEPDYEVEHRFGEFVELRHAIRNCVLVSHSNSGLPNDHEMCSFCGPMLQY  132

Query  171  VHSSIFPPR  179
            ++  +  PR
Sbjct  133  INHDMKQPR  141

>PYU1_G013937
Length=214

 Score = 38.1 bits (87),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 70/155 (45%), Gaps = 36/155 (23%)

Query  98   WIGKG------VDVFMQSTLKGI-----AKKSK--------CSTD-----DRTPDYCVEH  133
            ++G+G      +DVF+Q     I     +K+SK        C +       R PD+ VE 
Sbjct  51   FVGRGDTIYYVIDVFLQKPESRIPTNNRSKQSKSFVPGAKGCESSASLASTREPDFQVER  110

Query  134  RYSAFRALRKAISDVVRVSKDKSHARWCPYCSR-VRELVHSSIFPPRFPN----HNSIAT  188
            R+S F  LR A   V R+++       C +C+  V  ++ SS  P RF N     N  A 
Sbjct  111  RFSEFTKLRSA---VYRLAQTSHSLLRCQFCNDVVNSILLSSNQPKRFMNLLFTRNVKAR  167

Query  189  VMGVHDYLDQLENPSNVAKLNS--LRCGSSSRVPQ  221
            ++  H +++ L + +  +K N+    C    ++PQ
Sbjct  168  IL--HKFVNSLMDMTLRSKKNNGCRECKGQEQIPQ  200

>PPTG_16701
Length=229

 Score = 38.1 bits (87),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 41/81 (51%), Gaps = 8/81 (10%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRT----PDYCVEHRYSAFRALRKAISDVVRVSKDKSHA  158
            ++VF+ +    +   +  S+++R     P + VEHR+S F  LRK++S  V + +  S  
Sbjct  94   LEVFLSTPTSRLPVSTPSSSEERAAAACPAFTVEHRFSDFEELRKSVSSCVSMERQCS--  151

Query  159  RWCPYCSRVRELVHSSIFPPR  179
              C YC +  E +  S   PR
Sbjct  152  --CMYCLKFVEYIRFSSSQPR  170

>H257_00868
Length=242

 Score = 37.7 bits (86),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 10/99 (10%)

Query  99   IGKGVDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKA-ISDVVRVSKDKSH  157
            +   +DV++     GI          R P Y V+HRYS  R LR + I+ V+   +D+S 
Sbjct  97   VAYSMDVYLAVAELGIYDHWT----SRQPHYQVQHRYSDCRTLRLSLITSVLDAHRDQS-  151

Query  158  ARWCPYCSRVRELVHSSIFPPRFPNHNSIATVMGVHDYL  196
               C +C  +     S  FP R+P    + TV G H  L
Sbjct  152  ---CEFCKCMFNFFVSFPFPKRWPK-VLVQTVPGWHSLL  186

>PYIW_25445
Length=250

 Score = 37.4 bits (85),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW--CPYCSRVRELVHSSIFPPR  179
            D   PD+ V HRY  F  LRK +S +V+ +  K   R   C +C  +RE ++     PR
Sbjct  115  DGHEPDFEVSHRYPEFVRLRKKLSKIVKRAHRKITPRHSECAFCRPMREFLNHDRTRPR  173

>PYVX_21768
Length=307

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 7/102 (7%)

Query  125  RTPDYCVEHRYSAFRALRKAISDVV--RVSKDKSHARWCPYCSRVRELVHSSIFPPRFPN  182
            R  DY V+H Y+AF  L + +  +V  R   D  H   C YCSR+RE +  + + P  P 
Sbjct  189  RESDYEVDHAYAAFVELAQFVRLLVGSRQRSDSIHHDDCRYCSRLREFIRCTPWRPS-PA  247

Query  183  HN----SIATVMGVHDYLDQLENPSNVAKLNSLRCGSSSRVP  220
            H       A +  +  +++Q+ +        S  C +S  VP
Sbjct  248  HRLTTLKTAKMRWLTTFMNQMLHIVAAESTASSDCQASVHVP  289

>PYU1_G013951
Length=237

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC  164
            DR P Y +EHR+  F+ L+ A+  V      K HA +C +C
Sbjct  125  DREPAYQIEHRFVDFQELKSALQRVA-----KKHAAYCSHC  160

>PYIW_24884
Length=214

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 31/54 (57%), Gaps = 3/54 (6%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW--CPYCSRVRE-LVHSSIFP  177
            PD+ + HRYS F ALRK +S + + +  K+ A+   C +C  + E L H S  P
Sbjct  89   PDFEILHRYSEFVALRKKLSAITKDAHHKTSAKHSDCTFCKPLLEFLNHDSARP  142

>PITG_13059
Length=272

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 5/66 (8%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            PD+ V  RYS FRAL +A+      +  K HA  C  C  + E  +SS+   RFP+ + +
Sbjct  55   PDWYVAKRYSEFRALHEALQRQCNGNGSKQHAS-CSACEEL-ESFYSSV---RFPDRHIL  109

Query  187  ATVMGV  192
             + +G+
Sbjct  110  QSGLGI  115

>PITG_13060
Length=301

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 5/66 (8%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            PD+ V  RYS FRAL +A+      +  K HA  C  C  + E  +SS+   RFP+ + +
Sbjct  55   PDWYVAKRYSEFRALHEALQRQCNGNGSKQHAS-CSACEEL-ESFYSSV---RFPDRHIL  109

Query  187  ATVMGV  192
             + +G+
Sbjct  110  QSGLGI  115

>PITG_13061
Length=283

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 5/66 (8%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            PD+ V  RYS FRAL +A+      +  K HA  C  C  + E  +SS+   RFP+ + +
Sbjct  37   PDWYVAKRYSEFRALHEALQRQCNGNGSKQHAS-CSACEEL-ESFYSSV---RFPDRHIL  91

Query  187  ATVMGV  192
             + +G+
Sbjct  92   QSGLGI  97

>HYAP_01534
Length=226

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (55%), Gaps = 2/51 (4%)

Query  124  DRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSS  174
            +R PD+ VE R+S FR LR  +  ++R   +  H   C  C  + ++V +S
Sbjct  105  EREPDFVVERRFSEFRWLRDGVVALIR--ANGGHVSTCVDCQELVQVVIAS  153

>PHALS_12746
Length=1102

 Score = 37.0 bits (84),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 18/99 (18%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW--  160
            +D+ + S  KG+  ++ C T    P    +H  S F A+ +   DV+R+   +++  W  
Sbjct  445  LDIVIDSLKKGVHPRAICKTLSYCPSEIADHT-SDFDAISRL--DVMRMVGLEANKNWAM  501

Query  161  -----------CPYCSRVRELVHSSIF--PPRFPNHNSI  186
                       C +CSRV E++H   F  P + PN  +I
Sbjct  502  LNGDVYLPHDSCFFCSRVAEVIHHLNFASPGKLPNFKNI  540

>H257_13938
Length=254

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 25/48 (52%), Gaps = 6/48 (13%)

Query  133  HRYSAFRALRKAISDVVRVSKDKSHARW-CPYCSRVRELVHSSIFPPR  179
            HRYS F  LRK + +V+ V     HAR  CP C  V   V    FPPR
Sbjct  79   HRYSDFYRLRKTVLEVLSV-----HARMGCPVCQTVHAQVKKFDFPPR  121

>PYAR_25409
Length=229

 Score = 35.0 bits (79),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 35/65 (54%), Gaps = 6/65 (9%)

Query  117  KSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW-CPYCSRVRELVHSSI  175
            + + +   R PDY +  R+S F +LR  ISD++ ++     AR+ C YC+   E +   +
Sbjct  92   RRRTTQTSRAPDYQIGARFSDFASLRSEISDLLCMN-----ARFTCEYCNTFNEFIKFRV  146

Query  176  FPPRF  180
              PR+
Sbjct  147  AQPRW  151

>PHYKE_7012
Length=439

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query  103  VDVFMQSTLKGIA--KKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW  160
            +DV+++     I   K+ + S  DR PDY ++ R+S F  LR  +    + S D   A  
Sbjct  55   LDVYLKHHTNRIPTNKRLEASRSDR-PDYTIQKRFSDFANLRYQVWSYAQRSHDGGSA--  111

Query  161  CPYCSRVRELVHSSIFPPRF  180
            C YCS+  + + +S   PR 
Sbjct  112  CRYCSKNMDFLVTSFSQPRL  131

>PYU1_G003220
Length=353

 Score = 35.0 bits (79),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 6/42 (14%)

Query  125  RTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW--CPYC  164
            R PD+ +EHRYS+F  LR  +  + R    K H R   C YC
Sbjct  239  RVPDFQIEHRYSSFARLRANVWQIAR----KRHRRGQSCSYC  276

>PYAP_19831
Length=258

 Score = 34.7 bits (78),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query  117  KSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC  164
            KS    ++R PDY V+ R+S F  LR  + + V+     +H  +C +C
Sbjct  122  KSSVHCENRKPDYTVQRRFSEFDNLRNQLWECVQ----HTHRHYCSFC  165

>PHYKE_7014
Length=182

 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 2/78 (3%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCP  162
            +DVF++     I    K S     PDY +E R++ F  LR  +   V   +       C 
Sbjct  48   LDVFLEHNTSRIPTNKKASKTANRPDYQLERRFNDFANLRYQV--WVYAQRKHQDDCMCN  105

Query  163  YCSRVRELVHSSIFPPRF  180
            YCS     +  S+  PR 
Sbjct  106  YCSTFMSYIVHSMSQPRL  123

>PYIR_15855
Length=205

 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (46%), Gaps = 5/74 (7%)

Query  108  QSTLKGIAKKSK-CSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSR  166
            Q+T    +K SK  S  +R PDY +E R++ F   R      V V   K+H   C YC  
Sbjct  73   QNTNLNTSKTSKNTSKINRKPDYQLEKRFTDFADFRYQ----VWVYAQKNHGCKCAYCDE  128

Query  167  VRELVHSSIFPPRF  180
              + +  S+  PR 
Sbjct  129  FMDFIVYSMAQPRL  142

>PYVX_15873
Length=552

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (68%), Gaps = 3/28 (11%)

Query  371  PIEFLFFMGCPDDSS---REIGYLRARP  395
            P+EFLFF GCPDDS+    E+   R RP
Sbjct  189  PMEFLFFSGCPDDSNLYRLEMNQHRRRP  216

 Score = 32.3 bits (72),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (53%), Gaps = 5/51 (10%)

Query  371  PIEFLFFMGCPDD---SSREIGYLRARPKSRSARNTAT--PSFATAIATTI  416
            P+EFLFF  CPDD   ++ EI   R R    S   TA   PS AT+   +I
Sbjct  480  PMEFLFFPSCPDDLVVNTLEINQFRRRANIASGGATAQSEPSAATSDLDSI  530

>PHYCA_532926
Length=337

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 36/81 (44%), Gaps = 8/81 (10%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYC----VEHRYSAFRALRKAISDVVRVSKDKSHA  158
            +DVF+      +      S ++R  + C    VE R+S F  LRK +S  V + +  S  
Sbjct  201  LDVFLSKPTSRLPVSKSNSNEERVAEACPTFKVERRFSDFEELRKNVSSCVSMERQCS--  258

Query  159  RWCPYCSRVRELVHSSIFPPR  179
              C YC +  E +  S   PR
Sbjct  259  --CQYCLKYVEYIRFSSTQPR  277

>PPTG_12353
Length=295

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 35/69 (51%), Gaps = 9/69 (13%)

Query  126  TPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVREL--VHSSIFPPRFPNH  183
            T D+ V  RYS FRAL +A+      +  K H    P CS   EL   +SS+   RFP+ 
Sbjct  51   TADWYVAKRYSEFRALHEALQRQCTGNGSKQH----PSCSACEELESFYSSV---RFPDR  103

Query  184  NSIATVMGV  192
            +   + +G+
Sbjct  104  HIFQSGLGI  112

>PYVX_15645
Length=190

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 38/80 (48%), Gaps = 4/80 (5%)

Query  103  VDVFMQSTLKGI-AKKSKCSTDDRT-PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW  160
            +DVF++     I   KS+ +   R  PDY VEHR++ F  LR  +    +  +  + ++ 
Sbjct  55   LDVFLEHHSSRIPTNKSRETKMSRVMPDYKVEHRFNDFADLRYQVWSYAQ--RQHAGSKG  112

Query  161  CPYCSRVRELVHSSIFPPRF  180
            C YC      +  S+  PR 
Sbjct  113  CAYCDEYMRFIVHSMSQPRL  132

>PYVX_15877
Length=240

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  111  LKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYC  164
            ++G  K  +    D+TP Y +E RYSAF  LR  +   V + +     R CPYC
Sbjct  114  VQGEDKLGQIPPTDQTPTYQIERRYSAFDRLRSLVD--VWLHEALPLCR-CPYC  164

>PYIR_21555
Length=233

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 25/53 (47%), Gaps = 4/53 (8%)

Query  127  PDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPR  179
            PD+ VE R+S F  LR  +SD   ++ D      C YC+     V   +  PR
Sbjct  110  PDFQVERRFSEFVKLRSQVSDATLINMDC----MCSYCAEFSMYVRFKMQQPR  158

>PYIR_21554
Length=206

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query  126  TPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPR  179
            +PD+ +E R+S F  LR  +SD   +  D      C YC+     +  S+  PR
Sbjct  85   SPDFQIERRFSEFVKLRNQVSDATLLKLDC----VCAYCAEFSMFLSFSMHQPR  134

>PITG_08603
Length=183

 Score = 32.7 bits (73),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 32/77 (42%), Gaps = 2/77 (3%)

Query  102  GVDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWC  161
             VDVF+      I   +  + +   PDY V HR+S F  LR       +   +  H   C
Sbjct  51   AVDVFLLHHTSRIPTHNTPTANASRPDYQVLHRFSQFADLRYQAWIYAQRKHEDGHI--C  108

Query  162  PYCSRVRELVHSSIFPP  178
             YCS+    +  S+  P
Sbjct  109  KYCSKYMHFILYSLSQP  125

>PITG_11258
Length=189

 Score = 32.7 bits (73),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 3/79 (4%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDR-TPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWC  161
            +DV+ +     I    +     R  PDY V+ R+S F  LR  +    +   D   A  C
Sbjct  55   IDVYRKHHTNRIPTNKRLEASRRDQPDYTVQKRFSDFSNLRYQMWSYAQRQHDGGAA--C  112

Query  162  PYCSRVRELVHSSIFPPRF  180
             YCS+  + + +S   PR 
Sbjct  113  KYCSKNMDFLVTSFSQPRL  131

>PHALS_13173
Length=348

 Score = 33.1 bits (74),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 1/51 (2%)

Query  129  YCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPR  179
            +C+ HR+S FRALR  +   +  SK +     CP C  V   + +  FP R
Sbjct  171  WCIVHRFSEFRALRLQLIKHLSRSKRRRQP-HCPICDNVLTSIVNGAFPSR  220

>PYAP_18966
Length=319

 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 31/65 (48%), Gaps = 3/65 (5%)

Query  128  DYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH---SSIFPPRFPNHN  184
            ++ V  RYS FR L  A+ D +    + S  R    C++ REL     S  FP RF   +
Sbjct  45   EWYVARRYSEFRTLHLALRDALDSPHEASRLRTTKGCAQCRELARHYGSVGFPSRFRVRS  104

Query  185  SIATV  189
              A+V
Sbjct  105  GFASV  109

>PYU1_G003202
Length=238

 Score = 32.3 bits (72),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query  118  SKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFP  177
            S+ + +D  PDY VE R+S F  LR+++ D   VSK+      C +CS   E V  +   
Sbjct  114  SRVAREDAQPDYQVERRFSEFCELRQSVYD--SVSKNPHFN--CRHCSVFVEYVRFNGRQ  169

Query  178  PR  179
            PR
Sbjct  170  PR  171

>PYIW_25446
Length=206

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (47%), Gaps = 3/58 (5%)

Query  123  DDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW--CPYCSRVRELV-HSSIFP  177
            D   PD+ V H YS F  LRK +S +      K+  R   C +C  + E + H S  P
Sbjct  77   DAYEPDFEVLHHYSEFVKLRKKLSGIATEVHAKTELRHSGCAFCKPLLEFLNHDSTRP  134

>SDRG_12188
Length=256

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 26/56 (46%), Gaps = 8/56 (14%)

Query  131  VEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            V HRYS F  LRK I D + +    S    C YC    + +H  I    FP  +SI
Sbjct  78   VCHRYSEFHRLRKRILDQLEIHMKMS----CAYC----KALHGQIAKFDFPGRSSI  125

>PYU1_G003201
Length=238

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 29/66 (44%), Gaps = 4/66 (6%)

Query  115  AKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSS  174
            A   +   + R PDY VEHRYS F  LR+   D   ++        C YC+     +   
Sbjct  104  ALAQQTPVEGRKPDYQVEHRYSEFSLLREQAFDWSCMNPQFV----CDYCNEFIIYIRFE  159

Query  175  IFPPRF  180
            +  PRF
Sbjct  160  LCQPRF  165

>PYIW_18764
Length=213

 Score = 32.0 bits (71),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 38/100 (38%), Gaps = 16/100 (16%)

Query  103  VDVFMQ------------STLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVR  150
            VDV++Q             T   I++K         PDY +E R+S F   R      V 
Sbjct  59   VDVYLQYFTSRIPTNQQKQTTASISQKKTQHLRREKPDYQLEKRFSDFADFRYH----VW  114

Query  151  VSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSIATVM  190
            V   K+H   C YC    + +  S+  PR     +  T M
Sbjct  115  VFAQKNHGCKCAYCDEFMDYIVHSLSQPRLLVRLATTTAM  154

>PHYRA_86089
Length=196

 Score = 32.0 bits (71),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 5/66 (8%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCP  162
            +DV+++  L  I   +K   + + PD+ V  R+S F  LR+ ++     +  +     CP
Sbjct  60   LDVYVRHQLSRIPTNNKQHLEQK-PDFRVLRRFSEFETLRERVT----AASQQQLMATCP  114

Query  163  YCSRVR  168
            YC  +R
Sbjct  115  YCDSIR  120

>PYU1_G003215
Length=208

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 31/60 (52%), Gaps = 9/60 (15%)

Query  107  MQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARW-CPYCS  165
            + S L     +  C+T    PDY +E R+S FR LR+ I +        ++ R+ CP+C+
Sbjct  88   LSSNLAKTKTQLSCTTR---PDYQIERRFSEFRRLREQIFEAA-----ATNMRFRCPHCN  139

>PHYSO_315355
Length=190

 Score = 31.6 bits (70),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 3/77 (4%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCP  162
            V+VF+Q ++  I      +  D  PDY +E R+S F  LR  +   +   +     + C 
Sbjct  54   VEVFLQHSMSRIPTVKATAVADH-PDYQLERRFSDFANLRYQVW--MYAQRKHEDDQSCE  110

Query  163  YCSRVRELVHSSIFPPR  179
            YC      +  S+  PR
Sbjct  111  YCGEFMSYIVHSLSQPR  127

>H310_08756
Length=353

 Score = 32.3 bits (72),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 14/86 (16%)

Query  102  GVDVFMQSTLKGIAKK--SKCSTDDRTP------DYCVEHRYSAFRALRKAISDVVRVSK  153
            G+ VF+ + LK  +      C   D TP      ++ V  RYS F  LR+ I   +++S+
Sbjct  24   GIVVFIPAALKRPSHTLYCICVKVDETPHGGGCAEWSVNRRYSQFLELRRQILLFLQLSQ  83

Query  154  DKSHARWCPYCSRVRELVHSSIFPPR  179
                   CP C  +   V S  FPP+
Sbjct  84   T------CPGCQSMARAVGSFPFPPK  103

>PHYRA_78852
Length=399

 Score = 32.0 bits (71),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 5/66 (8%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCP  162
            +DV+++  L  I   +K   + + PD+ V  R+S F  LR+ ++     +  +     CP
Sbjct  263  LDVYVRHQLSRIPTNNKQHLEQK-PDFRVLRRFSEFETLRERVT----AASQQQLMATCP  317

Query  163  YCSRVR  168
            YC  +R
Sbjct  318  YCDSIR  323

>PHYCA_121843
Length=183

 Score = 31.6 bits (70),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 21/79 (27%), Positives = 31/79 (39%), Gaps = 2/79 (3%)

Query  102  GVDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWC  161
             +DVF+      I   +  +     PDY V HR+S F  LR      V   +       C
Sbjct  51   ALDVFLLHHTSRIPTLNTPTASASHPDYQVLHRFSDFAHLR--YQAWVYAQRKHEDGHIC  108

Query  162  PYCSRVRELVHSSIFPPRF  180
             YC++    +  S+  PR 
Sbjct  109  KYCNKYMHFILYSLAQPRL  127

>H257_12581
Length=213

 Score = 31.6 bits (70),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query  129  YCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFP  181
            Y V+ RYS F  LR  +  +V           CP+CS    +V S  FP R P
Sbjct  42   YSVQRRYSHFYELRNQLVAIVNWGH-------CPFCSHCCSVVKSYPFPKRTP  87

>PYAR_23128
Length=225

 Score = 31.6 bits (70),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 26/56 (46%), Gaps = 5/56 (9%)

Query  126  TPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVH-SSIFPPRF  180
             PD  +E R+S F  LR  +S    V  +  H  +C YC    + +  SSI P  F
Sbjct  89   VPDLVIERRFSEFEKLRNTLS----VCFENLHPGYCSYCDTFIDFLSCSSIQPGLF  140

>PHYRA_96703
Length=671

 Score = 32.3 bits (72),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 2/78 (3%)

Query  103  VDVFMQSTLKGIAKKSKCSTDDRTPDYCVEHRYSAFRALRKAISDVVRVSKDKSHARWCP  162
            +DVF+      I   +  +     PDY V HR+S F  LR       +   +  H   C 
Sbjct  51   LDVFLLHHTSRIPTLNTPTASASRPDYQVLHRFSEFADLRYQAWVYAQRKHEDGHI--CK  108

Query  163  YCSRVRELVHSSIFPPRF  180
            YCS+    +  S+  PR 
Sbjct  109  YCSKYMHFILYSLSQPRL  126

>SPRG_11770
Length=259

 Score = 31.6 bits (70),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 26/56 (46%), Gaps = 8/56 (14%)

Query  131  VEHRYSAFRALRKAISDVVRVSKDKSHARWCPYCSRVRELVHSSIFPPRFPNHNSI  186
            V HRYS F  LRK I D + +    S    C YC    + +H  I    FP  +SI
Sbjct  78   VCHRYSEFHRLRKRILDQLEIHMKMS----CAYC----KALHGQIAKFDFPGRSSI  125

Lambda      K        H        a         alpha
   0.320    0.131    0.406    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 29359116900

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40