Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_0000661281286702e-91
PHYCA_1025626783591045044e-63
PHYCA_11214141631266863905e-47
PITG_068444024373542573e-29
PPTG_0319818892205872371e-24
PPTG_20068678361872353e-23
PHYCA_9858940243146722112e-21
PPTG_0348119059351872187e-21
PITG_2194816976201742003e-19
PITG_00752678221742004e-19
PITG_1548812503142741885e-18
PITG_174201396390621838e-18
PITG_136521108181671551e-13
PITG_194391540081751523e-13
PHYCA_734321108177491411e-11
PYIW_2554416508787831351e-10
PHYRA_7775182930636964e-04
PITG_0093682932035946e-04
HYAP_0617482931035920.001
HYAP_061756403531035920.001
PYIW_249668224238057920.001
PHYSO_47101882931535910.001
PYU1_G00205482936635920.002
PHALS_0226682930835910.002
PYAP_1855182935135900.002
PPTG_1042782931935890.003
PYIW_168149648031763890.003
PHYCA_11557982931636880.005
PYU1_G0115629648015142840.010
HYAP_14406960138294800.046
PITG_09368775315453730.28
PYIW_1611116424122749710.69
PPTG_175992399021142691.3
PHYSO_4542851697618244645.5
PPTG_074151488155174646.9
PITG_186581488134474647.0
PYAP_22803100566241122637.4
PHYRA_857231488119874638.0
CCI40676670520036629.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00006

Length=128
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00006                                                            262        2e-91
PHYCA_102562                                                          198        4e-63
PHYCA_112141                                                          154        5e-47
PITG_06844                                                            103        3e-29
PPTG_03198                                                            95.9       1e-24
PPTG_20068                                                            95.1       3e-23
PHYCA_98589                                                           85.9       2e-21
PPTG_03481                                                            88.6       7e-21
PITG_21948                                                            81.6       3e-19
PITG_00752                                                            81.6       4e-19
PITG_15488                                                            77.0       5e-18
PITG_17420                                                            75.1       8e-18
PITG_13652                                                            64.3       1e-13
PITG_19439                                                            63.2       3e-13
PHYCA_73432                                                           58.9       1e-11
PYIW_25544                                                            56.6       1e-10
PHYRA_77751                                                           41.6       4e-04
PITG_00936                                                            40.8       6e-04
HYAP_06174                                                            40.0       0.001
HYAP_06175                                                            40.0       0.001
PYIW_24966                                                            40.0       0.001
PHYSO_471018                                                          39.7       0.001
PYU1_G002054                                                          40.0       0.002
PHALS_02266                                                           39.7       0.002
PYAP_18551                                                            39.3       0.002
PPTG_10427                                                            38.9       0.003
PYIW_16814                                                            38.9       0.003
PHYCA_115579                                                          38.5       0.005
PYU1_G011562                                                          37.0       0.010
HYAP_14406                                                            35.4       0.046
PITG_09368                                                            32.7       0.28 
PYIW_16111                                                            32.0       0.69 
PPTG_17599                                                            31.2       1.3  
PHYSO_454285                                                          29.3       5.5  
PPTG_07415                                                            29.3       6.9  
PITG_18658                                                            29.3       7.0  
PYAP_22803                                                            28.9       7.4  
PHYRA_85723                                                           28.9       8.0  
CCI40676                                                              28.5       9.2  

>PITG_00006
Length=128

 Score = 262 bits (670),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  1    MSSSTPLEQPSVAATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRT  60
            MSSSTPLEQPSVAATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRT
Sbjct  1    MSSSTPLEQPSVAATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRT  60

Query  61   ACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVEARAAGISDRKTSEACQT  120
            ACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVEARAAGISDRKTSEACQT
Sbjct  61   ACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVEARAAGISDRKTSEACQT  120

Query  121  KHYVSAPQ  128
            KHYVSAPQ
Sbjct  121  KHYVSAPQ  128

>PHYCA_102562
Length=359

 Score = 198 bits (504),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 99/104 (95%), Gaps = 0/104 (0%)

Query  1    MSSSTPLEQPSVAATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRT  60
            MSSSTP +QPSVAATTAS+ GEREKAKPLL IDELL+DESQSIE+TETGLLAFGAKQLRT
Sbjct  1    MSSSTPFDQPSVAATTASEHGEREKAKPLLSIDELLFDESQSIEDTETGLLAFGAKQLRT  60

Query  61   ACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVEA  104
            ACYCRQLRIVKSGAECND KLGYVALLMKLKRAYAEMQ+LHVE 
Sbjct  61   ACYCRQLRIVKSGAECNDNKLGYVALLMKLKRAYAEMQQLHVEG  104

>PHYCA_112141
Length=266

 Score = 154 bits (390),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 78/86 (91%), Gaps = 0/86 (0%)

Query  19   DQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECND  78
            + GEREKAKPLL IDELL+DESQS E+TETGLLAFGAKQLRT CYCRQLRIVKSGAECN 
Sbjct  34   EHGEREKAKPLLSIDELLFDESQSNEDTETGLLAFGAKQLRTTCYCRQLRIVKSGAECNG  93

Query  79   KKLGYVALLMKLKRAYAEMQELHVEA  104
             KLGYVALLMKLKRAYAEMQ+L VE 
Sbjct  94   NKLGYVALLMKLKRAYAEMQQLQVEG  119

>PITG_06844
Length=73

 Score = 103 bits (257),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 51/54 (94%), Gaps = 0/54 (0%)

Query  50   LLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVE  103
            LLAFGAKQLR ACYCRQLRIVKSGAECND KLGYVALLMKLKRAYA+MQ+L VE
Sbjct  2    LLAFGAKQLRAACYCRQLRIVKSGAECNDSKLGYVALLMKLKRAYAKMQQLQVE  55

>PPTG_03198
Length=205

 Score = 95.9 bits (237),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 59/87 (68%), Gaps = 6/87 (7%)

Query  32   IDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLK  91
            I ++L+D + + E+ E  L  FGAKQLRT CY RQLRIVK G++CND K+GYVALLM+ K
Sbjct  14   IADILFDATVTPEDAEAKLTTFGAKQLRTECYLRQLRIVKKGSDCNDHKVGYVALLMQQK  73

Query  92   RAYAEMQELHVE------ARAAGISDR  112
            R + EMQ L VE        AAGI  R
Sbjct  74   RVFTEMQRLGVEDGPSKIPVAAGIKRR  100

>PPTG_20068
Length=361

 Score = 95.1 bits (235),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 6/87 (7%)

Query  32   IDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLK  91
            I ++L+D + + E+ E  L  FGAKQLRT CY RQLRIVK G +CND K+GYVALLM+ K
Sbjct  14   IADILFDATVTPEDAEAKLTTFGAKQLRTECYLRQLRIVKKGPDCNDHKVGYVALLMQQK  73

Query  92   RAYAEMQELHVE------ARAAGISDR  112
            R + EMQ L VE        AAGI  R
Sbjct  74   RVFTEMQRLGVEDGPSKIPVAAGIKRR  100

>PHYCA_98589
Length=146

 Score = 85.9 bits (211),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)

Query  32   IDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLK  91
            I +++Y+ + ++E  E+ L+AFGAKQLRT  Y RQLRIVK G + ND K GYVALLM+ K
Sbjct  28   IADVMYNGTMNLEEAESCLMAFGAKQLRTERYLRQLRIVKKGPDANDHKSGYVALLMQQK  87

Query  92   RAYAEMQELHVE  103
            R ++EMQ L VE
Sbjct  88   RMFSEMQRLGVE  99

>PPTG_03481
Length=351

 Score = 88.6 bits (218),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 6/87 (7%)

Query  32   IDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLK  91
            I ++L+D + + E+ E  L  FGAKQLRT CY RQLRI K G +CND K+GYV LLM+ K
Sbjct  4    IADILFDATVTSEDAEAKLTTFGAKQLRTECYLRQLRIAKKGIDCNDHKIGYVGLLMRQK  63

Query  92   RAYAEMQELHVE------ARAAGISDR  112
            R + E Q L VE        AAGI  R
Sbjct  64   RVFTEKQRLGVEDGPSKILGAAGIKRR  90

>PITG_21948
Length=201

 Score = 81.6 bits (200),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 3/74 (4%)

Query  51   LAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVE---ARAA  107
            +AFGAKQLRT CY RQLRIVK G + ND K GYVALLM+ KRA++EMQ L VE   A   
Sbjct  1    MAFGAKQLRTECYLRQLRIVKKGPDANDHKSGYVALLMQQKRAFSEMQRLGVEEGPAERG  60

Query  108  GISDRKTSEACQTK  121
             + +++ +  C  +
Sbjct  61   VVGNKRRTRHCMLR  74

>PITG_00752
Length=221

 Score = 81.6 bits (200),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 3/74 (4%)

Query  51   LAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVE---ARAA  107
            +AFGAKQLRT CY RQLRIVK G + ND K GYVALLM+ KRA++EMQ L VE   A   
Sbjct  1    MAFGAKQLRTECYLRQLRIVKKGPDANDHKSGYVALLMQQKRAFSEMQRLGVEEGPAERG  60

Query  108  GISDRKTSEACQTK  121
             + +++ +  C  +
Sbjct  61   VVGNKRRTRHCMLR  74

>PITG_15488
Length=142

 Score = 77.0 bits (188),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 50/74 (68%), Gaps = 3/74 (4%)

Query  51   LAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVE---ARAA  107
            +AFGAKQLRT CY RQLRIVK G + ND K GYVALLM+ K A++EMQ L VE   A+  
Sbjct  1    MAFGAKQLRTECYLRQLRIVKRGPDANDHKSGYVALLMQQKPAFSEMQRLGVEEGPAKRG  60

Query  108  GISDRKTSEACQTK  121
             +  ++ +  C  +
Sbjct  61   VVGSKRRTRHCMLR  74

>PITG_17420
Length=90

 Score = 75.1 bits (183),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)

Query  42   SIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELH  101
            ++E  E+ L+AF AKQLRT CY RQL IVK G + ND K G VALLM+ KRA++EMQ L 
Sbjct  2    NLEEAESCLMAFEAKQLRTECYLRQLGIVKKGPDANDHKSGCVALLMQQKRAFSEMQRLG  61

Query  102  VE  103
            VE
Sbjct  62   VE  63

>PITG_13652
Length=81

 Score = 64.3 bits (155),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query  14  ATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSG  73
           AT  SD G    A     I +++Y+ + ++E  ++ L+AFGAKQLRT CY RQLRIVK G
Sbjct  13  ATATSDGGIPATAS---TIGDVMYNGTMNLEEADSCLMAFGAKQLRTECYLRQLRIVKKG  69

Query  74  AECNDKK  80
            + ND K
Sbjct  70  PDANDHK  76

>PITG_19439
Length=81

 Score = 63.2 bits (152),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%)

Query  7   LEQPSVAATTA-SDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRTACYCR  65
           L  P+   TTA SD G    A     I +++Y+ + ++E  ++ L+AFGAKQLRT CY R
Sbjct  5   LPSPTAPPTTATSDGGIPATAS---TIGDVMYNGTMNLEEADSCLMAFGAKQLRTECYLR  61

Query  66  QLRIVKSGAECNDKK  80
           QLRIVK   + ND K
Sbjct  62  QLRIVKKDPDANDHK  76

>PHYCA_73432
Length=77

 Score = 58.9 bits (141),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)

Query  32  IDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKK  80
           I +++Y+ + ++E  E+ L+AFGAKQLRT  Y RQLRIVK G + ND K
Sbjct  28  IADVMYNGTMNLEEAESCLMAFGAKQLRTERYLRQLRIVKKGPDANDHK  76

>PYIW_25544
Length=87

 Score = 56.6 bits (135),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 5/83 (6%)

Query  25   KAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYV  84
            +AKP   + ++L+    SIE     L  F AK+LR+ CY  QL+I+++G++ ND K GY+
Sbjct  4    RAKP--SVQDVLF---TSIEQARAFLSEFTAKKLRSECYSMQLKIIQTGSDANDNKEGYI  58

Query  85   ALLMKLKRAYAEMQELHVEARAA  107
             +L+  K  Y  M    V+  AA
Sbjct  59   DMLVSTKGTYELMARQSVDIGAA  81

>PHYRA_77751
Length=306

 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKL  90
           A  LR  CY R LR +K G   ND K GY+ LL K 
Sbjct  43  AHDLRAECYRRGLRPIKKGPNANDNKSGYIDLLRKF  78

>PITG_00936
Length=320

 Score = 40.8 bits (94),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
           A +LR  CY R++R +K G   ND K GY+ LL +
Sbjct  47  AHELRAECYRRRIRPIKKGPNANDNKGGYIDLLRR  81

>HYAP_06174
Length=310

 Score = 40.0 bits (92),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
           A  LR  CY R LR +K G   ND K GY+ LL K
Sbjct  44  AHDLRAECYRRGLRPIKKGPNANDNKNGYIELLRK  78

>HYAP_06175
Length=310

 Score = 40.0 bits (92),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
           A  LR  CY R LR +K G   ND K GY+ LL K
Sbjct  44  AHDLRAECYRRGLRPIKKGPNANDNKNGYIELLRK  78

>PYIW_24966
Length=380

 Score = 40.0 bits (92),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (51%), Gaps = 8/57 (14%)

Query  53   FGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQELHVEARAAGI  109
            F + QLRT CY R    VK+G   N  K G++ LL +  RA A         RAAG+
Sbjct  28   FTSTQLRTECYRRGAPPVKTGPRANYTKAGFIELLRRTDRAAAN--------RAAGV  76

>PHYSO_471018
Length=315

 Score = 39.7 bits (91),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
           A  LR  CY R LR +K G   ND K GY+ LL +
Sbjct  44  AHDLRAECYRRGLRPIKKGPHANDNKGGYIELLRR  78

>PYU1_G002054
Length=366

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55   AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
            A  LR  CY R +R +K G   ND K GY+ LL K
Sbjct  73   AHDLRAECYRRGIRPIKKGPNANDNKNGYILLLRK  107

>PHALS_02266
Length=308

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
           A  LR  CY R +R +K G   ND K GY+ LL K
Sbjct  41  AHDLRAECYRRGIRPIKKGPNANDNKGGYIILLRK  75

>PYAP_18551
Length=351

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55   AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
            A  LR  CY R +R +K G   ND K GY+ LL K
Sbjct  76   AHDLRAECYRRGIRPIKKGPNANDNKNGYILLLRK  110

>PPTG_10427
Length=319

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMK  89
           A  LR  CY R +R +K G   ND K GY+ LL +
Sbjct  47  AHDLRAECYRRGIRPIKKGPNANDNKGGYIDLLRR  81

>PYIW_16814
Length=317

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 30/63 (48%), Gaps = 17/63 (27%)

Query  37   YDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAE  96
            YD  +SIE             LR  CY R  R  +SG + ND K GY+ALL    RAY  
Sbjct  60   YDHYKSIE-------------LRAECYRRGTRPTRSGPKANDNKAGYMALL----RAYDL  102

Query  97   MQE  99
             Q+
Sbjct  103  TQD  105

>PHYCA_115579
Length=316

 Score = 38.5 bits (88),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (53%), Gaps = 0/36 (0%)

Query  55  AKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKL  90
           A  LR  CY R +R  K G   ND K GY+ LL K 
Sbjct  45  AHDLRAECYRRGIRPTKKGPGANDNKGGYIELLRKF  80

>PYU1_G011562
Length=151

 Score = 37.0 bits (84),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  57   QLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQ  98
            +LR  CY R  R +++G + ND K GY+ LL    R+Y  +Q
Sbjct  75   ELRAECYRRGTRPIRTGPKANDNKAGYLTLL----RSYDVIQ  112

>HYAP_14406
Length=382

 Score = 35.4 bits (80),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 49/94 (52%), Gaps = 12/94 (13%)

Query  1   MSSSTPLEQP-SVAATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLR  59
           M+S++P+ +P S+ + +ASD  +R    P    D+   D ++++E        + +K+LR
Sbjct  1   MASTSPVARPESIVSASASDSAQRVLEFPPQASDD---DFAKALETN------YQSKKLR  51

Query  60  TACYCRQLRIVKSGAECNDKKLGYVALLMKLKRA  93
            AC   QL +        D K GY+ LL + +RA
Sbjct  52  AACT--QLGLNPRADPMMDHKNGYIKLLTQYRRA  83

>PITG_09368
Length=154

 Score = 32.7 bits (73),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 1/53 (2%)

Query  44  ENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAE  96
           E   + L  F AK+LR+AC    ++ V+S     D K+GY  +L++L R+  E
Sbjct  24  EEIRSFLTGFTAKELRSACRIYHVK-VRSKTANLDSKVGYENVLVELARSQRE  75

>PYIW_16111
Length=227

 Score = 32.0 bits (71),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query  52  AFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQEL  100
           A+ A  LRT CY   +R +K     N+ K GYV LL    R+Y  ++++
Sbjct  18  AYKANALRTECYRCDVRSMKKSPFLNNNKAGYVKLL----RSYDTVKQV  62

>PPTG_17599
Length=211

 Score = 31.2 bits (69),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 1/42 (2%)

Query  50   LLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLK  91
            L ++ AKQLR+AC  R L I +  +   D K G++ LL K +
Sbjct  71   LESYRAKQLRSACVKRSL-IPQRHSSTEDNKQGFINLLCKYR  111

>PHYSO_454285
Length=182

 Score = 29.3 bits (64),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query  56  KQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAYAEMQE  99
           K+LR+ C     + V+S     D K+GYV +L++L R+  E +E
Sbjct  1   KELRSVCKLFGAK-VRSKNGSTDNKMGYVTILVQLARSRRESEE  43

>PPTG_07415
Length=551

 Score = 29.3 bits (64),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 0/74 (0%)

Query  35   LLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAY  94
            LL D +  I   E  L    A  L T  + ++L  ++S    ND+KLG ++ + +L + Y
Sbjct  30   LLTDRNAYISFLEVQLERVSAACLTTQTFEKRLAELESAQMANDQKLGSLSKVFRLNQEY  89

Query  95   AEMQELHVEARAAG  108
             E      ++  AG
Sbjct  90   VEQISQQAQSELAG  103

>PITG_18658
Length=344

 Score = 29.3 bits (64),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 0/74 (0%)

Query  35   LLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAY  94
            LL D +  I   E  L    A  L T  + ++L  ++S    ND+KLG ++ + +L + Y
Sbjct  30   LLTDRNAYISFLEVQLERVSAACLSTQTFEKRLVELESSQMSNDQKLGSLSKVFRLNQEY  89

Query  95   AEMQELHVEARAAG  108
             E      ++  AG
Sbjct  90   VEQTSQQAQSELAG  103

>PYAP_22803
Length=241

 Score = 28.9 bits (63),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (46%), Gaps = 17/122 (14%)

Query  10   PSVAATTASDQGEREKAKPLLCIDELLYDESQSIENTETGLLAFGAKQLRTACYCRQLRI  69
            P+VA      + ER K K        + DE + I + E        K+ R A    +LR 
Sbjct  82   PTVAVPAWPARPERRKRK-------RMSDEERKIRHREVQRQFMKRKRARIA----ELRK  130

Query  70   VKSGAECNDKKLGYVALLMK---LKRAYAEMQELHVEARAAGISDRKTSEACQTKHYVSA  126
            V SG E   K+L  V +L +   LK+   +++E H  A+++ ++   T  A ++  ++  
Sbjct  131  VLSGVE---KQLRLVTVLHEIEMLKKENEDLREQHESAQSSPVTSTSTDSAERSFSFMLT  187

Query  127  PQ  128
            P+
Sbjct  188  PE  189

>PHYRA_85723
Length=198

 Score = 28.9 bits (63),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (46%), Gaps = 0/74 (0%)

Query  35   LLYDESQSIENTETGLLAFGAKQLRTACYCRQLRIVKSGAECNDKKLGYVALLMKLKRAY  94
            LL D +  I   E  L    A  L T  + R+L  ++S    ND+K+G ++ + +L + Y
Sbjct  18   LLTDRNAYISFLEVQLERVSAACLTTQTFERRLSELESTQLANDQKVGSLSKVFRLNQEY  77

Query  95   AEMQELHVEARAAG  108
             E      +   AG
Sbjct  78   VEQTTQQTQNELAG  91

>CCI40676
Length=200

 Score = 28.5 bits (62),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  1   MSSSTPLEQPSVAATTASDQGEREKAKPLLCIDELL  36
           +S S+P + P+VA   +  Q   + AK   CID+LL
Sbjct  13  LSMSSPAQGPTVADQYSKSQSRGQTAKTDSCIDDLL  48

Lambda      K        H        a         alpha
   0.313    0.125    0.348    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3356835360

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40