Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_00005549349325320.0
PPTG_161875232964054218120.0
PPTG_162011625965654114260.0
PITG_207671625966154813980.0
PITG_175761407066154813950.0
PPTG_161861407060854113910.0
PHYSO_5200721625966154513870.0
PPTG_161995233666655213730.0
PPTG_161881407965754513700.0
PHYRA_845511625963853913550.0
PHYCA_5639341625964554013520.0
PHYSO_3379665233666854313395e-179
PHYRA_845535233666454213282e-177
PHYCA_1072241408065055412976e-173
PPTG_161841408065656812925e-172
PHYSO_5184415941266355412873e-171
PHYSO_2531951408067755912711e-168
PITG_175861408068655112651e-167
PITG_175851407965554712508e-166
PHYRA_8455959412265055113211e-162
HYAP_144401625964754412281e-162
PHYSO_5200171407966154712213e-161
PPTG_161855941263254512071e-159
PHYSO_3379525232961953811643e-153
PHYKE_31625959848511613e-153
PITG_00004461453711303e-148
PHYSO_5200645951166956910675e-138
PHYSO_519624745766956910675e-138
PHYSO_4850445725566956910675e-138
PHYRA_845555951166356310353e-133
PITG_207661625870457710053e-128
PPTG_16198609046565619901e-126
PHYSO_563952609046675719883e-126
PHYSO_483581571766675719874e-126
PPTG_16193721046805689651e-122
PPTG_16190140776415619523e-121
PPTG_16192595116375409499e-121
PHYCA_533390594124832999351e-120
PHYRA_84557140776435729481e-120
PHYRA_84554721046865969521e-120
PHYSO_337957140716565629473e-120
PHYSO_325252504676565629464e-120
HYAP_14439683024144039161e-118
PHYCA_107484411523432949063e-118
PHYSO_520885140776234929261e-117
PHYCA_107239140766495599203e-116
PHYCA_543946140773142918112e-104
PITG_17578140724813058107e-102
PHYSO_337956140705632918107e-101
PHYSO_337950721045755198047e-100
PHYSO_337967162586772918092e-99
PITG_17577140715102917944e-99
PHYRA_84552162587042828061e-98
PPTG_16200162587452917984e-97
PHYSO_253201461895405027555e-93
PHYSO_337959140726424967565e-92
PITG_17583140775504497434e-91
PHYSO_520398140766792967002e-83
PHYRA_84558140784152816723e-82
PITG_17582140767072796847e-81
HYAP_14441140768322966901e-80
PPTG_01981184913673606562e-80
PPTG_16191140768772796893e-80
PHYRA_84556140768173046855e-80
CCI41501162586805606495e-76
PPTG_16189140784372796265e-75
PITG_17584140784042716226e-75
CCA19358162586825606139e-71
PPTG_09878212636125465983e-69
PHYKE_181366514693075851e-68
PHYSO_519978683026445475952e-68
PHYSO_337953140783772855728e-68
PITG_0796766514742745799e-68
PHYSO_56543366514722705744e-67
PPTG_0847366514732995745e-67
PHYCA_107365683022692815551e-66
PHYCA_51128266514652995657e-66
PHALS_0362666514952995625e-65
PHYRA_8127366514452715586e-65
PHYCA_119381101612912785422e-64
H310_076201298526285575672e-64
SPRG_083021262946475225663e-64
PPTG_16203140694032835485e-64
CCA2193666514352735506e-64
CCA247861565534352735506e-64
PPTG_17293101614172815461e-63
PPTG_0213292546652885577e-63
PHALS_00921114836312925532e-62
SPRG_142531298526102735522e-62
PHYCA_122066114833442925332e-62
PHYCA_51128766525152655452e-62
SDRG_051051298526105315512e-62
PITG_0796866525262655436e-62
H257_074771298526264805487e-62
PHYKE_942866525032775409e-62
PPTG_0847466525312655411e-61
SDRG_173421262946305145461e-61
PHYRA_84546140694062815303e-61
PHYCA_543949140701951925123e-61
PHYSO_341117114839002925544e-61
PPTG_09853114837612925495e-61
PHYRA_8127466525182695341e-60
PYAR_13094995074783005292e-60
PITG_14156114837472925432e-60
HYAP_0365866525222685288e-60
HYAP_14838114833232715121e-59
CCI4104166514132685191e-59
PHYRA_83716114839602925441e-59
PHYCA_129660431582892825082e-59
PHYSO_52902266525172685252e-59
PHYSO_520489595356082765293e-59
PHYCA_543955140711901894941e-58
PHYCA_50505054413822905101e-58
PPTG_0206643553052815032e-58
PHYRA_7886892549052855352e-58
PHYRA_80666711665553135193e-58
PITG_17575140697922615295e-58
PHYCA_118320421745272885122e-57
PHYCA_107158595111881584852e-57
PITG_17579609044723745082e-57
PITG_0896774565562835123e-57
PPTG_18534243535162925094e-57
HYAP_0172274575462855104e-57
PPTG_10355146735692865107e-57
PHYCA_509624444585672955098e-57
PHYCA_54332474482962824909e-57
PHYCA_10600174572972914901e-56
SPRG_0307573965652845072e-56
PPTG_2183374565793035072e-56
PHYCA_9190140143252764902e-56
PITG_0754963375452865043e-56
PHYCA_104618974702854994e-56
PHYRA_824988975582855054e-56
PITG_010178974682854985e-56
PPTG_14170995077682905127e-56
PHYCA_128924176865562835028e-56
SDRG_0088373965712845039e-56
PITG_0511243556992785099e-56
PHYRA_7737954417732905119e-56
PHYSO_324311503676232865051e-55
PITG_18347146735472865001e-55
PHYCA_50427643556962785072e-55
PPTG_10369214225582865002e-55
SPRG_030781235904942714962e-55
PPTG_10361705215642955002e-55
SDRG_050991298466202955032e-55
PPTG_10353705175262864982e-55
PHALS_0540943556982785062e-55
PHYCA_55944218092942864803e-55
SDRG_051041358986325215023e-55
PPTG_06854201544862884943e-55
PHYRA_778178855522864983e-55
PPTG_10350384385932844994e-55
HYAP_0592254417832905074e-55
PYU1_G014939845866632925034e-55
PITG_06480544118562905134e-55
PHYRA_72889467923652704845e-55
PHYSO_28907443555322794955e-55
PPTG_18615716756053164995e-55
PHYSO_518438140692412394735e-55
PHYSO_413418550203182834796e-55
PHYKE_224743555262814946e-55
PHYCA_56389162584703794907e-55
PHYSO_354036534964372934887e-55
PHYCA_569895454833192834798e-55
PHYCA_4583563374422774889e-55
PHYSO_515035142614972674901e-54
PHYRA_77814705175652864941e-54
PHYSO_421999146732942784751e-54
PHYSO_522417544118382905092e-54
PHYRA_806655223111433075082e-54
PHYCA_117114420905462834922e-54
PHYRA_95777199203142824752e-54
PHYSO_474546705175332934912e-54
PPTG_2258989710092775062e-54
PHYCA_570506467923512754773e-54
PHYSO_260691467924862724873e-54
PHYCA_56257418625422924904e-54
PHYRA_7969174575883124924e-54
PHYSO_415772705214962804874e-54
PPTG_103708855652864914e-54
PHYSO_47768563375262894884e-54
PHYSO_48648992547962604995e-54
H310_0950566514272824815e-54
PHYRA_77670138235872834907e-54
CCA1915243557202884968e-54
PITG_17357139105552814888e-54
PHYCA_547243451743672854759e-54
SDRG_008861235904942714849e-54
PPTG_06851201512782664689e-54
PHYSO_472133138235882984881e-53
PPTG_11455218096022944882e-53
PYVX_22303604035492844852e-53
HYAP_0172574483792744732e-53
PITG_17252138235873704863e-53
PHYRA_83084717104943084813e-53
PHYCA_1226938855623654843e-53
PHYRA_77819146725572864843e-53
H310_071241399146464934883e-53
PHYCA_10511052943273174684e-53
PHYSO_41855773964152804744e-53
PPTG_10354146725312774815e-53
HYAP_0566143556982784895e-53
PHYCA_126097428343802784715e-53
PHYRA_93564534963162864665e-53
PPTG_07736439684312844755e-53
PHALS_058365817323064906e-53
SDRG_076201244364922794786e-53
PHYKE_960018623332834667e-53
H257_137991244015102844788e-53
H257_159181455803852794708e-53
PYVX_1795154426754744878e-53
HYAP_0173273963722814699e-53
PHYRA_8284743556962784871e-52
PPTG_01911184732462274581e-52
SPRG_0785566514202814711e-52
PPTG_2183274575542914801e-52
PHYRA_81021503676094414821e-52
PITG_17831142614972624761e-52
PHYSO_534637176865702854801e-52
PHYCA_503450439684522874732e-52
PPTG_11276176865522854792e-52
PITG_1078088744572754732e-52
PPTG_11454503676122864822e-52
PPTG_067174315812372714932e-52
H257_137911444475063104762e-52
PHYCA_112396416563702864672e-52
H310_077961444554892824752e-52
PHYCA_5705055814722894742e-52
PPTG_1414052944772944742e-52
PHALS_0963418623532734652e-52
PHYRA_77816214225422954782e-52
PHYSO_4765968895352864772e-52
PITG_010028855552864782e-52
PHYRA_955881768615772824932e-52
PHYRA_82925716756112924812e-52
PHYCA_503455439704692874732e-52
PHYCA_547239451733912854673e-52
PHYCA_10604573945632914773e-52
PITG_17495140145292734754e-52
PHYCA_56899888744582744704e-52
PPTG_09207140146552764805e-52
PHYRA_7629488744782814715e-52
H257_1742266514262714676e-52
PHYSO_53994418624632814696e-52
PITG_1123692547272624827e-52
PHYRA_845491406710482804879e-52
PHALS_13547138235463674731e-51
PITG_0896874575553184731e-51
PHALS_1294654416762924791e-51
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00005

Length=493
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00005                                                            979        0.0   
PPTG_16187                                                            702        0.0   
PPTG_16201                                                            553        0.0   
PITG_20767                                                            543        0.0   
PITG_17576                                                            541        0.0   
PPTG_16186                                                            540        0.0   
PHYSO_520072                                                          538        0.0   
PPTG_16199                                                            533        0.0   
PPTG_16188                                                            532        0.0   
PHYRA_84551                                                           526        0.0   
PHYCA_563934                                                          525        0.0   
PHYSO_337966                                                          520        5e-179
PHYRA_84553                                                           516        2e-177
PHYCA_107224                                                          504        6e-173
PPTG_16184                                                            502        5e-172
PHYSO_518441                                                          500        3e-171
PHYSO_253195                                                          494        1e-168
PITG_17586                                                            491        1e-167
PITG_17585                                                            486        8e-166
PHYRA_84559                                                           513        1e-162
HYAP_14440                                                            477        1e-162
PHYSO_520017                                                          474        3e-161
PPTG_16185                                                            469        1e-159
PHYSO_337952                                                          452        3e-153
PHYKE_3                                                               451        3e-153
PITG_00004                                                            439        3e-148
PHYSO_520064                                                          415        5e-138
PHYSO_519624                                                          415        5e-138
PHYSO_485044                                                          415        5e-138
PHYRA_84555                                                           403        3e-133
PITG_20766                                                            391        3e-128
PPTG_16198                                                            385        1e-126
PHYSO_563952                                                          385        3e-126
PHYSO_483581                                                          384        4e-126
PPTG_16193                                                            376        1e-122
PPTG_16190                                                            371        3e-121
PPTG_16192                                                            370        9e-121
PHYCA_533390                                                          364        1e-120
PHYRA_84557                                                           369        1e-120
PHYRA_84554                                                           371        1e-120
PHYSO_337957                                                          369        3e-120
PHYSO_325252                                                          369        4e-120
HYAP_14439                                                            357        1e-118
PHYCA_107484                                                          353        3e-118
PHYSO_520885                                                          361        1e-117
PHYCA_107239                                                          358        3e-116
PHYCA_543946                                                          317        2e-104
PITG_17578                                                            316        7e-102
PHYSO_337956                                                          316        7e-101
PHYSO_337950                                                          314        7e-100
PHYSO_337967                                                          316        2e-99 
PITG_17577                                                            310        4e-99 
PHYRA_84552                                                           315        1e-98 
PPTG_16200                                                            311        4e-97 
PHYSO_253201                                                          295        5e-93 
PHYSO_337959                                                          295        5e-92 
PITG_17583                                                            290        4e-91 
PHYSO_520398                                                          274        2e-83 
PHYRA_84558                                                           263        3e-82 
PITG_17582                                                            268        7e-81 
HYAP_14441                                                            270        1e-80 
PPTG_01981                                                            257        2e-80 
PPTG_16191                                                            270        3e-80 
PHYRA_84556                                                           268        5e-80 
CCI41501                                                              254        5e-76 
PPTG_16189                                                            245        5e-75 
PITG_17584                                                            244        6e-75 
CCA19358                                                              240        9e-71 
PPTG_09878                                                            234        3e-69 
PHYKE_1813                                                            229        1e-68 
PHYSO_519978                                                          233        2e-68 
PHYSO_337953                                                          224        8e-68 
PITG_07967                                                            227        9e-68 
PHYSO_565433                                                          225        4e-67 
PPTG_08473                                                            225        5e-67 
PHYCA_107365                                                          218        1e-66 
PHYCA_511282                                                          222        7e-66 
PHALS_03626                                                           221        5e-65 
PHYRA_81273                                                           219        6e-65 
PHYCA_119381                                                          213        2e-64 
H310_07620                                                            223        2e-64 
SPRG_08302                                                            222        3e-64 
PPTG_16203                                                            215        5e-64 
CCA21936                                                              216        6e-64 
CCA24786                                                              216        6e-64 
PPTG_17293                                                            214        1e-63 
PPTG_02132                                                            219        7e-63 
PHALS_00921                                                           217        2e-62 
SPRG_14253                                                            217        2e-62 
PHYCA_122066                                                          209        2e-62 
PHYCA_511287                                                          214        2e-62 
SDRG_05105                                                            216        2e-62 
PITG_07968                                                            213        6e-62 
H257_07477                                                            215        7e-62 
PHYKE_9428                                                            212        9e-62 
PPTG_08474                                                            213        1e-61 
SDRG_17342                                                            214        1e-61 
PHYRA_84546                                                           208        3e-61 
PHYCA_543949                                                          201        3e-61 
PHYSO_341117                                                          218        4e-61 
PPTG_09853                                                            216        5e-61 
PHYRA_81274                                                           210        1e-60 
PYAR_13094                                                            208        2e-60 
PITG_14156                                                            213        2e-60 
HYAP_03658                                                            207        8e-60 
HYAP_14838                                                            201        1e-59 
CCI41041                                                              204        1e-59 
PHYRA_83716                                                           214        1e-59 
PHYCA_129660                                                          200        2e-59 
PHYSO_529022                                                          206        2e-59 
PHYSO_520489                                                          208        3e-59 
PHYCA_543955                                                          194        1e-58 
PHYCA_505050                                                          201        1e-58 
PPTG_02066                                                            198        2e-58 
PHYRA_78868                                                           210        2e-58 
PHYRA_80666                                                           204        3e-58 
PITG_17575                                                            208        5e-58 
PHYCA_118320                                                          201        2e-57 
PHYCA_107158                                                          191        2e-57 
PITG_17579                                                            200        2e-57 
PITG_08967                                                            201        3e-57 
PPTG_18534                                                            200        4e-57 
HYAP_01722                                                            201        4e-57 
PPTG_10355                                                            201        7e-57 
PHYCA_509624                                                          200        8e-57 
PHYCA_543324                                                          193        9e-57 
PHYCA_106001                                                          193        1e-56 
SPRG_03075                                                            199        2e-56 
PPTG_21833                                                            199        2e-56 
PHYCA_9190                                                            193        2e-56 
PITG_07549                                                            198        3e-56 
PHYCA_10461                                                           196        4e-56 
PHYRA_82498                                                           199        4e-56 
PITG_01017                                                            196        5e-56 
PPTG_14170                                                            201        7e-56 
PHYCA_128924                                                          197        8e-56 
SDRG_00883                                                            198        9e-56 
PITG_05112                                                            200        9e-56 
PHYRA_77379                                                           201        9e-56 
PHYSO_324311                                                          199        1e-55 
PITG_18347                                                            197        1e-55 
PHYCA_504276                                                          199        2e-55 
PPTG_10369                                                            197        2e-55 
SPRG_03078                                                            195        2e-55 
PPTG_10361                                                            197        2e-55 
SDRG_05099                                                            198        2e-55 
PPTG_10353                                                            196        2e-55 
PHALS_05409                                                           199        2e-55 
PHYCA_55944                                                           189        3e-55 
SDRG_05104                                                            197        3e-55 
PPTG_06854                                                            194        3e-55 
PHYRA_77817                                                           196        3e-55 
PPTG_10350                                                            196        4e-55 
HYAP_05922                                                            199        4e-55 
PYU1_G014939                                                          198        4e-55 
PITG_06480                                                            202        4e-55 
PHYRA_72889                                                           191        5e-55 
PHYSO_289074                                                          195        5e-55 
PPTG_18615                                                            196        5e-55 
PHYSO_518438                                                          186        5e-55 
PHYSO_413418                                                          189        6e-55 
PHYKE_2247                                                            194        6e-55 
PHYCA_56389                                                           193        7e-55 
PHYSO_354036                                                          192        7e-55 
PHYCA_569895                                                          189        8e-55 
PHYCA_45835                                                           192        9e-55 
PHYSO_515035                                                          193        1e-54 
PHYRA_77814                                                           194        1e-54 
PHYSO_421999                                                          187        1e-54 
PHYSO_522417                                                          200        2e-54 
PHYRA_80665                                                           200        2e-54 
PHYCA_117114                                                          194        2e-54 
PHYRA_95777                                                           187        2e-54 
PHYSO_474546                                                          193        2e-54 
PPTG_22589                                                            199        2e-54 
PHYCA_570506                                                          188        3e-54 
PHYSO_260691                                                          192        3e-54 
PHYCA_562574                                                          193        4e-54 
PHYRA_79691                                                           194        4e-54 
PHYSO_415772                                                          192        4e-54 
PPTG_10370                                                            193        4e-54 
PHYSO_477685                                                          192        4e-54 
PHYSO_486489                                                          196        5e-54 
H310_09505                                                            189        5e-54 
PHYRA_77670                                                           193        7e-54 
CCA19152                                                              195        8e-54 
PITG_17357                                                            192        8e-54 
PHYCA_547243                                                          187        9e-54 
SDRG_00886                                                            191        9e-54 
PPTG_06851                                                            184        9e-54 
PHYSO_472133                                                          192        1e-53 
PPTG_11455                                                            192        2e-53 
PYVX_22303                                                            191        2e-53 
HYAP_01725                                                            186        2e-53 
PITG_17252                                                            191        3e-53 
PHYRA_83084                                                           189        3e-53 
PHYCA_122693                                                          191        3e-53 
PHYRA_77819                                                           191        3e-53 
H310_07124                                                            192        3e-53 
PHYCA_105110                                                          184        4e-53 
PHYSO_418557                                                          187        4e-53 
PPTG_10354                                                            189        5e-53 
HYAP_05661                                                            192        5e-53 
PHYCA_126097                                                          186        5e-53 
PHYRA_93564                                                           184        5e-53 
PPTG_07736                                                            187        5e-53 
PHALS_05836                                                           193        6e-53 
SDRG_07620                                                            188        6e-53 
PHYKE_9600                                                            184        7e-53 
H257_13799                                                            188        8e-53 
H257_15918                                                            185        8e-53 
PYVX_17951                                                            192        8e-53 
HYAP_01732                                                            185        9e-53 
PHYRA_82847                                                           192        1e-52 
PPTG_01911                                                            181        1e-52 
SPRG_07855                                                            186        1e-52 
PPTG_21832                                                            189        1e-52 
PHYRA_81021                                                           190        1e-52 
PITG_17831                                                            187        1e-52 
PHYSO_534637                                                          189        1e-52 
PHYCA_503450                                                          186        2e-52 
PPTG_11276                                                            189        2e-52 
PITG_10780                                                            186        2e-52 
PPTG_11454                                                            190        2e-52 
PPTG_06717                                                            194        2e-52 
H257_13791                                                            187        2e-52 
PHYCA_112396                                                          184        2e-52 
H310_07796                                                            187        2e-52 
PHYCA_570505                                                          187        2e-52 
PPTG_14140                                                            187        2e-52 
PHALS_09634                                                           183        2e-52 
PHYRA_77816                                                           188        2e-52 
PHYSO_476596                                                          188        2e-52 
PITG_01002                                                            188        2e-52 
PHYRA_95588                                                           194        2e-52 
PHYRA_82925                                                           189        2e-52 
PHYCA_503455                                                          186        2e-52 
PHYCA_547239                                                          184        3e-52 
PHYCA_106045                                                          188        3e-52 
PITG_17495                                                            187        4e-52 
PHYCA_568998                                                          185        4e-52 
PPTG_09207                                                            189        5e-52 
PHYRA_76294                                                           186        5e-52 
H257_17422                                                            184        6e-52 
PHYSO_539944                                                          185        6e-52 
PITG_11236                                                            190        7e-52 
PHYRA_84549                                                           192        9e-52 
PHALS_13547                                                           186        1e-51 
PITG_08968                                                            186        1e-51 
PHALS_12946                                                           189        1e-51 
PPTG_00068                                                            189        1e-51 
PHYCA_572415                                                          181        1e-51 
PITG_00646                                                            189        2e-51 
PHYCA_75205                                                           179        2e-51 
PHYRA_87904                                                           179        2e-51 
PPTG_01145                                                            187        2e-51 
PHYRA_85819                                                           189        2e-51 
PHYRA_80624                                                           189        2e-51 
H310_07804                                                            185        2e-51 
PPTG_11363                                                            186        3e-51 
PHYCA_503452                                                          182        3e-51 
PHYCA_550540                                                          178        3e-51 
H310_07805                                                            184        3e-51 
CCI47779                                                              190        3e-51 
PPTG_01910                                                            172        3e-51 
PHYSO_470718                                                          184        4e-51 
PHYRA_95776                                                           184        4e-51 
PHYCA_563236                                                          178        4e-51 
PPTG_15084                                                            186        4e-51 
HYAP_13262                                                            178        4e-51 
SPRG_06057                                                            187        4e-51 
PHYRA_73578                                                           188        5e-51 
PPTG_08125                                                            187        5e-51 
PPTG_10360                                                            184        6e-51 
PHYCA_106047                                                          181        6e-51 
PHYRA_83112                                                           188        6e-51 
SDRG_03655                                                            179        7e-51 
H310_09502                                                            181        8e-51 
PHALS_14321                                                           184        8e-51 
PHYRA_72890                                                           187        9e-51 
H257_17420                                                            181        1e-50 
PHYRA_84550                                                           189        1e-50 
PHYSO_257885                                                          182        1e-50 
PHYRA_76010                                                           185        1e-50 
PHALS_02513                                                           177        1e-50 
H257_05418                                                            179        2e-50 
SDRG_12761                                                            186        2e-50 
PITG_01006                                                            181        2e-50 
PHYSO_532919                                                          183        2e-50 
H310_07797                                                            182        2e-50 
PHYSO_523359                                                          185        2e-50 
PHYRA_77669                                                           183        3e-50 
PPTG_07734                                                            184        3e-50 
HYAP_03127                                                            179        3e-50 
PHYRA_77380                                                           184        4e-50 
PITG_08890                                                            181        4e-50 
H310_10437                                                            178        4e-50 
PITG_23109                                                            182        4e-50 
HYAP_05921                                                            182        5e-50 
PPTG_10018                                                            182        5e-50 
PITG_17832                                                            185        6e-50 
PITG_06286                                                            178        6e-50 
PHYCA_8440                                                            182        6e-50 
PHYKE_6708                                                            175        7e-50 
PHYSO_516459                                                          181        7e-50 
PPTG_10363                                                            181        8e-50 
SPRG_07856                                                            178        8e-50 
PHYKE_2403                                                            181        9e-50 
PITG_08888                                                            184        9e-50 
PHYCA_105269                                                          183        1e-49 
PPTG_14169                                                            183        1e-49 
PHYSO_337522                                                          184        1e-49 
PHYSO_337442                                                          181        1e-49 
SPRG_05981                                                            183        1e-49 
SDRG_02945                                                            178        1e-49 
PHYRA_80659                                                           185        1e-49 
PPTG_06257                                                            179        1e-49 
SDRG_07159                                                            185        2e-49 
PPTG_06258                                                            180        2e-49 
H310_09503                                                            177        2e-49 
PHYSO_563616                                                          180        2e-49 
PHYRA_73247                                                           181        2e-49 
SPRG_03077                                                            179        2e-49 
PPTG_06194                                                            181        2e-49 
PHYSO_499386                                                          179        3e-49 
H310_07803                                                            179        3e-49 
PPTG_06260                                                            183        3e-49 
PHYSO_515605                                                          183        3e-49 
PITG_08957                                                            180        3e-49 
PPTG_06848                                                            177        3e-49 
PHYCA_125089                                                          179        3e-49 
SDRG_05454                                                            182        4e-49 
H257_17421                                                            176        4e-49 
PITG_06481                                                            181        5e-49 
PITG_08901                                                            178        6e-49 
SDRG_05329                                                            175        6e-49 
PPTG_00076                                                            182        6e-49 
SPRG_03241                                                            176        7e-49 
PPTG_11277                                                            179        7e-49 
SDRG_04429                                                            175        8e-49 
H310_07802                                                            179        8e-49 
SPRG_03506                                                            174        9e-49 
PITG_17840                                                            177        9e-49 
PPTG_00069                                                            181        9e-49 
PHYRA_81631                                                           180        9e-49 
SPRG_14246                                                            179        1e-48 
SPRG_02180                                                            177        1e-48 
HYAP_02510                                                            178        1e-48 
PHYSO_543580                                                          171        1e-48 
H310_12610                                                            175        1e-48 
PHYRA_80633                                                           180        1e-48 
H257_09180                                                            175        1e-48 
H257_08281                                                            180        1e-48 
CCA23126                                                              181        1e-48 
H257_10805                                                            180        1e-48 
SPRG_09620                                                            182        2e-48 
PITG_06925                                                            178        2e-48 
SPRG_07851                                                            174        2e-48 
PHALS_04459                                                           177        2e-48 
HYAP_08539                                                            179        2e-48 
H310_07798                                                            177        2e-48 
PHYCA_505168                                                          178        2e-48 
SPRG_05673                                                            182        2e-48 
CCI48517                                                              181        2e-48 
PHYSO_563622                                                          179        2e-48 
PHYCA_17500                                                           175        2e-48 
H257_13792                                                            177        2e-48 
H310_04787                                                            177        3e-48 
PHYRA_80636                                                           176        3e-48 
SPRG_05680                                                            171        4e-48 
SDRG_01275                                                            177        5e-48 
PITG_17356                                                            176        5e-48 
PPTG_11181                                                            172        5e-48 
SDRG_00885                                                            176        5e-48 
SDRG_16928                                                            175        6e-48 
PHYCA_6116                                                            169        6e-48 
PHALS_02415                                                           179        6e-48 
H310_05564                                                            178        7e-48 
PYVX_17944                                                            178        7e-48 
PITG_04611                                                            171        7e-48 
PHYKE_5057                                                            171        7e-48 
PHYRA_74873                                                           171        7e-48 
PITG_17580                                                            163        7e-48 
PHYCA_559315                                                          173        8e-48 
PHYCA_504366                                                          171        8e-48 
PITG_17571                                                            176        8e-48 
PHYCA_553853                                                          175        8e-48 
CCI40251                                                              178        9e-48 
H310_12631                                                            178        1e-47 
SDRG_15831                                                            177        1e-47 
PHYRA_72888                                                           180        1e-47 
PHYSO_292762                                                          171        1e-47 
PHYSO_343499                                                          179        1e-47 
PHYSO_519560                                                          176        1e-47 
PPTG_14638                                                            175        2e-47 
PPTG_16208                                                            176        2e-47 
SDRG_12259                                                            172        2e-47 
H310_07843                                                            172        2e-47 
PPTG_16207                                                            175        2e-47 
PHYSO_469689                                                          172        2e-47 
PHYRA_76005                                                           177        2e-47 
PHYCA_543953                                                          162        2e-47 
PPTG_06243                                                            174        3e-47 
PHYSO_335179                                                          174        3e-47 
CCI43480                                                              176        4e-47 
PYU1_G013198                                                          169        4e-47 
PPTG_08127                                                            178        4e-47 
PITG_23114                                                            174        5e-47 
HYAP_09438                                                            169        6e-47 
HYAP_14295                                                            171        6e-47 
PITG_02119                                                            172        6e-47 
H257_03172                                                            174        6e-47 
SPRG_19673                                                            172        7e-47 
SPRG_04655                                                            171        8e-47 
PHYCA_10859                                                           176        8e-47 
SPRG_09612                                                            170        9e-47 
SPRG_01027                                                            173        9e-47 
PITG_00643                                                            176        1e-46 
SPRG_14085                                                            167        1e-46 
PITG_08898                                                            174        1e-46 
HYAP_01680                                                            175        1e-46 
SPRG_04729                                                            171        1e-46 
HYAP_01679                                                            172        1e-46 
SDRG_02762                                                            173        1e-46 
PHALS_05692                                                           174        1e-46 
PHYCA_541730                                                          167        1e-46 
PPTG_16206                                                            170        2e-46 
H310_08166                                                            167        2e-46 
PHYCA_101485                                                          171        2e-46 
PITG_00640                                                            174        2e-46 
PHYKE_9028                                                            175        2e-46 
PHYSO_513011                                                          171        2e-46 
SPRG_15337                                                            171        2e-46 
PPTG_16599                                                            173        2e-46 
PHYCA_563952                                                          165        3e-46 
H257_15738                                                            171        3e-46 
H257_13798                                                            171        3e-46 
PHYSO_506773                                                          175        3e-46 
PHALS_07056                                                           176        3e-46 
SPRG_12339                                                            171        3e-46 
H257_15917                                                            169        4e-46 
SPRG_11076                                                            165        4e-46 
PHYSO_546345                                                          173        4e-46 
H310_12630                                                            171        5e-46 
PHALS_05686                                                           173        5e-46 
PHYSO_320857                                                          172        5e-46 
PPTG_06246                                                            172        6e-46 
PHYSO_540589                                                          163        6e-46 
H257_18714                                                            167        6e-46 
SDRG_09093                                                            171        7e-46 
SDRG_10000                                                            169        7e-46 
SDRG_10935                                                            173        7e-46 
SDRG_12347                                                            170        7e-46 
SDRG_02521                                                            169        1e-45 
H310_00232                                                            172        1e-45 
PPTG_14637                                                            171        2e-45 
PHYRA_75794                                                           167        2e-45 
PHYRA_77820                                                           162        2e-45 
SPRG_05677                                                            164        2e-45 
PPTG_01723                                                            172        2e-45 
SDRG_15865                                                            171        2e-45 
PITG_17251                                                            170        2e-45 
SPRG_08298                                                            162        2e-45 
PHYKE_3558                                                            173        2e-45 
SDRG_11990                                                            172        2e-45 
H310_12609                                                            166        3e-45 
H257_13801                                                            167        3e-45 
H257_04203                                                            168        3e-45 
H310_05900                                                            171        3e-45 
HYAP_07961                                                            167        3e-45 
PYVX_15888                                                            165        3e-45 
PHYCA_35810                                                           162        3e-45 
PPTG_08129                                                            170        4e-45 
PHYKE_1459                                                            168        4e-45 
H310_09289                                                            169        4e-45 
PITG_09664                                                            171        5e-45 
H257_06723                                                            171        5e-45 
PHYRA_72884                                                           171        5e-45 
SPRG_15848                                                            169        5e-45 
PHYRA_96877                                                           171        6e-45 
HYAP_03125                                                            172        6e-45 
PHYCA_118938                                                          171        7e-45 
H310_12616                                                            165        8e-45 
PYIW_21814                                                            165        8e-45 
PPTG_11364                                                            168        9e-45 
PHYCA_106917                                                          167        9e-45 
PPTG_02401                                                            164        9e-45 
CCA16155                                                              169        1e-44 
HYAP_13907                                                            164        1e-44 
SDRG_16768                                                            168        1e-44 
PHYSO_347055                                                          171        1e-44 
SPRG_12836                                                            168        1e-44 
PHYRA_74479                                                           164        1e-44 
PITG_10971                                                            163        2e-44 
SPRG_14612                                                            167        2e-44 
SPRG_12234                                                            165        2e-44 
SPRG_07170                                                            159        2e-44 
SPRG_04439                                                            165        2e-44 
SPRG_11580                                                            164        2e-44 
PITG_17573                                                            162        3e-44 

>PITG_00005
Length=493

 Score = 979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/493 (100%), Positives = 493/493 (100%), Gaps = 0/493 (0%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPTMTPSIR  60
            MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPTMTPSIR
Sbjct  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPTMTPSIR  60

Query  61   LRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRRIEFTDD  120
            LRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRRIEFTDD
Sbjct  61   LRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRRIEFTDD  120

Query  121  YMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILGVAIAVAGMALGWLSCRRKLEA  180
            YMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILGVAIAVAGMALGWLSCRRKLEA
Sbjct  121  YMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILGVAIAVAGMALGWLSCRRKLEA  180

Query  181  SMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHL  240
            SMKQKSGIEHERRSQRSSGSSQERRAISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHL
Sbjct  181  SMKQKSGIEHERRSQRSSGSSQERRAISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHL  240

Query  241  EGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELT  300
            EGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELT
Sbjct  241  EGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELT  300

Query  301  ASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMSSNVLLTDSIEPKII  360
            ASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMSSNVLLTDSIEPKII
Sbjct  301  ASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMSSNVLLTDSIEPKII  360

Query  361  DFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            DFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV
Sbjct  361  DFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG
Sbjct  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480

Query  481  RDSeeeeeGARTL  493
            RDSEEEEEGARTL
Sbjct  481  RDSEEEEEGARTL  493

>PPTG_16187
Length=640

 Score = 702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/542 (68%), Positives = 406/542 (75%), Gaps = 70/542 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M NYTMADLAVPK+DVS+VDCTYLNCSQP+   AHYAQYCTGWQMLNVSR          
Sbjct  101  MQNYTMADLAVPKSDVSFVDCTYLNCSQPSEEIAHYAQYCTGWQMLNVSRCVADDFEDPG  160

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP MTPSIRLRDH W QDI EFGG +TF VYVVHTV H+LDPAWN+C
Sbjct  161  ADTYLGMMWSTGGDPNMTPSIRLRDHTWTQDIAEFGGNVTFSVYVVHTVSHELDPAWNQC  220

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVIL  158
            P + G+ SLTVPCHR+IEFTD+YMAANTTVP GS  VTTWLK EFA E + SQ+ IPV+L
Sbjct  221  PPNNGFGSLTVPCHRKIEFTDEYMAANTTVPTGSELVTTWLKNEFAMEKTQSQMWIPVLL  280

Query  159  GVAIAVAGMALGWLSCRRKLEASM-KQKSGIEHerrsqrssgssqerrAISISSPQQRRD  217
             V I VAG+ LGWL CRRK +ASM KQ SG +        S S     ++  S       
Sbjct  281  SVIIIVAGVVLGWLGCRRKSKASMVKQISGAKGANSDSHRSLSISSSTSLPGS-------  333

Query  218  SAIQSLYCERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
               +SL+ ERAGSNKT   LLDSEHLEGKRIP++S+VFE  ISKGASGEVWVCE+N QKA
Sbjct  334  ---ESLHYERAGSNKTLQILLDSEHLEGKRIPYESVVFETAISKGASGEVWVCEYNGQKA  390

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            AVKRLLQRKKQKAESVQ+FA EIELTASL+HPNIVQFIGVAWNSLDNLVM+LEYL T SL
Sbjct  391  AVKRLLQRKKQKAESVQEFAKEIELTASLVHPNIVQFIGVAWNSLDNLVMLLEYLPT-SL  449

Query  335  KEFLEEP---------------------------------REFMSSNVLLTDSIEPKIID  361
            K++LE+                                  R+  SSNVLLTDS+EPKIID
Sbjct  450  KDYLEKNKDRLSWARDKIYIAIGIARALEYLHARTPPLIHRDLKSSNVLLTDSVEPKIID  509

Query  362  FGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT  421
            FGVSRG V+LSMTAGVGTPFWTAPEILEGNHYTEKAD+YS GVVLSELDT +VPYHDAV+
Sbjct  510  FGVSRGRVELSMTAGVGTPFWTAPEILEGNHYTEKADIYSLGVVLSELDTCEVPYHDAVS  569

Query  422  EDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGR  481
            EDGTKLKP QILKEVMSGTMRPSFS ECP RIRRI +ACLSL+PS R TA +LVRQLEG 
Sbjct  570  EDGTKLKPFQILKEVMSGTMRPSFSQECPARIRRITSACLSLEPSRRLTAQQLVRQLEGL  629

Query  482  DS  483
            D+
Sbjct  630  DN  631

>PPTG_16201
Length=656

 Score = 553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/541 (52%), Positives = 361/541 (67%), Gaps = 66/541 (12%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M N TM ++A+PK +VS VDCT+ NCSQPN VTA+Y+  CTGWQMLN S           
Sbjct  119  MHNRTMDNIAIPKWEVSGVDCTFTNCSQPNEVTAYYSHTCTGWQMLNTSHCVIDVFEDSG  178

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP + P I LRDH W +  P F    TF VYVVHTV    +PAW EC
Sbjct  179  AGTYLGNMWANGGDPDVAPLIELRDHTWTE--PVFNKSTTFSVYVVHTVSSSQEPAWGEC  236

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ--LLIPV  156
            P   GY ++++PC RR +FT ++MAANTT+P GSA+VTTWL QEFA+E S     LL+P+
Sbjct  237  P--SGYGTVSIPCARRDQFTAEFMAANTTIPTGSAWVTTWLAQEFAEESSGFDYILLVPI  294

Query  157  ILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRR  216
            ILG  + + G+ LGW   +RK + + ++ +   HE  + +          +  +     +
Sbjct  295  ILGALVVLGGIGLGWFCWKRKAKNNAQKSTSAAHELETDQYLAVGTPEMILGPTG-MTTQ  353

Query  217  DSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQK  273
             S + S Y E AGSNKTL   LDSEHL+GKRIP+DS+VFER +SKGASGEVW+C++N QK
Sbjct  354  GSTLSSHY-ESAGSNKTLKILLDSEHLQGKRIPYDSLVFERAVSKGASGEVWICQYNGQK  412

Query  274  AAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGS  333
             A KRLLQ K+Q AE VQ FA EIEL+ASL+HP+IV+FIGVAWNSL+NL MVLE+   G+
Sbjct  413  VAAKRLLQTKEQNAEKVQAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMVLEFFPMGN  472

Query  334  LKEFLEEP---------------------------------REFMSSNVLLTDSIEPKII  360
            L+ +L++                                  R+  S+N+LLTD +EPK+I
Sbjct  473  LQNYLQKNADLLSWARDKIHMAVGVAQALEYLHDRTPPLIHRDLKSNNILLTDKLEPKLI  532

Query  361  DFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            DFGVSR  VDL+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVL+ELDT ++PY DA 
Sbjct  533  DFGVSRDTVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDAT  592

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            TE G K KP QIL++VM+G +RP+FS++CPPRI++IG ACL+L P  RPTAHELV +L+G
Sbjct  593  TEHGGKPKPFQILQDVMAGKLRPTFSEDCPPRIKKIGMACLALSPEDRPTAHELVLELQG  652

Query  481  R  481
             
Sbjct  653  N  653

>PITG_20767
Length=661

 Score = 543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/548 (51%), Positives = 362/548 (66%), Gaps = 82/548 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M N TM ++A+PK +VS VDCT+ NCSQPN +TA+Y+  CTGWQMLN S           
Sbjct  114  MHNRTMDNIAIPKWEVSGVDCTFTNCSQPNDITAYYSHTCTGWQMLNTSHCVIDVFEDSG  173

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP + P I LRDH W +  P F    TF VYVVHTV    +PAW +C
Sbjct  174  AGTYLGNMWANGGDPDVAPLIELRDHTWTE--PVFNTSTTFSVYVVHTVYSSQEPAWGQC  231

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS--PSQLLIPV  156
            PL  GY ++++PC RR  FTD++MAANTT+P GSA+VTTWL+ EFA++ S   + LLIP+
Sbjct  232  PL--GYGAVSIPCARRDAFTDEFMAANTTIPTGSAWVTTWLEDEFAEKSSGFDTILLIPI  289

Query  157  ILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQ--  214
            ILGV   +  + LGW   +RK E    + +   H+  + +          +++ +P+   
Sbjct  290  ILGVVAVLGALGLGWFCWKRKAENRAHKSTSAAHDMETDQY---------LAVGTPEMIL  340

Query  215  ------RRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVW  265
                   + S I S Y E AGSNKTL   LDSEHL+GKRIP+DS++FER +SKGASGEVW
Sbjct  341  GPTGLTTQGSTISSHY-ESAGSNKTLKILLDSEHLQGKRIPYDSLLFERAVSKGASGEVW  399

Query  266  VCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMV  325
            +C++N Q+ A KRLLQ K Q AE VQ FA EIEL+ASL+HP+IV+FIGVAWNSL+NL MV
Sbjct  400  ICQYNGQQVAAKRLLQSKDQNAEKVQAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMV  459

Query  326  LEYLSTGSLKEFLEEP---------------------------------REFMSSNVLLT  352
            LE    G+L+ +L++                                  R+  S+N+LLT
Sbjct  460  LELFPMGNLQNYLQKNSDLLSWARDKIHMAIGVAQALAYLHARTPPLIHRDLKSNNILLT  519

Query  353  DSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTG  412
            D +EPK+IDFGVSR  VDL+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVL+ELDT 
Sbjct  520  DKLEPKLIDFGVSRDTVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTS  579

Query  413  QVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAH  472
            ++PY DA TE G K KP QIL++VM+G +RP+FS +CPPRI++IG ACL+L+P  RP+A 
Sbjct  580  KIPYSDAATEHGGKPKPFQILQDVMAGKLRPTFSKDCPPRIQKIGMACLALNPEDRPSAQ  639

Query  473  ELVRQLEG  480
            ELV++L+G
Sbjct  640  ELVQELQG  647

>PITG_17576
Length=661

 Score = 541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/548 (51%), Positives = 362/548 (66%), Gaps = 82/548 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M N TM ++A+PK +VS VDCT+ NCSQPN +TA+Y+  CTGWQMLN S           
Sbjct  114  MHNRTMDNIAIPKWEVSGVDCTFTNCSQPNDITAYYSHTCTGWQMLNTSHCVIDVFEDSG  173

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP + P I LRDH W +  P F    TF VYVVHTV    +PAW +C
Sbjct  174  AGTYLGNMWANGGDPDVAPLIELRDHTWTE--PVFNTSTTFSVYVVHTVYSSQEPAWGQC  231

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS--PSQLLIPV  156
            PL  GY ++++PC RR  FTD++MAANTT+P GSA+VTTWL+ EFA++ S   + LLIP+
Sbjct  232  PL--GYGAVSIPCARRDAFTDEFMAANTTIPTGSAWVTTWLEDEFAEKSSGLDTILLIPI  289

Query  157  ILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQ--  214
            ILGV   +  + LGW   +RK E    + +   H+  + +          +++ +P+   
Sbjct  290  ILGVVAVLGALGLGWFCWKRKAENRAHKSTSAAHDMETDQY---------LAVGTPEMIL  340

Query  215  ------RRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVW  265
                   + S I S Y E AGSNKTL   LDSEHL+GKRIP+DS++FER +SKGASGEVW
Sbjct  341  GPTGLTTQGSTISSHY-ESAGSNKTLKILLDSEHLQGKRIPYDSLLFERAVSKGASGEVW  399

Query  266  VCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMV  325
            +C+ N Q+ A KRLLQR+ Q AE VQ FA EIEL+ASL+HP+IV+FIGVAWNSL+NL MV
Sbjct  400  ICQCNGQQVAAKRLLQRRDQNAEKVQAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMV  459

Query  326  LEYLSTGSLKEFLEEP---------------------------------REFMSSNVLLT  352
            LE    G+L+ +L++                                  R+  S+N+LLT
Sbjct  460  LELFPMGNLQNYLQKNSDLLSWARDKIHMAIGVAQALAYLHARTPPLIHRDLKSNNILLT  519

Query  353  DSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTG  412
            D +EPK+IDFGVSR  VDL+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVL+ELDT 
Sbjct  520  DKLEPKLIDFGVSRDTVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTS  579

Query  413  QVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAH  472
            ++PY DA TE G K KP QIL++VM+G +RP+FS +CPPRI++IG ACL+L+P  RP+A 
Sbjct  580  KIPYSDAATEHGGKPKPFQILQDVMAGKLRPTFSKDCPPRIQKIGMACLALNPEDRPSAQ  639

Query  473  ELVRQLEG  480
            ELV++L+G
Sbjct  640  ELVQELQG  647

>PPTG_16186
Length=608

 Score = 540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/541 (53%), Positives = 354/541 (65%), Gaps = 93/541 (17%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M N++MADLAVPK  V+ VDCTYLNCSQPNGVTAHY+QYCTGWQMLNVSR          
Sbjct  100  MHNHSMADLAVPKYQVTNVDCTYLNCSQPNGVTAHYSQYCTGWQMLNVSRCVADVFEDPG  159

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP MTP IRLRDH W QDI EFGG ITF VYVVHTVPH+LDPAWNEC
Sbjct  160  AGTYLGMMWSVGGDPDMTPLIRLRDHTWTQDIAEFGGNITFSVYVVHTVPHELDPAWNEC  219

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSP--SQLLIPV  156
            P DE YASLTVPCHRR E++D+ +AAN T P GSA+V TWL+ EFA+E S   + LL+P+
Sbjct  220  PHDESYASLTVPCHRRDEYSDEEVAANMTKPTGSAWVNTWLETEFAREKSEFDTMLLVPI  279

Query  157  ILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRR  216
            I+G+      +   W  CR       KQK                     +S +    RR
Sbjct  280  IVGILFV---LWFCW-QCRS------KQK---------------------LSTARGDTRR  308

Query  217  DSAIQSLYCERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQK  273
             S     YC     N+T   L  SE+L+GKRI F+++ F R+ S+GASGE+WVCE+N ++
Sbjct  309  SSLSNPNYCS-PNVNQTLQILFGSEYLQGKRISFENLSFRRLASRGASGEIWVCEYNGRQ  367

Query  274  AAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGS  333
             A KR L  K   A  VQ FA EIELTA L+HPNIV+FIGV WNSL NL MV+E+   G 
Sbjct  368  VAAKR-LHTKDLNAVKVQAFAEEIELTARLVHPNIVEFIGVVWNSLSNLTMVIEFYPKGC  426

Query  334  LKEFLEEP---------------------------------REFMSSNVLLTDSIEPKII  360
            L+++L +                                  R+  S+NVL+++ +EPK+I
Sbjct  427  LQDYLHKNKNLLSWGQEKMRITVGIAKALEYLHAHSPPLIHRDVKSNNVLISNELEPKLI  486

Query  361  DFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            DFGVSR ++DL+MTAG+GTPFWTAPE+LEG+ YTE+AD+YSFGVVLSELD  + PY DAV
Sbjct  487  DFGVSRVVLDLTMTAGIGTPFWTAPEVLEGDRYTEQADIYSFGVVLSELDMCKTPYTDAV  546

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            TE G+K +  QIL+EVM+G +RP+FS++CP R+ R+  ACLSLDPSSRPTA E++RQL+ 
Sbjct  547  TEGGSKARHFQILQEVMAGELRPNFSEDCPSRVLRVAMACLSLDPSSRPTASEVIRQLDF  606

Query  481  R  481
            R
Sbjct  607  R  607

>PHYSO_520072
Length=661

 Score = 538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/545 (52%), Positives = 355/545 (65%), Gaps = 68/545 (12%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            MGN TMAD+AV K +VS V CT+ NCSQPNGVTA Y+  CTG+QM N S           
Sbjct  116  MGNRTMADIAVQKYEVSNVQCTFTNCSQPNGVTAFYSHTCTGFQMQNTSHCVANDFVDDA  175

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP + P I LRDH W + I EF G   F VYVVHTV    + AW  C
Sbjct  176  ASTYLGNMWASGGDPDVIPEIELRDHTWSEYIAEFNGTFDFSVYVVHTVSSSDEVAWGAC  235

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPS---QLLIP  155
            P D  Y ++++PC RR +FTD YMA NTT P G+A+VTTWL++EFA ED       LL+P
Sbjct  236  PDDGEYGAVSIPCARRDQFTDAYMAENTTTPTGTAWVTTWLQEEFAGEDDDGFNLVLLVP  295

Query  156  VILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEH----errsqrssgssqerrAISISS  211
            +ILGV + +    LGW   RR+ +   ++ +   H        Q  +  + E     +SS
Sbjct  296  IILGVLVVIG---LGWFFWRRRAKQRAQKSTTNPHCELEVDSVQYMTMGAPELNPTMMSS  352

Query  212  PQQRRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCE  268
                + S I S + E AGSNKTL   L SE L+GKRIPFDSI+FER +SKGASGEVW+CE
Sbjct  353  HPTTQGSTISSQHYESAGSNKTLKILLGSEQLQGKRIPFDSIIFERALSKGASGEVWICE  412

Query  269  FNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEY  328
            +N QK A KRLLQ K QKAE+VQ FA EI+L+ASL+HP+IV+FIGVAWNSL+NL+MVLE+
Sbjct  413  YNGQKVAAKRLLQTKDQKAENVQAFAEEIQLSASLVHPHIVEFIGVAWNSLNNLIMVLEF  472

Query  329  LSTGSLKEFLEE---------------------------------PREFMSSNVLLTDSI  355
               G+L+ +L +                                  R+  S+N+LLTD +
Sbjct  473  FPKGNLQNYLHKHGDLLSWARDKIHMAIGVAQALEYLHARTPPLIHRDLKSNNILLTDQL  532

Query  356  EPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVP  415
            EPK+IDFGVSR  +DL+MTAGVGTP+WTAPEI EG  YTE+AD+YSFGVVL+ELDT ++P
Sbjct  533  EPKLIDFGVSRDTIDLTMTAGVGTPYWTAPEIHEGKRYTEQADIYSFGVVLTELDTCKIP  592

Query  416  YHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELV  475
            Y +A TE G   KP QIL++VM+G +RPSFS +CPPRI+RIG ACLS+DPS+RPTA ELV
Sbjct  593  YSNAATEGGGMPKPFQILQDVMAGKLRPSFSQDCPPRIQRIGLACLSIDPSARPTARELV  652

Query  476  RQLEG  480
            ++L G
Sbjct  653  KELGG  657

>PPTG_16199
Length=666

 Score = 533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/552 (51%), Positives = 360/552 (65%), Gaps = 80/552 (14%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M  Y+MA +A+PK+DV+ VDCT+LNCSQPN V A+Y +YCTG+Q+LN SR          
Sbjct  120  MKGYSMAAIAIPKSDVANVDCTFLNCSQPNDVEAYYTKYCTGYQILNASRCVVDLFEDSG  179

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP MTP +RLRDH W QDI EFGG ITF VY VHTV    DPAW+ C
Sbjct  180  AGSFLGMMWSVGGDPDMTPELRLRDHTWTQDIEEFGGNITFSVYAVHTVSIVNDPAWDVC  239

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQL-LIPVI  157
            P   GYASLT+PCHRR +FTD+YMAANT +P GS +VTTWL++EFAQ     ++ LIP+I
Sbjct  240  P--AGYASLTIPCHRRDQFTDEYMAANTMLPTGSEWVTTWLEKEFAQSSGFDEIVLIPII  297

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQ---  214
            L V I    +  GW   +R+   +M++K   E    +      +         +P     
Sbjct  298  LSVVIV---LGFGWFCWKRR---AMRKKD--ERSTSATADYDFNSTSHYWGGGTPDMVLR  349

Query  215  --------RRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGE  263
                        +  S+  E AGSN TL   L+SEHL+GK + F+SI+FE+ ISKGASGE
Sbjct  350  PMMVTSQLSSQLSSLSMQYESAGSNTTLQILLNSEHLQGKHLAFESIIFEKAISKGASGE  409

Query  264  VWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLV  323
            VWVC+++ Q+ AVKRLLQ K QKA+ VQ FA EIEL+ASL+HPN+V+FIGVAWN+L+NLV
Sbjct  410  VWVCDYDGQQVAVKRLLQTKHQKAQHVQAFAEEIELSASLVHPNVVEFIGVAWNTLNNLV  469

Query  324  MVLEYLSTGSLKEFL-----------------------------EEP----REFMSSNVL  350
            MV+EYL  GSL+ +L                              +P    R+  SSN+L
Sbjct  470  MVMEYLPMGSLQRYLRVNSELLSWSKDKLRITIEIVQALEYLHSRKPSLIHRDLKSSNIL  529

Query  351  LTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELD  410
            LT+ +EPK+IDFGVSR  +DL+MT  +GTP+WTAPE+LEG  YTE+AD+YSFGV+LSELD
Sbjct  530  LTNKLEPKLIDFGVSRDKIDLTMTGEIGTPYWTAPEVLEGKRYTERADIYSFGVMLSELD  589

Query  411  TGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPT  470
            TG+ PY DAVTE+G   KP  +L++VM+G +RPSF  +CP RI+R+G ACL+LDP  RPT
Sbjct  590  TGKAPYSDAVTENGGMPKPFYVLQDVMAGRLRPSFLKDCPLRIKRVGLACLALDPLRRPT  649

Query  471  AHELVRQLEGRD  482
            A ELV++L   D
Sbjct  650  ARELVQELLMED  661

>PPTG_16188
Length=657

 Score = 532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/545 (52%), Positives = 362/545 (66%), Gaps = 70/545 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G+YTMAD+AVP+ D++ V+CT L C QPN + A+ +QYC+G Q+LNVSR          
Sbjct  118  IGDYTMADIAVPQDDITKVNCTMLECPQPNDIPAYSSQYCSGTQILNVSRCVVDTFEDSG  177

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    D TMTP IRLRDH W +  P  G  +++ VY VHTV    DP WN+C
Sbjct  178  ASDFLGVMWSTGGDSTMTPHIRLRDHTWTE--PTTG--VSYSVYAVHTVSSVDDPTWNQC  233

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ--LLIPV  156
            P ++GY+SL VPCH+R EFTD  MAA  T P GSA+VTTWLK EFA EDS  +  LLIPV
Sbjct  234  PANDGYSSLIVPCHKRSEFTDAEMAA-LTRPTGSAWVTTWLKDEFAVEDSGFEELLLIPV  292

Query  157  ILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRR  216
            IL   + +A M +GW   +R      +Q S  + +  S          +A+  +      
Sbjct  293  IL---VVIATMGIGWFCWKRSSMLKREQASSCDFDVVSPNYLDVVTHEQALRRTVTTTSY  349

Query  217  DSAIQSL--YCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNR  271
              +I S     E AGSN+TL   L S+HL G RIP+DS+VF+  +SKGASGEVW+C +  
Sbjct  350  GPSISSHPDDYESAGSNQTLKILLHSQHLHGNRIPYDSLVFQTELSKGASGEVWICRYGG  409

Query  272  QKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLST  331
            Q+ AVK+LL  + QKAE VQ FA EIELTASLIHP+IV+FIGVAWNSL NL +VLEY+  
Sbjct  410  QEVAVKKLLHTRDQKAEDVQVFAEEIELTASLIHPHIVKFIGVAWNSLSNLSLVLEYVPR  469

Query  332  GSLKEFLEEP---------------------------------REFMSSNVLLTDSIEPK  358
            G+L+++L                                    R+  S+N+LLT+S++PK
Sbjct  470  GNLRDYLHTNSDILSWARDRIFMAIAVAEALEYLHSRTPAIIHRDLKSNNILLTESLDPK  529

Query  359  IIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD  418
            +IDFGVSRG++DL+MTAGVGTP+WTAPEILEG+ YTEKAD+YSFGVVLSELDTG++PY D
Sbjct  530  LIDFGVSRGMMDLTMTAGVGTPYWTAPEILEGDRYTEKADIYSFGVVLSELDTGRIPYFD  589

Query  419  AVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            AV +DGT+L P QIL+EVM+GT+RPSFS +CPPRI+RIG ACLS +PS RPTA EL++ L
Sbjct  590  AVEDDGTRLMPFQILQEVMTGTLRPSFSADCPPRIQRIGAACLSFEPSDRPTAQELIQWL  649

Query  479  EGRDS  483
            EGR S
Sbjct  650  EGRHS  654

>PHYRA_84551
Length=638

 Score = 526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/539 (51%), Positives = 363/539 (67%), Gaps = 68/539 (13%)

Query  3    NYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR------------  50
            N +MAD+AV K +V  V CT  NCSQP+G   +Y +YCTG+QMLN S             
Sbjct  104  NRSMADIAVQKYEVFNVQCTVKNCSQPSGEDGYYTRYCTGYQMLNTSHCVIDVFEDSGAG  163

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLIT-FHVYVVHTVPHDLDPAWNECP  99
                  W    DP   P I +RDH W      F  ++T F VYVVHT+    +PAW+ CP
Sbjct  164  TYLGNMWAAGGDPDTVPEIEVRDHSWSD---YFNDVMTDFSVYVVHTMSSTDEPAWDTCP  220

Query  100  LDEGYAS-LTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ-LLIPVI  157
             D+GY S L+VPCHRR +F+D++MAANTTVP GSA+VTTWL+ EFA++   ++ LL+P+I
Sbjct  221  ADDGYTSPLSVPCHRRDQFSDEFMAANTTVPTGSAWVTTWLEDEFAEDSGFNKVLLVPII  280

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRD  217
            LG+ + + G  LGW   +R+ + +  + +   +E   +   G +     +S+      + 
Sbjct  281  LGILVVLGG-GLGWFCWKRRAKTNADKSATAAYELEGEHYVGVATPE--LSLHPMTTTQG  337

Query  218  SAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            S I S Y E AGSNKTL   L SEHL GKRIPF+S+ FER +SKGASGEVWVC +N QK 
Sbjct  338  STISSHY-ESAGSNKTLKVLLGSEHLRGKRIPFESLSFERALSKGASGEVWVCAYNGQKV  396

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            AVKRLLQ K+QKAE+VQ FA EI+L+ASL+HP+IV+FIGVAWNSL+NLV+VLE+   G+L
Sbjct  397  AVKRLLQSKEQKAENVQAFAEEIDLSASLVHPHIVEFIGVAWNSLNNLVLVLEFFPRGNL  456

Query  335  KEFLEE---------------------------------PREFMSSNVLLTDSIEPKIID  361
            + +L++                                  R+  S+N+LLTD +EPK+ID
Sbjct  457  QSYLQQHGDLLSWARDKIHMAIGVAQALEYLHARTPPLIHRDLKSNNILLTDKLEPKLID  516

Query  362  FGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT  421
            FGVSRG VD +MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVL+ELDT ++PY +A T
Sbjct  517  FGVSRGTVDNTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTCKIPYSNAAT  576

Query  422  EDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            E G K KP QIL++VM+G +RPSFS++CPPRI+R+G  CL++DP+ RPTAHEL+++LEG
Sbjct  577  EGGGKPKPFQILQDVMAGKLRPSFSEDCPPRIKRVGLRCLAVDPAGRPTAHELIQELEG  635

>PHYCA_563934
Length=645

 Score = 525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/540 (51%), Positives = 361/540 (67%), Gaps = 68/540 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M NY+MAD+A+PK DV+ VDC++LNCSQPN V A+Y QYCTG+Q+LN SR          
Sbjct  110  MKNYSMADIAIPKTDVANVDCSFLNCSQPNEVEAYYTQYCTGYQILNASRCVVDQFQDSG  169

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP +TP +RLRDH W QDI  FGG +TF VY VHTV  + DPAW+ C
Sbjct  170  AGSFLGMMWSVGGDPNITPELRLRDHTWTQDIEVFGGNVTFSVYAVHTVSSENDPAWDVC  229

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQL-LIPVI  157
            P   GYASLT+PCHRR EF+D+YMAANTTVP GSA+VTTWL++EFAQ    +++ LIP++
Sbjct  230  P--SGYASLTIPCHRRDEFSDEYMAANTTVPVGSAWVTTWLEEEFAQSSGFNKIFLIPIL  287

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRD  217
            L + + +    + W   R + +      +       +    G     R + ++S    + 
Sbjct  288  LSIFLVIG---VSWFCWRCRGKKKTPSTTADFDLNSTCHYWGGDMVFRPMMVTSQLSSQL  344

Query  218  SAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            S +   Y E AGSN TL   L SE+L+GK + +DS+VF++ ISKGASGEVW C++N QK 
Sbjct  345  STLSMQY-ESAGSNTTLQILLGSEYLQGKHVAYDSLVFDKAISKGASGEVWFCDYNGQKV  403

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEY---LST  331
            AVKRLLQ K QKA+ VQ FA EIEL+ASL+HP IV+FIGVAWN+L+NLVMV+E+   L  
Sbjct  404  AVKRLLQTKHQKAQHVQAFAEEIELSASLVHPYIVEFIGVAWNTLNNLVMVMEWQQNLPM  463

Query  332  GSLKEFLE------------------------------EP---REFMSSNVLLTDSIEPK  358
            G+L+ +L+                               P   R+  SSN+LLT+ ++PK
Sbjct  464  GNLQRYLKVNNSKLSWSKDKIYIAIGIAQALEYLHGRSSPIIHRDLKSSNILLTNELKPK  523

Query  359  IIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD  418
            +IDFGVSRG +DL+MT G+GTP+WTAPE+LEG  Y+E+AD+YSFGVVLSELDTG+ PY D
Sbjct  524  LIDFGVSRGKIDLTMTGGIGTPYWTAPEVLEGKRYSEQADIYSFGVVLSELDTGKAPYCD  583

Query  419  AVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            AVTE G   KP  IL++VM+G +RP+FS +CP RI+R+G ACL+L+ S RP+A +LV++L
Sbjct  584  AVTEHGGMPKPFYILQDVMAGRLRPTFSQDCPLRIKRLGLACLALNVSRRPSAQKLVQEL  643

>PHYSO_337966
Length=668

 Score = 520 bits (1339),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 273/543 (50%), Positives = 352/543 (65%), Gaps = 68/543 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            MG+Y++ D+A+PKADV+ VDCT+LNCSQPN  TA++ + CTG+Q+LN SR          
Sbjct  123  MGDYSITDIAIPKADVANVDCTFLNCSQPNAETAYFTKTCTGYQILNASRCVVDLFEDPG  182

Query  51   --------WD----PTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W     P  TP +RLR+H W QDI EFGG ITF VY VHTVP   D  WN C
Sbjct  183  AGSFLGTMWSTGGFPNRTPELRLREHTWTQDIDEFGGNITFSVYSVHTVPSREDSTWNVC  242

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLL-IPVI  157
            P   GY SLTVPC  R + +D YM ANT+VP GSA+VTTWL+ EFA +   ++LL IP++
Sbjct  243  P--SGYGSLTVPCIPRNQVSDAYMVANTSVPTGSAWVTTWLEDEFAGDSGFNKLLLIPIL  300

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAIS---ISSPQQ  214
            L V + + G+  GW   R + +  + +K   E+   S            +    ++S   
Sbjct  301  LSVLLVIGGV--GWYLWRLRAK-KLAEKLTYEYGAVSPHYWSGGTPDMVVRPMVVTSQLT  357

Query  215  RRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNR  271
             + S + S Y E  GSNKTL   L SEHL+GK IPF+S+ FE+ ISKGASGEVW+CE+N 
Sbjct  358  SQFSTLSSHY-ESVGSNKTLQILLGSEHLQGKHIPFESLAFEKAISKGASGEVWICEYNG  416

Query  272  QKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLST  331
            QK AVKRLLQ K Q+A  VQ FA EIEL+ASL HPNIV+FIGVAWN+L+NLVMV+E L  
Sbjct  417  QKVAVKRLLQTKHQRAHDVQAFAEEIELSASLAHPNIVEFIGVAWNTLNNLVMVIELLPM  476

Query  332  GSLKEFLEEP---------------------------------REFMSSNVLLTDSIEPK  358
            GSL+ +L E                                  R+  SSN+LLT ++EPK
Sbjct  477  GSLQRYLREDGMLLSWSNGKLEMAIGIASALEYLHARTPPLIHRDLKSSNILLTKTLEPK  536

Query  359  IIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD  418
            +IDFG SR  +DL+MT G+GTP+WTAPE+LEG  Y+++AD+YSFGVVLSELDTG+ PY D
Sbjct  537  LIDFGASRDTIDLTMTGGIGTPYWTAPEVLEGKRYSQRADIYSFGVVLSELDTGKAPYAD  596

Query  419  AVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            AVTE+G   KP  +L++VM+G +RPSFS  CP  I+R+G ACL+L+P +RPT  ELV +L
Sbjct  597  AVTENGGMPKPFYVLQDVMAGRLRPSFSKNCPVWIKRLGLACLALEPRNRPTVRELVHEL  656

Query  479  EGR  481
            + R
Sbjct  657  QSR  659

>PHYRA_84553
Length=664

 Score = 516 bits (1328),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 279/542 (51%), Positives = 355/542 (65%), Gaps = 64/542 (12%)

Query  3    NYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR------------  50
            NY+MA +AVPK +V+ VDCT+LNCSQPN V A+Y +YCTG+Q+LN SR            
Sbjct  122  NYSMAQIAVPKYEVANVDCTFLNCSQPNDVEAYYTKYCTGYQILNASRCVADTFEDPGAG  181

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    DP MTP +R RDH W QD+ +FGG ITF VY VHTV    DPAW+ CP 
Sbjct  182  DFLGMMWSTGGDPDMTPELRFRDHTWTQDVEQFGGNITFSVYSVHTVSSSEDPAWDVCP-  240

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLL-IPVILG  159
              GYAS+TVPCHRR EFTD +MAANTT P GSA+VTTWL+QEFAQ+     LL IP++LG
Sbjct  241  -SGYASVTVPCHRRDEFTDAFMAANTTKPTGSAWVTTWLQQEFAQDSGFDMLLFIPIVLG  299

Query  160  VAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAI---SISSPQQRR  216
                V  + + W    +K E      +  EH          S+    +    I + Q   
Sbjct  300  AVAVVGLVGVFWRWRVKKKEQEKTLSNAWEHSGDYSYFMSGSEPGEMVLRPMIVTSQLST  359

Query  217  DSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQK  273
              +  S + E AGSNKTL   L SEHL+ K +PFDS+VF++ +SKGASGEVW+CE+N +K
Sbjct  360  QLSSLSSHYESAGSNKTLKILLGSEHLQDKYMPFDSLVFQKALSKGASGEVWICEYNGRK  419

Query  274  AAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGS  333
             AVKRLLQ K+QKA++VQ FA EIEL ASL+HP+IV+FIGVAWN+L+NLVMVLEYL  GS
Sbjct  420  VAVKRLLQSKEQKAQNVQAFAEEIELGASLVHPHIVEFIGVAWNTLNNLVMVLEYLPKGS  479

Query  334  LKEFLE-----------------------------EP----REFMSSNVLLTDSIEPKII  360
            L+++L+                              P    R+  SSN+LLT+ +EPK+I
Sbjct  480  LQQYLKLDGSQLSWWMGKLHMAVGIAQALEYLHGRSPSLIHRDLKSSNILLTEELEPKLI  539

Query  361  DFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            DFGVSR   + +MT G+GTP+WTAPEIL G  YTE+AD+YSFGVVLSELDTG+ PY D +
Sbjct  540  DFGVSRDRAEATMTGGIGTPYWTAPEILIGKRYTEQADIYSFGVVLSELDTGKSPYSDTL  599

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            TE G   KP  IL++VM+G +RPSFS  CP  + ++G +CL++DP++RPTA ELV+ LE 
Sbjct  600  TECGGMPKPFYILQDVMAGKLRPSFSPTCPLHVLQLGLSCLAIDPANRPTARELVQWLEN  659

Query  481  RD  482
             D
Sbjct  660  SD  661

>PHYCA_107224
Length=650

 Score = 504 bits (1297),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 271/554 (49%), Positives = 356/554 (64%), Gaps = 81/554 (15%)

Query  3    NYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR------------  50
            +YTMAD+AVPKA VS   CT+ NC+QPN   A+Y   C+G QM+NVSR            
Sbjct  97   SYTMADIAVPKAQVSAEGCTFKNCTQPNEELAYYTLICSGAQMVNVSRCVVDMFVDSAAT  156

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    DP MTP IRLRDH W   + E      + VY VHT     DPAWN CP 
Sbjct  157  SYLGSMWSVGGDPDMTPYIRLRDHSWVDPVTEKA----YSVYAVHTTSVADDPAWNVCPT  212

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPS---QLLIPVI  157
             + Y +LTVPCHRR EFTDD +A   T P GS +VTTWL++EF++ D       LLIP+I
Sbjct  213  GDSYGALTVPCHRRDEFTDDEIATMNT-PTGSTWVTTWLEEEFSESDGSGFNMLLLIPII  271

Query  158  LGVAIAVAGMALGWLSCRR---KLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQ  214
            LGV I   G  LGWL  R+   K++ +               S  +    + +S +  Q 
Sbjct  272  LGVVILALG--LGWLYRRKANTKIDETASTTCDFVETSPRYLSGSTVPLPKYVSSTPDQA  329

Query  215  RRDSAIQS----------LYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGAS  261
             R + + S          +Y E AGS +TL   L+ +HL  KR+P+D+I ++++++KG+S
Sbjct  330  LRPTIMTSQGTFLSARGGIY-ESAGSCRTLKILLEGQHLMDKRMPYDNITYQKILAKGSS  388

Query  262  GEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDN  321
            GEVW CE N Q+ AVKRLLQ K+QKAE+VQ FA EI LTASL HP+IV FIGVAWN+L+N
Sbjct  389  GEVWACEHNGQQVAVKRLLQTKEQKAENVQAFAEEISLTASLDHPHIVGFIGVAWNTLNN  448

Query  322  LVMVLEYLSTGSLKEFLEEP--------------------------------REFMSSNV  349
            L+MVLEY+  GSL+ +L++                                 R+  S+N+
Sbjct  449  LIMVLEYVPMGSLQSYLDQNADLLSWARDKIHMAVGIAQALEYLHGTPSLIHRDLKSNNI  508

Query  350  LLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSEL  409
            LL+  +EPK+IDFGVSRG V+ +MTAGVGTP+WTAPEILEG  YT++AD+YSFG+VLSEL
Sbjct  509  LLSHMLEPKLIDFGVSRGTVENTMTAGVGTPYWTAPEILEGKRYTQQADIYSFGIVLSEL  568

Query  410  DTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRP  469
            DTG++PYHDA+TE+G K KPVQIL++V+SGT+RP FS +CPPRI RIG+ACL+ DPSSRP
Sbjct  569  DTGKIPYHDALTENGGKTKPVQILQDVVSGTLRPKFSTDCPPRILRIGSACLAQDPSSRP  628

Query  470  TAHELVRQLEGRDS  483
            TA +L+++LEG+++
Sbjct  629  TAQQLLQELEGKEN  642

>PPTG_16184
Length=656

 Score = 502 bits (1292),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 271/568 (48%), Positives = 358/568 (63%), Gaps = 106/568 (19%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M +YTMAD+AVPK +VS   CT+ NC+QPN   A+Y   C+G QM+NVSR          
Sbjct  99   MNDYTMADIAVPKDEVSGEGCTFKNCTQPNDELAYYTLICSGAQMVNVSRCVADTFVDSA  158

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP M P IRLRDH W   + E    +++ VY VHT     DPAWN C
Sbjct  159  ATSYLGSMWSVGGDPNMVPYIRLRDHSWVDPVTE----VSYSVYAVHTTSVADDPAWNVC  214

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS-PSQLLIPVI  157
            P D+GY +LTVPCHRR EFTD  M A  T P GSA+VTTWL++EFA++    + LLIP+I
Sbjct  215  PADDGYGALTVPCHRRDEFTDKEMEAMHT-PTGSAWVTTWLEEEFAEDSGFDTMLLIPII  273

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRD  217
            LG  + +  +  G    +RK      QKS I+    +            ++  SPQ   +
Sbjct  274  LGAVVLIIAVGCGRYYWKRK------QKSDIDETVSTTCD---------LTAVSPQYTSE  318

Query  218  SAI---------------------QSLYC------ERAGSNKTL---LDSEHLEGKRIPF  247
            S +                     Q  +       E AGS +TL   L+S+HL  KR+P+
Sbjct  319  STVPLPKYAATTPDHTLRPTVMTTQGSFLSTRGGYESAGSCRTLKILLNSQHLMDKRMPY  378

Query  248  DSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPN  307
            +SI+++R++SKG+SGEVW+C+ N Q+ A+KRLLQ K+QKAESVQ FA EIELTASL HP+
Sbjct  379  ESIMYQRLLSKGSSGEVWLCKHNGQQIAIKRLLQIKQQKAESVQAFAEEIELTASLDHPH  438

Query  308  IVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP--------------------------  341
            IV F+ VAWN+L+NLVMV+EY+  GSL+ +L +                           
Sbjct  439  IVTFVSVAWNTLNNLVMVMEYVPMGSLQSYLHQNADLLSWARDKIHMAVGIAQALDYLHS  498

Query  342  -------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYT  394
                   R+  S+N+LLT  +EPK+IDFGVSR  V+ +MTAGVGTP+WTAPEILEG  YT
Sbjct  499  RTPSCIHRDVKSTNILLTHMLEPKLIDFGVSRKSVEATMTAGVGTPYWTAPEILEGKRYT  558

Query  395  EKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIR  454
            E+AD+YSFGVVLSELDTG++PYHDA+TE G K+KPVQIL++V+SG +RP+FS +CPPRI+
Sbjct  559  EQADIYSFGVVLSELDTGKIPYHDALTESGGKVKPVQILQDVVSGMLRPTFSKDCPPRIQ  618

Query  455  RIGTACLSLDPSSRPTAHELVRQLEGRD  482
            R+G+ACL  DPS+RPTA +LV++LEG++
Sbjct  619  RVGSACLVQDPSTRPTAQQLVKELEGKE  646

>PHYSO_518441
Length=663

 Score = 500 bits (1287),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 265/554 (48%), Positives = 349/554 (63%), Gaps = 87/554 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M N+TMAD+A+PK++V    CT+ NCSQPN VTA++   C+G QML+V+R          
Sbjct  114  MDNFTMADIAIPKSEVGEAGCTFKNCSQPNDVTAYFTLICSGDQMLSVARCVADTFEDDG  173

Query  51   --------WD----PTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W     P + P IR+RDH W   +       ++ VY VHTVP  LD AWN+C
Sbjct  174  AAGYLGAMWSNGAAPDVAPLIRMRDHAWTDPVSNH----SYSVYAVHTVPSALDVAWNQC  229

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ---LLIP  155
            P + GYAS+ VPCHRR  ++D+ MA   TVP GS +VTTWL +EF  +D+      +L+ 
Sbjct  230  PANNGYASVAVPCHRRDSYSDEEMA-TMTVPTGSEWVTTWLSEEFGTKDAAGLNLLMLVL  288

Query  156  VILGVAIAVAGMALGWLSCRRK------LEASMKQKSGIEHerrsqrssgssqerrAISI  209
            +ILGVA+ +  + LGW   RR+      L AS     G +        +           
Sbjct  289  IILGVAL-IGAIVLGWCCWRRRAIHKPDLTASPACDLGADSTCYLDGGTPELP-------  340

Query  210  SSPQQRRDSAIQSLYC-------ERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKG  259
            S P      A   L C       E AGSN TL   L S HL+G+R+P++S+ F++ +SKG
Sbjct  341  SRPTTYSTRATAQLSCFSHSEDYETAGSNATLAILLHSVHLQGRRVPYESLSFDKSLSKG  400

Query  260  ASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSL  319
            ASGEVW+  +  Q+ A+K+LLQ   QKAESVQ FA EIEL++SL+HP+IV+F+GVAWNSL
Sbjct  401  ASGEVWIGSYAGQQVAIKKLLQSTGQKAESVQAFAEEIELSSSLVHPHIVEFVGVAWNSL  460

Query  320  DNLVMVLEYLSTGSLKEFLEEP---------------------------------REFMS  346
             NL MV+E+   G+L+++L +                                  R+  S
Sbjct  461  SNLAMVMEFFPRGNLQDYLHKNIDLLSWARDRVQMAVAIAQALQYLHSRPPSIIHRDLKS  520

Query  347  SNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVL  406
            +N+LLTD +EPK+IDFGVSRGLVDL+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVL
Sbjct  521  NNILLTDRLEPKLIDFGVSRGLVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVL  580

Query  407  SELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPS  466
            SELDTG++PYHDAVTE G K KP Q+L++VM+G +RPSFS +CPPRI+RIG ACL+ +PS
Sbjct  581  SELDTGRIPYHDAVTEGGGKAKPFQVLQDVMAGKLRPSFSRDCPPRIQRIGLACLAFEPS  640

Query  467  SRPTAHELVRQLEG  480
            SRPTA +L+ QLEG
Sbjct  641  SRPTASQLIEQLEG  654

>PHYSO_253195
Length=677

 Score = 494 bits (1271),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 272/559 (49%), Positives = 363/559 (65%), Gaps = 81/559 (14%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M +YTMA+LAVPKA VS   CT+ NCSQPN VTA+Y   C+G QMLNVSR          
Sbjct  117  MDDYTMAELAVPKAQVSGQGCTFKNCSQPNDVTAYYTLICSGDQMLNVSRCVADTFEDSA  176

Query  51   --------WD----PTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W     P  TP +RLR+H W+  + +     ++ VY +HTV +  DPAWN C
Sbjct  177  ATSYMGSMWSVGGGPNATPQLRLRNHAWKDPVTK----DSYSVYAIHTVSNADDPAWNVC  232

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS-PSQLLIPVI  157
            P D+GYA+LTVPCHRR EFTD  M A T  P GSA+VTTWLK+EF +     + LLIP+I
Sbjct  233  PADDGYAALTVPCHRRDEFTDAEMEAMTK-PTGSAWVTTWLKEEFGESSGFNTLLLIPII  291

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerr----AISISSPQ  213
            LG  + +AG ++ W   RR+ +  +++++          S     E       ++ S+P 
Sbjct  292  LGAVVVIAGASVAWFCWRRRAKVKIEEETMSTTCDLVGVSPQYRAENSVPRPTVTASTPA  351

Query  214  QRR-----------DSAIQSLY--CERAGSNKTL---LDSEHLEGKRIPFDSIVFERVIS  257
            + R            S+  SL    E  GS KTL   L S+HL  +R+ +++I F+  +S
Sbjct  352  KHRATTLTSRLTTLGSSFSSLAEAYESPGSCKTLKILLSSQHLVERRLQYENITFQSALS  411

Query  258  KGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWN  317
            KG+SGEVWVCE + Q+ AVKRLLQ K QKAE+V +FA E+ELTASL HPNIV F+GVAWN
Sbjct  412  KGSSGEVWVCEHDGQQVAVKRLLQTKNQKAENVLEFAEEVELTASLDHPNIVGFVGVAWN  471

Query  318  SLDNLVMVLEYLSTGSLKEFLEEP---------------------------------REF  344
            +L+NL++VLEY+  GSL+ +L++                                  R+ 
Sbjct  472  TLNNLLLVLEYVPMGSLQTYLQKNADLLSWARDKVHMAVGIAKALEYLHGHTPALIHRDL  531

Query  345  MSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGV  404
             S+N+LLTD +EPK+IDFGVSRG V+L+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGV
Sbjct  532  KSNNILLTDRLEPKLIDFGVSRGTVELTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGV  591

Query  405  VLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLD  464
            VLSELDTG++PYHDA+TE G K KPVQIL++V+ GT+RP+F+ +CPPRI R+G+ACL+ D
Sbjct  592  VLSELDTGRIPYHDALTEGGGKAKPVQILQDVVCGTLRPTFTKDCPPRILRVGSACLAQD  651

Query  465  PSSRPTAHELVRQLEGRDS  483
            PSSRPTA +L+++L+G+ +
Sbjct  652  PSSRPTAEQLIQELQGKST  670

>PITG_17586
Length=686

 Score = 491 bits (1265),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 264/551 (48%), Positives = 347/551 (63%), Gaps = 75/551 (14%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M +YTMA++AVPK +VS   CT+ NC+QPN   A+Y   C+G QM+NVSR          
Sbjct  132  MDDYTMANIAVPKEEVSGEGCTFKNCTQPNNALAYYTLICSGAQMVNVSRCVADTFVDSA  191

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    D  M P IRLRDH W   + E    +++ VY VHT     DPAWN C
Sbjct  192  ATSYLGSMWSVGGDLDMIPYIRLRDHSWVDPVTE----VSYSVYAVHTTSVADDPAWNVC  247

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS-PSQLLIPVI  157
            P D GY ++TVPCHRR EFTD  M A  T P GSA+V  WL++EFAQ     + LLIP+I
Sbjct  248  PADNGYGAVTVPCHRRDEFTDQEMEAMNT-PTGSAWVAKWLEEEFAQGSGFDTLLLIPII  306

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAI-----SISSP  212
             G  + VA + +G    +RK E  + +      +  +      S     +         P
Sbjct  307  SGAVVFVAVIGVGRFYWKRKEEHKIDETVSTTCDLATVSPQYMSGSTVPLPKYTSGTPDP  366

Query  213  QQR-----RDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEV  264
              R        +  S Y E AGS +TL   L S+HL  KR+P++SI +++ +SKG+SGEV
Sbjct  367  ALRPTVMTTQGSFLSTY-ESAGSCRTLKILLRSQHLTEKRMPYESIAYQQALSKGSSGEV  425

Query  265  WVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVM  324
            W+CE N Q+ A+KRLLQ K+QKAE+VQ FA EIELTASL HP++V FIGVAWN+L+NLVM
Sbjct  426  WLCEHNGQQVAIKRLLQNKQQKAENVQAFAEEIELTASLDHPHVVSFIGVAWNTLNNLVM  485

Query  325  VLEYLSTGSLKEFLEEP---------------------------------REFMSSNVLL  351
            VLEY+  GSL+ +L++                                  R+  S+N+LL
Sbjct  486  VLEYVPMGSLQTYLDQNADLLSWARDKIHMAVGIAQALDYLHGHTPSLIHRDLKSTNILL  545

Query  352  TDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDT  411
            T  +EPK+IDFGVSRG  DL+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVLSELDT
Sbjct  546  THMLEPKLIDFGVSRGTADLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDT  605

Query  412  GQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTA  471
            G++PYHDA+T  G ++KPVQIL++V+SG +RP+FS +CPPRI R+G+ACL+ DP++RPTA
Sbjct  606  GKIPYHDALTGAGGRVKPVQILQDVVSGALRPTFSSDCPPRILRVGSACLAQDPATRPTA  665

Query  472  HELVRQLEGRD  482
             +LV +L G++
Sbjct  666  QQLVSELVGKE  676

>PITG_17585
Length=655

 Score = 486 bits (1250),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 263/547 (48%), Positives = 338/547 (62%), Gaps = 80/547 (15%)

Query  2    GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50
            G++TMAD+AV   D++ V+CT L C QPN   A+ +QYC+G Q+LNVSR           
Sbjct  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180

Query  51   -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99
                   W    D TMTP IRLRDH W +  P  G  +++ VY VHTV    DP WN+CP
Sbjct  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTE--PTTG--VSYSVYAVHTVSSADDPTWNQCP  236

Query  100  LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILG  159
            ++ GY+SL VPCH+R EF+D  MAA    P GS +VT WLK EFA  DS     + +I  
Sbjct  237  VNNGYSSLIVPCHKRSEFSDAEMAA-VNKPKGSEWVTMWLKDEFAVGDSSGFDELLLIPI  295

Query  160  VAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSA  219
            + +  A M +GW   +R      +Q S          +           ++  Q RR + 
Sbjct  296  LLVVAAAMGMGWFCWKRHAMLKREQSSSCCDFDVVSPNYLGV-------VAHEQARRGTV  348

Query  220  IQSLYC----------ERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWV  266
              + Y           E AGSN+T   LL S+HL G RIP++S+ F+  +SKGASGE W+
Sbjct  349  ATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKGASGEAWI  408

Query  267  CEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVL  326
            C++  Q  AVK+LL  K QKA+ VQ FA EIELTASLIHP+IV+FIGVAWNSL NL MVL
Sbjct  409  CQYGGQPVAVKKLLHTKDQKADDVQAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVL  468

Query  327  EYLSTGSLKEFLEEP---------------------------------REFMSSNVLLTD  353
            E++S G L+ FL +                                  R+  S+N+LLT+
Sbjct  469  EFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTE  528

Query  354  SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
             ++PK+IDFGVSRG++DL+MTAGVGTP+WTAPE+LEG  Y+E+AD+YSFGVVLSELDTG+
Sbjct  529  DLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEEADIYSFGVVLSELDTGR  588

Query  414  VPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
            +PY D V  DG KL P QIL+EVM+GT+RPSFS +CPPRI+RI  ACLS DPS RPTA E
Sbjct  589  IPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQE  648

Query  474  LVRQLEG  480
            L++ LEG
Sbjct  649  LIQWLEG  655

>PHYRA_84559
Length=2650

 Score = 513 bits (1321),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 274/551 (50%), Positives = 356/551 (65%), Gaps = 77/551 (14%)

Query  2     GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50
             G+YTMAD+AVPK +VS V CT+ NCSQPN   A Y   C+G QMLNVSR           
Sbjct  2094  GDYTMADIAVPKEEVSDVGCTFKNCSQPNDEMAFYTLICSGEQMLNVSRCVADTFVDSAA  2153

Query  51    -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99
                    W    D  MTP IRLRDH WE  + +      + VY VHT     DPAWN CP
Sbjct  2154  SSYMGSMWSRGGDSGMTPHIRLRDHSWEDPVTK----AAYSVYAVHTASSAEDPAWNVCP  2209

Query  100   LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS-PSQLLIPVIL  158
             +D+ Y ++TVPCHRR EF+D+ MAA TT P GSA+VT WL++EFA +    + LL+P+I+
Sbjct  2210  VDDKYTAMTVPCHRRDEFSDEEMAAMTT-PTGSAWVTAWLQEEFAADSGFDTLLLLPIIV  2268

Query  159   GVAIAVAGMALGWLSCRR----KLEASMKQKSGI-EHerrsqrssgssqerrAISISSPQ  213
             G    VA + LGW+  RR    K+E +M     +          S       A  ++ P 
Sbjct  2269  GAVALVAAIGLGWVCWRRRAKGKIEETMSTTGDLCSSSPLYLSGSTIPVPNYAAEMAEPA  2328

Query  214   QRRD-SAIQSLYC-------ERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASG  262
              R      QS +        E AGS +TL   L S HL+GKR+P++S++ +  +SKG+SG
Sbjct  2329  LRPTIMTTQSTFLSSHLEGYESAGSCRTLKILLGSHHLQGKRLPYESLMLQTTLSKGSSG  2388

Query  263   EVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNL  322
             E+W+  +N +K A KRLLQ K QKA +VQ FA EIELTASL HP+IV+FIGVAWN+L+NL
Sbjct  2389  EIWLSAYNGRKVAAKRLLQSKDQKAGNVQAFAEEIELTASLTHPHIVEFIGVAWNNLNNL  2448

Query  323   VMVLEYLSTGSLKEFLEEP---------------------------------REFMSSNV  349
             VMVLE++  GSL+ +L +                                  R+  S+N+
Sbjct  2449  VMVLEFVPNGSLQSYLHQNADLLSWARDKIHMAVGIAQALDYLHGHSPPLIHRDLKSNNI  2508

Query  350   LLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSEL  409
             LLTD +EPK+IDFGVSRG +DL+MTAG+GTP+WTAPE+LEG+ YTE+AD+YSFGVVLSEL
Sbjct  2509  LLTDMLEPKLIDFGVSRGRIDLTMTAGIGTPYWTAPEVLEGSRYTEQADIYSFGVVLSEL  2568

Query  410   DTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRP  469
             DTG++PY DAVTE G+KLKPVQIL++V+SGT++PSFS +C PRIRR+G+ACL+LDP+SRP
Sbjct  2569  DTGRIPYFDAVTEGGSKLKPVQILQDVVSGTLQPSFSADCAPRIRRVGSACLALDPASRP  2628

Query  470   TAHELVRQLEG  480
             TA +LV +L G
Sbjct  2629  TAQQLVEELRG  2639

 Score = 512 bits (1319),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 273/530 (52%), Positives = 346/530 (65%), Gaps = 63/530 (12%)

Query  5     TMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR--------------  50
             TMA + V   +V  V C   NC+QPNG   +Y+  CTG+QMLN S               
Sbjct  695   TMASINVQMYEVFNVQCKTTNCTQPNGEQTYYSFTCTGYQMLNTSHCVIDVFNDTGSTNY  754

Query  51    ----W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDE  102
                 W    DP + P I LRDH W ++I  FGG   F VYVVHTV    +  W EC L +
Sbjct  755   LGNMWAAGGDPDLVPEIELRDHTWTENIAVFGGDTFFSVYVVHTVASRDEAPWGEC-LPK  813

Query  103   GYAS-LTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQL-LIPVILGV  160
             GY S L+VPCHRR +F+D+YMAANTTVP GSA+VTTWL+ EFA++   ++L L+P++LGV
Sbjct  814   GYGSPLSVPCHRRDQFSDEYMAANTTVPEGSAWVTTWLEDEFAEDSGFNKLMLLPILLGV  873

Query  161   AIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAI  220
              +A+ G+A  +   R KL+  +   +           +        I + S       +I
Sbjct  874   FVAI-GVAWFYRGRRTKLQEKLLPSTSTNLTGSRLGDTTHGSALTPIDMDS-LILHGVSI  931

Query  221   QSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVK  277
              SL  E AGS+K L   L S+HL GKRIP++ +VFE  +SKGASGEVW+CE+N Q  A K
Sbjct  932   SSLDYESAGSSKALQILLGSDHLHGKRIPYELLVFENALSKGASGEVWICEYNGQHVAAK  991

Query  278   RLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEF  337
             RLL  KK++AE+V  FA EIEL+A+LIHP+IV F+GVAWN+LDNLV+VLEYL  G+L+ +
Sbjct  992   RLLSAKKEQAETVHAFAEEIELSATLIHPHIVGFVGVAWNTLDNLVLVLEYLPMGNLQNY  1051

Query  338   LEEP---------------------------------REFMSSNVLLTDSIEPKIIDFGV  364
             LE+                                  R+  SSN+LLTD++EPKIIDFGV
Sbjct  1052  LEKNADQLSWARDKIHIAIGIANALKYLHDRTPPLIHRDVKSSNILLTDALEPKIIDFGV  1111

Query  365   SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDG  424
             SRG V+ +MT G+GTP+W APE+LEG HYTE+AD+YSFGVVLSELDTG++PYHDAVTEDG
Sbjct  1112  SRGRVEQTMTGGIGTPYWIAPEVLEGEHYTEQADIYSFGVVLSELDTGKIPYHDAVTEDG  1171

Query  425   TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHEL  474
             TKLKP +IL EVMSGT+RPSF+ +CP RI+RI TACLSLDPSSRPTA EL
Sbjct  1172  TKLKPFRILNEVMSGTLRPSFAGDCPARIQRISTACLSLDPSSRPTAQEL  1221

 Score = 495 bits (1275),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 274/557 (49%), Positives = 350/557 (63%), Gaps = 75/557 (13%)

Query  2     GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50
             G++TMA++AVPK DV+   CT+ NCSQP+  TA+Y   C+G QML+VSR           
Sbjct  1403  GDHTMAEIAVPKDDVADAKCTFKNCSQPDDETAYYTLICSGDQMLSVSRCVVDTFQDTGA  1462

Query  51    -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99
                    W    DP M P IRLRDH W   +       TF VY VHTV    D AWNECP
Sbjct  1463  LNFMGAMWSRGGDPDMAPMIRLRDHTWTDPVSN----DTFTVYAVHTVSGAEDVAWNECP  1518

Query  100   LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQL-LIPVIL  158
                GY SL++PCHRR E+TD+ +AA TT PAGSA+VT WL+ EFA +     L LI +I 
Sbjct  1519  ASNGYGSLSIPCHRRSEYTDNEIAALTT-PAGSAWVTAWLEDEFAVDTGVDTLMLILLIA  1577

Query  159   GVAIAVAGMALGWLSCR----RKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQ  214
             G  + +  + LGW   R    RK E +      +          G+     A+   +   
Sbjct  1578  GTLVLIGAIGLGWYCWRHRSMRKEEYTAPTICDLSVPSPGYHGGGTPDLGLALR-GTTAS  1636

Query  215   RRDSAIQSLYC-----ERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWV  266
              R +   S++      E AGSN TL   LDS HL GKRIP++S+ F++ ISKGASGEVW+
Sbjct  1637  TRPTGQSSIFSYSGDFESAGSNNTLKILLDSYHLYGKRIPYESLTFQKTISKGASGEVWL  1696

Query  267   CEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVL  326
             C +N Q+ AVKRLLQ   QKA++VQ FA EIEL+ASL+HPNIV+FIGVAWNSL+NL MV+
Sbjct  1697  CLYNEQQVAVKRLLQ-SNQKADNVQAFAEEIELSASLVHPNIVEFIGVAWNSLNNLAMVI  1755

Query  327   EYLSTGSLKEFLEEP---------------------------------REFMSSNVLLTD  353
             E+   G+L+ +L++                                  R+  S+N+LLTD
Sbjct  1756  EFSPAGNLQTYLQKNIDLLSWARDKIHMAIGVAQALQYLHTRVPAIIHRDLKSNNILLTD  1815

Query  354   SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
              +EPK+IDFGVSRGL DL+MTAGVGTP+WTAPEILEG  YT +AD+YSFGVVLSELDTG+
Sbjct  1816  RLEPKLIDFGVSRGLGDLTMTAGVGTPYWTAPEILEGKRYTVQADIYSFGVVLSELDTGR  1875

Query  414   VPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
             +PY+DA TE G K K  QIL++VM+G +RPSFS +CPPRI+R+G ACL+ DPSSRPTA +
Sbjct  1876  IPYYDAATEGGGKAKSFQILQDVMAGMLRPSFSRDCPPRIQRVGLACLAFDPSSRPTACQ  1935

Query  474   LVRQLEGRDSeeeeeGA  490
             LV +LEG  +E    G+
Sbjct  1936  LVEELEGNSTELTPPGS  1952

 Score = 464 bits (1193),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 307/473 (65%), Gaps = 85/473 (18%)

Query  52   DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPC  111
            D  MTP +RLRDH W +  P  G  I++ VY VHT     DP W++CP  +GY+SL VPC
Sbjct  141  DSAMTPHVRLRDHSWTE--PTTG--ISYSVYAVHTSSSADDPTWSQCPASDGYSSLIVPC  196

Query  112  HRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ--LLIPVILGVAIAVAGMAL  169
            HRR EFTD  MAA TT PAGSA+VTTWL+ EFA E S     LL+P+ILG ++AV  + +
Sbjct  197  HRRDEFTDGEMAAMTT-PAGSAWVTTWLEDEFAAESSGFNELLLVPIILG-SLAVI-VVI  253

Query  170  GWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAG  229
             WL     LE+    + G                               A+  L      
Sbjct  254  RWLVL---LESESNDEGG-------------------------------AVLVL------  273

Query  230  SNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAES  289
                LL S+HL+G R+P+D + F+  ISKG SGEVW+CE+   + AVK+LL  K+QKAE 
Sbjct  274  ---ILLYSQHLQGNRLPYDRLTFKSEISKGGSGEVWLCEYGGGQVAVKKLLHTKEQKAED  330

Query  290  VQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP--------  341
            VQ FA EIELTASL+HPNIV+FIGVAWNSL+NLVMVLEY+  G+LK +L +         
Sbjct  331  VQAFAQEIELTASLVHPNIVRFIGVAWNSLNNLVMVLEYVPMGNLKNYLHKSAVLLSWAR  390

Query  342  -------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                                     R+  S+N+LL+ ++EPK+IDFGVSRGL+DL+MTAG
Sbjct  391  DKIHMATGIAEALEYLHSRTPAIIHRDLKSNNILLSRNLEPKLIDFGVSRGLIDLTMTAG  450

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEV  436
            VGTP+W APE+LEGN YTEK D+YSFGVVLSELDTG++PY DAVT DGTK+KP Q+L EV
Sbjct  451  VGTPYWVAPEVLEGNRYTEKGDIYSFGVVLSELDTGKIPYFDAVTADGTKMKPFQVLNEV  510

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRDSeeeeeG  489
            MSG++RPS SDECPPRIRRIGTACLSLDP+SRPTA ELV +L GR+S     G
Sbjct  511  MSGSLRPSLSDECPPRIRRIGTACLSLDPASRPTAQELVDELGGRESLSSSIG  563

>HYAP_14440
Length=647

 Score = 477 bits (1228),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 255/544 (47%), Positives = 340/544 (63%), Gaps = 70/544 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            + N+TMADLAVP+  V    CT   C QPN +T +Y Q C+G QML+ SR          
Sbjct  101  LQNFTMADLAVPEKQVKTAGCTLKKCVQPNDITGYYTQTCSGTQMLSASRCVIDTFKDDG  160

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP MTP IRLRDH W   I       +F VY VHTVP+ LD  WN+C
Sbjct  161  AVGFLGAMWSKGGDPGMTPLIRLRDHSWTDPISN----DSFSVYAVHTVPNALDAVWNQC  216

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS-PSQLLIPVI  157
            P+   YASLTVPCHRR   TD+   A  +VP+GS +VTTWL+ +F       + +++ +I
Sbjct  217  PVHTKYASLTVPCHRRDMITDEVKMA-MSVPSGSDWVTTWLENDFVVPSGFDTSMVVAII  275

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRD  217
            L V   +  +A GW  CR +   S K  S +            +   +  + S+ +  R 
Sbjct  276  LAVLTMLVILAFGWYCCRHRSSRSKKAASSVYKLAGDAPQYSDAWTSKTGNRSTDRSLRL  335

Query  218  SAIQSLYC-----ERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEF  269
            +   SL+      E AGSN+TL   L S+ L+ KRIP+++++ +  ISKGASGEVW+C +
Sbjct  336  THQSSLFSSSGDFESAGSNRTLKILLGSKCLQQKRIPYENLMLQEPISKGASGEVWICAY  395

Query  270  NRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYL  329
              +  AVKRL+ R  + AE+V+ FA EIEL+ASL+HPN+V+FIGVAWNSLDNL MVLEY 
Sbjct  396  RGKTVAVKRLI-RGSRNAETVRTFAEEIELSASLVHPNVVEFIGVAWNSLDNLAMVLEYF  454

Query  330  STGSLKEFLEEPREFMS---------------------------------SNVLLTDSIE  356
              G+L+ +L +  + +S                                 +N+LLTD+++
Sbjct  455  PRGNLQNYLHKNADLLSWARDKIQMAVAIAQALQYLHGRSPAIIHRDLKCNNILLTDNLQ  514

Query  357  PKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY  416
            PK+IDFGVSRGLVD++MTAGVGTP+W APEILEG  YTE+AD+YSFGVVLSELDTG++PY
Sbjct  515  PKLIDFGVSRGLVDITMTAGVGTPYWAAPEILEGKRYTEQADIYSFGVVLSELDTGEIPY  574

Query  417  HDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVR  476
            H+AVTE G +    QIL++VM+G++RPSFS +CPPRIRR+G ACLSLDPS RPT ++L++
Sbjct  575  HNAVTESGGQATSFQILQDVMAGSLRPSFSRDCPPRIRRVGLACLSLDPSDRPTTNQLIQ  634

Query  477  QLEG  480
             LEG
Sbjct  635  GLEG  638

>PHYSO_520017
Length=661

 Score = 474 bits (1221),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 255/547 (47%), Positives = 341/547 (62%), Gaps = 75/547 (14%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M NYTMA+++VP+ D++ V+CT L C QPN   A+ +QYCTG Q+LNVSR          
Sbjct  123  MENYTMANISVPQQDIAEVNCTMLECPQPNSEPAYSSQYCTGSQILNVSRCVADTFEDSG  182

Query  51   --------WD----PTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W       MTP IRLRDH W +  P  G    + +Y +HT     DP WN+C
Sbjct  183  ASGYLGVMWSTGGSANMTPLIRLRDHSWVE--PTTGD--AYELYAIHTESSADDPTWNQC  238

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ--LLIPV  156
            P + GY+SL VPCH+R EFTD  +AA  T PAGS +VT WL++EFA +       LLIP+
Sbjct  239  PANGGYSSLVVPCHKRSEFTDKDIAA-MTKPAGSNWVTNWLREEFAVKKPRFNKLLLIPI  297

Query  157  ILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRR  216
            ILG  + VA  A   +  +R+     K+++G   +                +++SP    
Sbjct  298  ILGSLVTVAAGAFVGVYLKRR----AKRRNGEVPDDYEAFQHHYVAGESYDAVTSPVMST  353

Query  217  D------SAIQSLYCERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVC  267
            D      S+ ++   E  GSN+T   LL S HL G RIP+D++VFE  +S+G SG VW+C
Sbjct  354  DPSYAFSSSSRAENYESVGSNQTFRILLHSPHLHGNRIPYDNLVFESKLSRGGSGVVWLC  413

Query  268  EFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLE  327
            ++  Q+ A K+LL  +  KA+ VQ FA EIELTASL+HP IV+FIGVAWN+L NL MV+E
Sbjct  414  KYGGQQVAAKKLLLTRGVKADDVQSFAEEIELTASLVHPYIVKFIGVAWNNLTNLSMVIE  473

Query  328  YLSTGSLKEFLEEP---------------------------------REFMSSNVLLTDS  354
            Y+  G+L+++LE+                                  R+   +N+LLT  
Sbjct  474  YVPNGNLRDYLEKNIRILSWARDKIHIAIAIAEALEYLHSRTPGVIHRDLKFNNILLTKH  533

Query  355  IEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQV  414
            +EPK+ DFGVSR ++D +MT+GVGTP+WTAPEILEG+ YTEK+D+YSFGVVLSELDTG++
Sbjct  534  LEPKLTDFGVSRNMIDSTMTSGVGTPYWTAPEILEGDRYTEKSDIYSFGVVLSELDTGRI  593

Query  415  PYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHEL  474
            PY DAV EDG+K++P  IL+EVM+G MRP+FS +CPPRI+RIG ACLSLDP  RPTA EL
Sbjct  594  PYSDAVMEDGSKVRPFHILQEVMAGAMRPNFSRDCPPRIQRIGAACLSLDPRKRPTAREL  653

Query  475  VRQLEGR  481
            V +L G+
Sbjct  654  VLELLGK  660

>PPTG_16185
Length=632

 Score = 469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 252/545 (46%), Positives = 341/545 (63%), Gaps = 71/545 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            + NYTMA+LAVP  +VS   CT+ NCSQPN  TA Y   C+G QM +VSR          
Sbjct  85   INNYTMAELAVPMDEVSDAGCTFRNCSQPNNETASYTLICSGEQMFSVSRCVVDIFEDNG  144

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W     P M P IRLR+HKW   +      +++ VY VHTVP +L+  WN+C
Sbjct  145  AGTYFGAMWAKGGHPDMAPHIRLREHKWNDPVSN----VSYSVYAVHTVPSELEATWNQC  200

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSP---SQLLIP  155
               +GY +L VPC+RR   T + M A  T P GS++VT WL +EF ++      + +L+ 
Sbjct  201  APYDGYGALAVPCYRRDNVTVE-MDAQLTTPTGSSWVTNWLDEEFGEKSDQGLDTMVLVL  259

Query  156  VILGVAIAVAGMALGWLSCRRKLEASMK----QKSGIEHerrsqrssgssqerrAISISS  211
            +I+G  I +    LGW   RR+ +        +  G + E     +   ++   A S   
Sbjct  260  IIVGSVIVLGLFGLGWYCWRRRSKRREGKPELEADGFDVESPFYMTPELAKPPAASSGRP  319

Query  212  PQQRRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCE  268
             QQ    +  S+  E AGSN+TL   L S +L+G+RIP++S+VF+  +SKG +GEVW+CE
Sbjct  320  TQQSSLFSQSSIDYESAGSNRTLEILLHSRYLQGRRIPYESVVFKTTLSKGVNGEVWMCE  379

Query  269  FNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEY  328
            +N +K AVK L+Q + QKAE+VQ FA EIEL+ASL+HP+IV+FIGVAWNSL+NL MVLEY
Sbjct  380  YNGRKVAVKHLIQ-ENQKAETVQAFAEEIELSASLVHPSIVEFIGVAWNSLNNLAMVLEY  438

Query  329  LSTGSLKEFLEEP---------------------------------REFMSSNVLLTDSI  355
               G+L+ +L +                                  R+  S+N+LLT  +
Sbjct  439  FPKGNLQSYLHKNADLLTWARDKIQMAVAVADALQYLHGRFTPIIHRDLKSNNILLTKQL  498

Query  356  EPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVP  415
            EPK+IDFGVSRG V+L+MTAG+GTP+WTAPEILEG  YTE+AD+YSFGVVLSELDTG+ P
Sbjct  499  EPKLIDFGVSRGRVELTMTAGIGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGKTP  558

Query  416  YHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELV  475
            YHDA T+ G+K KP QIL++++ G ++PSF+ +CPPRI R+G ACLS DPS RPTA +L+
Sbjct  559  YHDARTQGGSKAKPFQILQDIVDGCLQPSFTRQCPPRIYRVGMACLSFDPSLRPTASQLI  618

Query  476  RQLEG  480
            R+LEG
Sbjct  619  RELEG  623

>PHYSO_337952
Length=619

 Score = 452 bits (1164),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 252/538 (47%), Positives = 336/538 (62%), Gaps = 89/538 (17%)

Query  4    YTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-------------  50
            ++MADLA+P +DV  VDCT  NCSQPN +TA+ +Q C+  Q+LN+ R             
Sbjct  112  HSMADLALPVSDVLTVDCTMTNCSQPNNITAYSSQSCSSSQILNMVRCVADTFEDNGAGT  171

Query  51   -----W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLD  101
                 W    DP   P + LR+H W +   +   +I   VY VHT P   + AW  CP  
Sbjct  172  YLGTFWANGGDPGGIPGLLLREHSWAESTAQNETVIN-SVYAVHTTPSADEAAWATCP-T  229

Query  102  EGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILGVA  161
             GYAS TVPC RR  +  D   A   VP  SA+VT WL++EFA    P  L+I +++   
Sbjct  230  SGYASFTVPCQRRDAYRGD--TAGLRVPKASAWVTKWLEEEFAH-GFPLSLVIVIVVS--  284

Query  162  IAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQ  221
             A+A + +G     R+++  +KQ+S                     S +S + R     +
Sbjct  285  -AIAAIGIGAFCWHRRIQ-RVKQQS---------------------STTSSEARLRPPAE  321

Query  222  SLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKR  278
            S+Y E AG+N+TL   L+SE+L+GKRIP++S+VF++ +SKGA GEVW+C++NR+K AVKR
Sbjct  322  SVY-EAAGTNETLHLLLNSEYLQGKRIPYESLVFDKALSKGAYGEVWLCDYNREKVAVKR  380

Query  279  LLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL  338
            LLQ K+QKA+ V  FA EIEL+ASL+HPNIV+FIGVAWNSL NLVMVLE+   GSL+ +L
Sbjct  381  LLQSKQQKADKVHAFAEEIELSASLVHPNIVEFIGVAWNSLSNLVMVLEFFPKGSLQNYL  440

Query  339  EEP---------------------------------REFMSSNVLLTDSIEPKIIDFGVS  365
             +                                  R+  S+N+LLT+++ PK+IDFGVS
Sbjct  441  HQGGGQLSWASDKITLAIGIARALDYLHARTPPLIHRDLKSNNILLTEALGPKLIDFGVS  500

Query  366  RGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT  425
            RG VDL+MTAGVGTP+WTAPEILE   Y EKAD+YSFGVVLSELDT ++P+ DA+TEDG+
Sbjct  501  RGKVDLTMTAGVGTPYWTAPEILESKRYDEKADVYSFGVVLSELDTCEIPFSDALTEDGS  560

Query  426  KLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRDS  483
            K KP QIL+ VM GT++P FS +CPP IR+I  +CL LDP+ RPTA +L+R LE  DS
Sbjct  561  KAKPFQILQNVMKGTLQPRFSTDCPPVIRQIALSCLKLDPADRPTASQLIRDLESSDS  618

>PHYKE_3
Length=598

 Score = 451 bits (1161),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 243/485 (50%), Positives = 311/485 (64%), Gaps = 61/485 (13%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            M NY+MAD+AVP +DV+ VDCT+LNCSQP+G  A+Y+QYCTG+QMLNVSR          
Sbjct  116  MKNYSMADIAVPMSDVTKVDCTFLNCSQPDGEVAYYSQYCTGYQMLNVSRCVADIFEDSS  175

Query  51   --------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W    DP M P +RL DH W +        +++ VYVVHTV  + DPAWN C
Sbjct  176  ARDFMGMMWSKGGDPDMAPELRLLDHAWTEYNNWTDTNVSYSVYVVHTVSRENDPAWNNC  235

Query  99   PLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ-LLIPVI  157
            P + GYASLTVPCHR  +++ D +AA T   +GSA++TTWL+QEFA++ S +  LL+P+I
Sbjct  236  PANNGYASLTVPCHRSDQYSADELAAMTKT-SGSAWMTTWLEQEFAEDSSFNLVLLVPII  294

Query  158  LGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRD  217
            LGV + +A +  GW   RR+ +A  K  S    E   Q           IS         
Sbjct  295  LGVLVVIAAIG-GWFWWRRRSKAKAKNLSTGGCEIGVQSPEYLGGSTPEISRMPTVMTNQ  353

Query  218  SAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            +    L  E AGSNKTL   L S+HL GKRI ++S+ FE+ +SKGASGEVWVCE+N  K 
Sbjct  354  TTSSHLEYESAGSNKTLKILLGSQHLMGKRISYESLTFEKALSKGASGEVWVCEYNSHKV  413

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            AVKRLLQ K Q A SVQ FA EIEL+A+L HP+IV FIGVAWNSL+NLVMVLE+L  G+L
Sbjct  414  AVKRLLQTKDQNAGSVQAFAEEIELSATLDHPHIVSFIGVAWNSLNNLVMVLEFLPQGNL  473

Query  335  KEFLEEP---------------------------------REFMSSNVLLTDSIEPKIID  361
            + +L++                                  R+  S+N+LLT  +EPK+ID
Sbjct  474  QNYLQKNADLLSWARDKIQMAIGIAQALEYLHNRTPPLIHRDLKSNNILLTSHLEPKLID  533

Query  362  FGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT  421
            FGVSR   +++MTAGVGTP+WTAPE+LEG  YTE+AD+YSFGVVLSELDT ++PY DAVT
Sbjct  534  FGVSRDRTEITMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLSELDTCKIPYADAVT  593

Query  422  EDGTK  426
            EDG++
Sbjct  594  EDGSR  598

>PITG_00004
Length=614

 Score = 439 bits (1130),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 252/537 (47%), Positives = 321/537 (60%), Gaps = 101/537 (19%)

Query  2    GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50
            G++TMAD+AV   D++ V+CT L C QPN   A+ +QYC+G Q+LNVSR           
Sbjct  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180

Query  51   -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99
                   W    D TMTP IRLRDH W +  P  G  +++ VY VHTV    DP WN+CP
Sbjct  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTE--PTTG--VSYSVYAVHTVSSADDPTWNQCP  236

Query  100  LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILG  159
            ++ GY+SL VPCH+R EF+D  MAA    P GS +VT WLK EFA  DS          G
Sbjct  237  VNNGYSSLIVPCHKRSEFSDAEMAA-VNKPRGSEWVTMWLKDEFAVGDSS---------G  286

Query  160  VAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSA  219
                +    L   SC      S      + HE+  + +  ++    +IS          +
Sbjct  287  FDELLLIPILLSSSCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSIS----------S  336

Query  220  IQSLYCERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAV  276
             Q  Y E AGSN+T   LL S+HL G RIP++S+ F+  +SK ASGE W+C++ R  A  
Sbjct  337  HQGDY-ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA--  393

Query  277  KRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKE  336
                            FA EIELTASLIHP+IV+FIGVAWNSL NL MVLE++S G L+ 
Sbjct  394  ----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQG  437

Query  337  FLEEP---------------------------------REFMSSNVLLTDSIEPKIIDFG  363
            FL +                                  R+  S+N+LLT+ ++PK+IDFG
Sbjct  438  FLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFG  497

Query  364  VSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED  423
            VSRG++DL+MTAGVGTP+WTAPE+LEG  Y+EKAD+YSFGVVLSELDTG++PY D V  D
Sbjct  498  VSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD  557

Query  424  GTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            G KL P QIL+EVM+GT+RPSFS +CPPRI+RI  ACLS DPS RPTA EL++ LEG
Sbjct  558  GAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614

>PHYSO_520064
Length=669

 Score = 415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 242/569 (43%), Positives = 330/569 (58%), Gaps = 92/569 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++MADLA+P      V CT +NC+QP+  T++   YC G QMLN +R          
Sbjct  106  LGGHSMADLAIPLVQFQDVGCTEMNCTQPDNTTSYSNLYCNGEQMLNAARCVMDDFTDPV  165

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P   P  R+R H+WE+D  +    I + V  VHTV  + +PA+  CP 
Sbjct  166  GIHGAMWITGGNPKSIPVPRVRKHEWEEDSTK----IPYTVLAVHTVDKNDEPAYGVCPS  221

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
               ++GY SL + C+  ++ +DD  +A   V  G+ +V+ WL ++++   + S       
Sbjct  222  KDENDGYGSLVLSCYSSLKVSDDVRSAMEEV-QGTPWVSRWLVEDYSGASTSSTDSKNGF  280

Query  152  ---LLIPVILGVAIAVAGMALG-WLSCRRKLEAS-------MKQKSGIEHerrsqrssgs  200
                L+P++ G  I V  + L  ++  RR   AS       +   + + H       +  
Sbjct  281  NMLFLVPIVAGTVIVVGLVGLVVFIRHRRSKNASNNSPNENLGSPNSLYHGNNMDTPADY  340

Query  201  sqerrAISISSPQQ-------------RRDSAI-QSLYCERAGSNKTLLDSEHLEGKRIP  246
            +  R   +  + Q              RR S + ++L  E  G+ KTLL SE+L GKRIP
Sbjct  341  NNARGRPTNETIQNTDTSSSANTWNGLRRTSTLGENLSSESNGTLKTLLGSEYLVGKRIP  400

Query  247  FDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHP  306
            +++I FER +SKGA GEVWV E   Q+ A+KRL Q KK +AE V++FA EIEL+ASL+HP
Sbjct  401  YEAIRFERALSKGAYGEVWVGELQGQQVAIKRLFQSKKNRAEDVEEFAKEIELSASLVHP  460

Query  307  NIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL----------------------------  338
            NIV F+GVAWNSL+NLVMVLE+   G L+ +L                            
Sbjct  461  NIVAFVGVAWNSLNNLVMVLEFFPLGDLQGYLAKNADLLTWAKDKIDVAIGVGRALAYLH  520

Query  339  -EEP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHY  393
              EP    R+  S N+LLT  +EPK+IDFGVSRG  + SMTAGVGTP+WTAPEILEG  Y
Sbjct  521  AREPPLIHRDLKSKNILLTRKLEPKLIDFGVSRGREEYSMTAGVGTPYWTAPEILEGRRY  580

Query  394  TEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRI  453
            TE+AD+YSFGVVLSELDT ++PYHDA+T+DG K KP QIL +VM+GT+RPSFS+ CP RI
Sbjct  581  TEQADIYSFGVVLSELDTCKLPYHDALTQDGQKPKPFQILADVMAGTLRPSFSESCPRRI  640

Query  454  RRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            RRIG AC   DP+ RPTA ++V  LEG D
Sbjct  641  RRIGVACCQQDPARRPTAAQVVVMLEGGD  669

>PHYSO_519624
Length=669

 Score = 415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 242/569 (43%), Positives = 330/569 (58%), Gaps = 92/569 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++MADLA+P      V CT +NC+QP+  T++   YC G QMLN +R          
Sbjct  106  LGGHSMADLAIPLVQFQDVGCTEMNCTQPDNTTSYSNLYCNGEQMLNAARCVMDDFTDPV  165

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P   P  R+R H+WE+D  +    I + V  VHTV  + +PA+  CP 
Sbjct  166  GIHGAMWITGGNPKSIPVPRVRKHEWEEDSTK----IPYTVLAVHTVDKNDEPAYGVCPS  221

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
               ++GY SL + C+  ++ +DD  +A   V  G+ +V+ WL ++++   + S       
Sbjct  222  KDENDGYGSLVLSCYSSLKVSDDVRSAMEEV-QGTPWVSRWLVEDYSGASTSSTDSKNGF  280

Query  152  ---LLIPVILGVAIAVAGMALG-WLSCRRKLEAS-------MKQKSGIEHerrsqrssgs  200
                L+P++ G  I V  + L  ++  RR   AS       +   + + H       +  
Sbjct  281  NMLFLVPIVAGTVIVVGLVGLVVFIRHRRSKNASNNSPNENLGSPNSLYHGNNMDTPADY  340

Query  201  sqerrAISISSPQQ-------------RRDSAI-QSLYCERAGSNKTLLDSEHLEGKRIP  246
            +  R   +  + Q              RR S + ++L  E  G+ KTLL SE+L GKRIP
Sbjct  341  NNARGRPTNETIQNTDTSSSANTWNGLRRTSTLGENLSSESNGTLKTLLGSEYLVGKRIP  400

Query  247  FDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHP  306
            +++I FER +SKGA GEVWV E   Q+ A+KRL Q KK +AE V++FA EIEL+ASL+HP
Sbjct  401  YEAIRFERALSKGAYGEVWVGELQGQQVAIKRLFQSKKNRAEDVEEFAKEIELSASLVHP  460

Query  307  NIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL----------------------------  338
            NIV F+GVAWNSL+NLVMVLE+   G L+ +L                            
Sbjct  461  NIVAFVGVAWNSLNNLVMVLEFFPLGDLQGYLAKNADLLTWAKDKIDVAIGVGRALAYLH  520

Query  339  -EEP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHY  393
              EP    R+  S N+LLT  +EPK+IDFGVSRG  + SMTAGVGTP+WTAPEILEG  Y
Sbjct  521  AREPPLIHRDLKSKNILLTRKLEPKLIDFGVSRGREEYSMTAGVGTPYWTAPEILEGRRY  580

Query  394  TEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRI  453
            TE+AD+YSFGVVLSELDT ++PYHDA+T+DG K KP QIL +VM+GT+RPSFS+ CP RI
Sbjct  581  TEQADIYSFGVVLSELDTCKLPYHDALTQDGQKPKPFQILADVMAGTLRPSFSESCPRRI  640

Query  454  RRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            RRIG AC   DP+ RPTA ++V  LEG D
Sbjct  641  RRIGVACCQQDPARRPTAAQVVVMLEGGD  669

>PHYSO_485044
Length=669

 Score = 415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 242/569 (43%), Positives = 330/569 (58%), Gaps = 92/569 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++MADLA+P      V CT +NC+QP+  T++   YC G QMLN +R          
Sbjct  106  LGGHSMADLAIPLVQFQDVGCTEMNCTQPDNTTSYSNLYCNGEQMLNAARCVMDDFTDPV  165

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P   P  R+R H+WE+D  +    I + V  VHTV  + +PA+  CP 
Sbjct  166  GIHGAMWITGGNPKSIPVPRVRKHEWEEDSTK----IPYTVLAVHTVDKNDEPAYGVCPS  221

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
               ++GY SL + C+  ++ +DD  +A   V  G+ +V+ WL ++++   + S       
Sbjct  222  KDENDGYGSLVLSCYSSLKVSDDVRSAMEEV-QGTPWVSRWLVEDYSGASTSSTDSKNGF  280

Query  152  ---LLIPVILGVAIAVAGMALG-WLSCRRKLEAS-------MKQKSGIEHerrsqrssgs  200
                L+P++ G  I V  + L  ++  RR   AS       +   + + H       +  
Sbjct  281  NMLFLVPIVAGTVIVVGLVGLVVFIRHRRSKNASNNSPNENLGSPNSLYHGNNMDTPADY  340

Query  201  sqerrAISISSPQQ-------------RRDSAI-QSLYCERAGSNKTLLDSEHLEGKRIP  246
            +  R   +  + Q              RR S + ++L  E  G+ KTLL SE+L GKRIP
Sbjct  341  NNARGRPTNETIQNTDTSSSANTWNGLRRTSTLGENLSSESNGTLKTLLGSEYLVGKRIP  400

Query  247  FDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHP  306
            +++I FER +SKGA GEVWV E   Q+ A+KRL Q KK +AE V++FA EIEL+ASL+HP
Sbjct  401  YEAIRFERALSKGAYGEVWVGELQGQQVAIKRLFQSKKNRAEDVEEFAKEIELSASLVHP  460

Query  307  NIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL----------------------------  338
            NIV F+GVAWNSL+NLVMVLE+   G L+ +L                            
Sbjct  461  NIVAFVGVAWNSLNNLVMVLEFFPLGDLQGYLAKNADLLTWAKDKIDVAIGVGRALAYLH  520

Query  339  -EEP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHY  393
              EP    R+  S N+LLT  +EPK+IDFGVSRG  + SMTAGVGTP+WTAPEILEG  Y
Sbjct  521  AREPPLIHRDLKSKNILLTRKLEPKLIDFGVSRGREEYSMTAGVGTPYWTAPEILEGRRY  580

Query  394  TEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRI  453
            TE+AD+YSFGVVLSELDT ++PYHDA+T+DG K KP QIL +VM+GT+RPSFS+ CP RI
Sbjct  581  TEQADIYSFGVVLSELDTCKLPYHDALTQDGQKPKPFQILADVMAGTLRPSFSESCPRRI  640

Query  454  RRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            RRIG AC   DP+ RPTA ++V  LEG D
Sbjct  641  RRIGVACCQQDPARRPTAAQVVVMLEGGD  669

>PHYRA_84555
Length=663

 Score = 403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 235/563 (42%), Positives = 318/563 (56%), Gaps = 87/563 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++M DLAVP A    V C  +NC+QP+  T    + C G QMLN  R          
Sbjct  101  LAGHSMTDLAVPLAQFQAVGCVEMNCTQPDNTTRLSNRNCNGAQMLNAVRCVMEDFEDPE  160

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    DP   P  R+R H+W       G +I + V  VHTV  D +P W ECP 
Sbjct  161  NIHASMWVTGGDPKAVPVPRVRKHEWIDG--SSGSVINYTVLAVHTVDIDNEPGWGECPT  218

Query  101  DE---GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
            D    GY SL + CH   E +D+ M     V  GS +V+ WL  E++   S         
Sbjct  219  DAQNGGYGSLVLSCHSTAETSDEVMNEKQEV-EGSPWVSRWLVDEYSSVASTGSGKFDLV  277

Query  152  LLIPVILGVAIAVAGMALGWLSCRRK--------LEASMKQKS---GIEHerrsqrssgs  200
            L+ P++ GV + V  + L     RR+        +E+  ++ S   G   +  +  +   
Sbjct  278  LIAPIVAGVCVIVGVIGLVIFFKRRRSNRADNVLIESPQERPSSMYGAYKDTAADGAKNG  337

Query  201  sqerrAISI----SSPQQRRDSAIQ--SLYCE--RAGSNKTL---LDSEHLEGKRIPFDS  249
                   +I    ++P +R D  ++  SLY +   +GSN+TL   L SE L GKRIP++ 
Sbjct  338  PCRSTEGTIEDAETAPYRRCDDGVKRSSLYEDDFSSGSNETLKILLRSEFLVGKRIPYEM  397

Query  250  IVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIV  309
            + +ER +SKGASGEVWV E+  ++ A+KRLLQ K  +AE V++FA EIEL+ASLIHPNIV
Sbjct  398  LTYERALSKGASGEVWVGEYEGKQVAMKRLLQTKNNRAEQVEEFAKEIELSASLIHPNIV  457

Query  310  QFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------------------  341
             F+GVAWNSL+NLVMVLE+   G L E+L +                             
Sbjct  458  AFLGVAWNSLNNLVMVLEFFPVGDLHEYLSKNSDLLSWTKDKMEIAVGVMRAVGYLHSRT  517

Query  342  -----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEK  396
                 R+  S N+LLT  +EPK+IDFGVSR   + SMTAGVGTP+WTAPEILEG  YTE+
Sbjct  518  PPLIHRDLKSKNILLTRRLEPKLIDFGVSRDRQEHSMTAGVGTPYWTAPEILEGKRYTEQ  577

Query  397  ADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRI  456
            +D+YSFGVVL+ELDTG++PYHDA+T DG K KP  IL +VM+G +RP+FSD+CP  +RRI
Sbjct  578  SDIYSFGVVLTELDTGKIPYHDALTPDGKKPKPFHILADVMAGVLRPNFSDDCPRAVRRI  637

Query  457  GTACLSLDPSSRPTAHELVRQLE  479
            G AC   DP  RPTA ++++ L+
Sbjct  638  GVACCQQDPERRPTAAQILQMLK  660

>PITG_20766
Length=704

 Score = 391 bits (1005),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 318/577 (55%), Gaps = 100/577 (17%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNG-VTAHYAQYCTGWQMLNVSR---------  50
            +G ++M+DLAVP      V+C   NC+QP   + +    YC+G QML  +R         
Sbjct  133  LGGHSMSDLAVPLDQFRAVECEETNCTQPGTTIVSRSNLYCSGTQMLTAARCVVEDFDES  192

Query  51   -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99
                   W    +PT+ P+ ++R H W+ D       I++ V  VHTV  D + A+ ECP
Sbjct  193  DRLHLAMWMTGGNPTVIPTPQVRKHSWKDDFSN----ISYVVMAVHTVVGDDEAAYGECP  248

Query  100  LDE--GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
             ++  GY SL +PCH     TDD   A   V  GS +VT W ++E+++    +       
Sbjct  249  KEQNGGYGSLVLPCHTTKYLTDDVRDAMEEV-QGSPWVTKWFREEYSEMSKTTSATSSDK  307

Query  152  -------LLIPVILGVAIAVAGMALGWLSCR---RKLEA----------------SMKQK  185
                   L+ P++ GV + V  +AL   + R   R +E                 S+KQ 
Sbjct  308  DGGFNAVLIAPILAGVLVVVGLIALFVFAKRKRQRNIEGDALEDSLIYLDTCRPDSLKQD  367

Query  186  SGIEHerrsqrssgssqerrAISISSPQQRR----DSAIQSLYCERAGSNKTL---LDSE  238
            +  E E      S +      +++S     +     S+  S     +G N TL   L+SE
Sbjct  368  NAAESEFAHGDGSTAKTLDDTLTVSHKGVDKTIKFKSSTSSASDFGSGPNSTLQILLNSE  427

Query  239  HLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIE  298
             L GKRIP+DS+ F++ +SKGA GEVW+ E+  Q+ A+KRLLQ K  +A+ V++FA EIE
Sbjct  428  GLIGKRIPYDSLSFKKSLSKGACGEVWLGEYEGQQVAIKRLLQIKSHRADEVEEFAREIE  487

Query  299  LTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------  341
            L+ASL+HPNIV FIGVAWNSL NLVM LE+   G L+E+L +                  
Sbjct  488  LSASLVHPNIVSFIGVAWNSLSNLVMALEFFPMGDLQEYLAKNGDLLSWPRDKIQIAVGV  547

Query  342  ----------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAP  385
                            R+  S N+LLT  +E K+IDFGVSR   + SMTAGVGTP+WTAP
Sbjct  548  GRALEYLHCRSPPLIHRDLKSKNILLTSRLEAKLIDFGVSRDRQEYSMTAGVGTPYWTAP  607

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSF  445
            E+LEG  YTE+AD+YSFGVVL+ELDT +VPYHDA+T +G K KP QIL +VM+G +RPSF
Sbjct  608  EVLEGKRYTEQADIYSFGVVLTELDTSKVPYHDALTAEGKKPKPFQILTDVMAGMLRPSF  667

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            S+ CP RIRRIG AC   DP  RPTA ++   L+  D
Sbjct  668  SENCPSRIRRIGVACCQHDPIRRPTAAQVADMLQAAD  704

>PPTG_16198
Length=656

 Score = 385 bits (990),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 228/561 (41%), Positives = 322/561 (57%), Gaps = 84/561 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            + +++MADLAVPK+    V+CT   C+Q +G  ++    C G  ML  +R          
Sbjct  101  LNDHSMADLAVPKSRYEAVNCTVKECTQRDGSISYANYKCLGRDMLKAARCVVEDFEDET  160

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP-  99
                  W    DP + P++R+  H+W +D+ +    I   V+ VHT+  + +PAW++C  
Sbjct  161  DIHAAMWVTGGDPEVVPTLRVNKHEW-KDMHDNNSYI---VFAVHTIDQNGEPAWDQCAK  216

Query  100  --LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
               + GY SL +PCH     T +  ++   V  GSA+V+ WL +E++     +       
Sbjct  217  ANQNNGYGSLVLPCHTTANITAEINSSKQEV-TGSAWVSQWLVEEYSSVAGTTDDGEINL  275

Query  152  -LLIPVILGVAIAVAGMALG-WLSCRRK--------LEASMKQKSGIEHerrsqrssgss  201
             LL P++ GV + +  + L  +L  RR+         E+ +   +  +  R     + S+
Sbjct  276  SLLAPIVAGVLVVIGVIGLFVFLKKRRQSREDPIGFTESPVCPDNYYQSCRDLDFGARST  335

Query  202  qerrAISISSPQQRRDSAIQ---SLYCE-RAGSNKTL---LDSEHLEGKRIPFDSIVFER  254
                  S ++  +  D  I+   S   E  +GSN+TL    +SE L GKR+ +DSI+F++
Sbjct  336  VHTVVDSETATYKGVDRTIKLKPSYTGEFGSGSNRTLNILHNSEFLVGKRLSYDSIIFKQ  395

Query  255  VISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGV  314
             +SKGA+GEVW+CE   ++ AVKRL Q +   A  V++FA EIEL+ASL HPNIV FIG+
Sbjct  396  ALSKGANGEVWLCECQNEQVAVKRLFQNQNHHAGEVEEFAQEIELSASLKHPNIVSFIGM  455

Query  315  AWNSLDNLVMVLEYLSTGSLKEFLEEP---------------------------------  341
            AWNSL+NLVMVLEY   G L+  L++                                  
Sbjct  456  AWNSLNNLVMVLEYFPMGDLQSCLQKNGDLMSWSRDKIHIAVGTASALQYLHSRTPPLIH  515

Query  342  REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYS  401
            R+  S N+LLT ++E K+IDFGVSR   + SMTAGVGTP+WTAPEILEG  YTE+AD+YS
Sbjct  516  RDLKSKNILLTRALEAKLIDFGVSRARQEYSMTAGVGTPYWTAPEILEGKRYTEQADLYS  575

Query  402  FGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACL  461
            FGVVLSELDT ++P+HDA T DG KLKPVQIL +VM+G +RPSFS+ECP RIRRIG AC 
Sbjct  576  FGVVLSELDTCKLPFHDAFTSDGKKLKPVQILADVMAGMLRPSFSNECPQRIRRIGVACC  635

Query  462  SLDPSSRPTAHELVRQLEGRD  482
              DPS RP+A ++V  L   D
Sbjct  636  QQDPSRRPSAAQVVSMLTETD  656

>PHYSO_563952
Length=667

 Score = 385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 226/571 (40%), Positives = 318/571 (56%), Gaps = 94/571 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++MADLAVP  +   V+CT   C +PNG T+   Q CTG  ML  +R          
Sbjct  102  LGGHSMADLAVPVDEFLGVNCTEHVCPEPNGGTSLSNQQCTGADMLKAARCVVEDFVQTV  161

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +PT+ P+ R+  H W   +       ++ V+ +H+V  D +PAWN C  
Sbjct  162  EIHLAMWVTGGNPTVVPTPRIYKHAWNDSLDHN----SYVVFAIHSVDLDAEPAWNACAR  217

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEF------AQEDSPSQ  151
               ++GY SL VPCH     + +++  +     GSA+V+ WL++++      A  D  S 
Sbjct  218  ADQNDGYGSLVVPCHNTANIS-NFIDDSKQEVQGSAWVSRWLREDYSATAGTASSDQSSS  276

Query  152  ----LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAI  207
                +L+  I+   + V G+    +  +R+ +A  +Q +  E      R          +
Sbjct  277  KFNFMLLVPIVAGVVVVLGLVGLCVFLKRRRQAKAEQGALQESPVCQGRGYYRDCADAQL  336

Query  208  SISSPQQRRDSAIQSLY-CERAGSNKT----------------------LLDSEHLEGKR  244
            +      R  S  Q++      G +KT                      LL SE L GKR
Sbjct  337  TNEDDSTRGRSTAQTIEDTTTRGGDKTIRFKSIGDREDLSAGSNLTLKILLHSEFLVGKR  396

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            +P+DSI F+R +SKGA+GEVW+CEF  Q+ AVKRLLQ     A+ V++FA EIEL A+L+
Sbjct  397  VPYDSIFFKRALSKGANGEVWLCEFYEQQIAVKRLLQNTTHLADEVEEFAKEIELNATLV  456

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HPNIV F+GVAWN+L+NL+MVLE+   G L+ +L +                        
Sbjct  457  HPNIVSFVGVAWNTLNNLLMVLEFFPLGDLQTYLAKNGDLMSWARDKIHIAVGVARALEY  516

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGN  391
                      R+  S N++LT  +E K+IDFGVSRG +D +MTAGVGTP+WTAPEIL+G+
Sbjct  517  LHSRSPPLIHRDLKSKNIMLTRLLEAKLIDFGVSRGRLDNTMTAGVGTPYWTAPEILQGS  576

Query  392  HYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPP  451
             YTE+AD+YSFGVVLSELDT ++PYHDA+T +G K KPVQIL +VM+G +RPSFS++CP 
Sbjct  577  RYTEQADIYSFGVVLSELDTTKLPYHDALTSNGKKPKPVQILADVMAGMLRPSFSEDCPR  636

Query  452  RIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            RIRRIG AC   DP+ RP A ++ R LEG D
Sbjct  637  RIRRIGVACCQQDPARRPNAAQVGRMLEGDD  667

>PHYSO_483581
Length=667

 Score = 384 bits (987),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 226/571 (40%), Positives = 317/571 (56%), Gaps = 94/571 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++MADLAVP  +   V+CT   C +PNG T+   Q CTG  ML  +R          
Sbjct  102  LGGHSMADLAVPVDEFLGVNCTEHVCPEPNGGTSLSNQQCTGADMLKAARCVVEDFVQTV  161

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +PT+ P+ R+  H W   +       ++ V+ +H+V  D +PAWN C  
Sbjct  162  EIHLAMWVTGGNPTVVPTPRIYKHAWNDSLDHN----SYVVFAIHSVDLDAEPAWNACAR  217

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEF------AQEDSPSQ  151
               ++GY SL VPCH     + +++  +     GSA+V+ WL++++      A  D  S 
Sbjct  218  ADQNDGYGSLVVPCHNTANIS-NFIDDSKQEVQGSAWVSRWLREDYSATAGTASSDQSSS  276

Query  152  ----LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAI  207
                +L+  I+   + V G+    +  +R+ +A  +Q +  E      R          +
Sbjct  277  KFNFMLLVPIVAGVVVVLGLVGLCVFLKRRRQAKAEQGALQESPVCQGRGYYRDCADAQL  336

Query  208  SISSPQQRRDSAIQSLY-CERAGSNKT----------------------LLDSEHLEGKR  244
            +      R  S  Q++      G +KT                      LL SE L GKR
Sbjct  337  TNEDDSTRGRSTAQTIEDTTTRGGDKTIRFKSIGDREDLSAGSNLTLKILLHSEFLVGKR  396

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            +P+DSI F+R +SKGA+GEVW+CEF  Q+ AVKRLLQ     A+ V++FA EIEL A+L+
Sbjct  397  VPYDSIFFKRALSKGANGEVWLCEFYEQQIAVKRLLQNTTHLADEVEEFAKEIELNATLV  456

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HPNIV F+GVAWN+L+NL MVLE+   G L+ +L +                        
Sbjct  457  HPNIVSFVGVAWNTLNNLFMVLEFFPLGDLQTYLAKNGDLMSWARDKIHIAVGVARALEY  516

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGN  391
                      R+  S N++LT  +E K+IDFGVSRG +D +MTAGVGTP+WTAPEIL+G+
Sbjct  517  LHSRSPPLIHRDLKSKNIMLTRLLEAKLIDFGVSRGRLDNTMTAGVGTPYWTAPEILQGS  576

Query  392  HYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPP  451
             YTE+AD+YSFGVVLSELDT ++PYHDA+T +G K KPVQIL +VM+G +RPSFS++CP 
Sbjct  577  RYTEQADIYSFGVVLSELDTTKLPYHDALTSNGKKPKPVQILADVMAGMLRPSFSEDCPR  636

Query  452  RIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            RIRRIG AC   DP+ RP A ++ R LEG D
Sbjct  637  RIRRIGVACCQQDPARRPNAAQVGRMLEGDD  667

>PPTG_16193
Length=680

 Score = 376 bits (965),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 225/568 (40%), Positives = 309/568 (54%), Gaps = 91/568 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++MADLAVP+++   V CT   C QPN  T+     C G  ML  +R          
Sbjct  118  LNGHSMADLAVPRSEFEDVGCTVKVCEQPNNKTSLSNNKCLGGDMLKAARCVIEDFVDSI  177

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP-  99
                  W    +P + P+ R+  H W     +      + V+ +HTV    +PAWN+C  
Sbjct  178  DIHAAMWVTGGNPDVVPTPRVNKHAWN----DSNDHKDYVVFAIHTVDLIGEPAWNQCAK  233

Query  100  --LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQ--EDSPSQLLIP  155
               ++GY SL +PCH     T +  +A      G+ +V+ WL ++++     SP    + 
Sbjct  234  ADQNDGYGSLVLPCHTTENITAEIDSAKREA-TGTDWVSRWLVEDYSSIAGTSPDNGKLN  292

Query  156  VILGVAIA-----VAGMALGWLSCRRKLEA-------------SMKQKSGIEHerrsqrs  197
            V+L V+IA     V G+   +  C+R+ +A             +     GI         
Sbjct  293  VLLIVSIAAGVLVVIGIGGLFFFCKRRRQAKKDLDYCEESPVCTNNYYQGIRDPDFLDDV  352

Query  198  sgssqerrAISISSPQQR-----RDSAIQSLYCER--AGSNKTL---LDSEHLEGKRIPF  247
            S   +      + S         R   ++  Y     +GSN+TL    +SE L GKR+ +
Sbjct  353  SIPDRSIAHTVVDSETATYKAVDRTIKLKPFYTGEFDSGSNRTLNILHNSEFLVGKRLSY  412

Query  248  DSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPN  307
            DSI+F++ +SKGA+GEVW+CE+  ++ AVKRL Q +   A+ V++FA EIEL+ASL HPN
Sbjct  413  DSIIFKQALSKGANGEVWLCEYQNEQVAVKRLFQDQNHHADEVEEFAQEIELSASLKHPN  472

Query  308  IVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP--------------------------  341
            IV FIG+AWNSL+NLVMVLEY   G L+ +L++                           
Sbjct  473  IVSFIGMAWNSLNNLVMVLEYFPMGDLQSYLQKNGDLMSWSRDKIHIAVGTASALQYLHS  532

Query  342  -------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYT  394
                   R+  S N+LLT ++E K+IDFGVSR   + SMTAGVGTP+WTAPEILEG  YT
Sbjct  533  RTPPLIHRDLKSKNILLTRALEAKLIDFGVSRARQEYSMTAGVGTPYWTAPEILEGKRYT  592

Query  395  EKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIR  454
            E+AD+YSFGVVLSELDT ++PYHD V  DG  LKPVQIL +VM+G +RPSFSDECP RIR
Sbjct  593  EQADIYSFGVVLSELDTCKLPYHDVVGSDGKMLKPVQILADVMAGMLRPSFSDECPRRIR  652

Query  455  RIGTACLSLDPSSRPTAHELVRQLEGRD  482
            RIG AC   DPS RP A ++V  L   D
Sbjct  653  RIGVACCQQDPSRRPNAAQVVTMLTVAD  680

>PPTG_16190
Length=641

 Score = 371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 220/561 (39%), Positives = 304/561 (54%), Gaps = 91/561 (16%)

Query  4    YTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQM----------------LN  47
            ++M+ LA+   +     C   NC++P+    + ++YC G QM                 +
Sbjct  89   HSMSTLALTLTEYENAGCVPKNCTEPDDAIMYESRYCNGAQMSYAAKCVVQDFDGDGAYH  148

Query  48   VSRW----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP---L  100
             + W    +    P++R+  H+W  +  ++       +  +HTV  + +P WN CP   +
Sbjct  149  AAMWGIGGNSESAPALRMLKHEWNDNGTDY------EIMALHTVTAENEPGWNACPISNM  202

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEF---AQEDSPS---QLLI  154
            + GY SL  PC      T +       V  GSA+V+ WL  ++   A  DS      LLI
Sbjct  203  NGGYGSLVFPCRTTGNITAENKKQMKEV-TGSAWVSEWLVTDYKDTAGVDSSGFNMLLLI  261

Query  155  PVILGVAIAVAGMALGWLSCRRKL---------EASMKQKSGIEHerrsqrssgssqerr  205
            P+ILGV +  A + L +  C++K          E++  +   +            +  R 
Sbjct  262  PIILGVLVIFALIGLVFY-CKKKRRQRCLDEFEESTTGESPYVVAPSAKSFDQRDTLARP  320

Query  206  AISIS-----SPQQRRDSAIQ----SLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFE  253
             +++S     +     D  IQ           GSN TL   L SE+L G+RIP +++ FE
Sbjct  321  TVAVSEDMTTATYSGADQTIQFPGYGGEFMSGGSNTTLSVLLMSEYLVGQRIPLENLNFE  380

Query  254  RVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIG  313
            R +SKGASGEVW+CE+  QK A KRLLQ K+ KAE V +FALEI+L A L HPNI  FIG
Sbjct  381  RALSKGASGEVWICEYAGQKVAAKRLLQTKENKAEDVHEFALEIDLNARLEHPNIGAFIG  440

Query  314  VAWNSLDNLVMVLEYLSTGSLKEFLEEP--------------------------------  341
            VAW SL+NL MV+EY   G L+++L+                                  
Sbjct  441  VAWGSLNNLTMVIEYFPLGDLQKYLKRNADLLSWARDKIHMAVGVARALEYLHGYSPPII  500

Query  342  -REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMY  400
             R+  S N+LLT  +E K+IDFGVSRG +D +MTAGVGTPFWTAPEILEG  Y+E+AD+Y
Sbjct  501  HRDLKSKNILLTRQLEAKVIDFGVSRGRLDNTMTAGVGTPFWTAPEILEGKRYSEQADIY  560

Query  401  SFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTAC  460
            SFGVVLSELDTG++P++D    DG K KP  IL+EVM+GT+RPSFS +CPPRIRRIG  C
Sbjct  561  SFGVVLSELDTGKIPFYDCAGSDGKKTKPFHILQEVMAGTLRPSFSPDCPPRIRRIGVLC  620

Query  461  LSLDPSSRPTAHELVRQLEGR  481
               DPS RP+A +LV  L+G 
Sbjct  621  CQHDPSRRPSAAQLVEMLQGN  641

>PPTG_16192
Length=637

 Score = 370 bits (949),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 215/540 (40%), Positives = 299/540 (55%), Gaps = 73/540 (14%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            + N+TMA+LAVP   V  V C    C QP+  T++  ++C G Q+L  +R          
Sbjct  104  LNNHTMANLAVPLEQVRAVGCEEKACVQPDNTTSYSNEWCGGAQLLQAARCVVEDFVDTG  163

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP-  99
                  W    +P + P+  +  H+W+    +     ++ V+ +HT+  D +PAWN CP 
Sbjct  164  DIHAAMWVTGGNPIVIPTPHVLKHEWKDQRDKN----SYIVFAIHTLDFDDEPAWNTCPD  219

Query  100  --LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPS---QLLI  154
               ++GY SL VPC      T+  M A   V  GS +V+ WL ++++  D       LL+
Sbjct  220  STQNDGYGSLVVPCFTTDNITNATMEAMKEV-EGSPWVSRWLVEDYSTPDEHEFKMILLV  278

Query  155  PVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQ  214
            P+I G+   +  + L  +  +R+        S            G     + +S   P  
Sbjct  279  PIIGGIVATIGLLGLLIIVKQRRQRQPKSTSSDGAQICSKDLKRGYRNSNQGLSSHHP--  336

Query  215  RRDSAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNR  271
                A  S + +   ++ TL   + SE L  KRIP+DSI FERV+SKGASGEVW+ +F  
Sbjct  337  ----ANNSTFGDFEWTSSTLRETIGSESLLDKRIPYDSIHFERVVSKGASGEVWLADFQG  392

Query  272  QKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLST  331
            Q+ AVKRLLQ K   A+ V++FA EI+L+ASL HPNIV FIGVAWNSL N VMVLE+L  
Sbjct  393  QQVAVKRLLQSKTHSADEVEEFAQEIQLSASLTHPNIVGFIGVAWNSLTNFVMVLEFLPL  452

Query  332  GSLKEFLEEP---------------------------------REFMSSNVLLTDSIEPK  358
            G L+ +L +                                  R+  S N+L++  +EPK
Sbjct  453  GDLQAYLRKNFDLLLWSKDKIHIAIGIALALEYLHSRSPPLIHRDLKSRNILISKRLEPK  512

Query  359  IIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD  418
            + DFGVSR   +  MTAGVGTP+W+APEILEG  YTE AD+YSFGVVLSELDT ++PYHD
Sbjct  513  LSDFGVSRTRQENIMTAGVGTPYWSAPEILEGKQYTELADIYSFGVVLSELDTAKLPYHD  572

Query  419  AVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            A+T +G   KP +IL EV++G +RP+FS EC P+IRRIG AC   DP  RPTA +++  L
Sbjct  573  ALTPEGKSQKPFKILAEVITGVLRPTFSKECSPQIRRIGVACCQHDPDRRPTAAQVLEML  632

>PHYCA_533390
Length=483

 Score = 364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 223/299 (75%), Gaps = 36/299 (12%)

Query  218  SAIQSLYCERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            S + S + E AGSNKTL   LDS+HL+GKRIP+DS+V ER +SKGASGEVW+C++N QK 
Sbjct  185  STLSSQHYESAGSNKTLKILLDSKHLQGKRIPYDSLVLERAVSKGASGEVWICQYNGQKV  244

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            A KRLLQ K+Q AE VQ FA EIEL+ASL+HP+IV+FIGVAWNSL+NL MVLE+   G+L
Sbjct  245  AAKRLLQTKEQTAEKVQAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMVLEFFPMGNL  304

Query  335  KEFLE-----------------------------EP----REFMSSNVLLTDSIEPKIID  361
            +++L+                             EP    R+  S+N+LLTD +EPK+ID
Sbjct  305  QDYLQKNADLLSWARDKIHMAIGVAQALEYLHGREPPLIHRDLKSNNILLTDKLEPKLID  364

Query  362  FGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT  421
            FGVSR  VDL+MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVL+ELDT  +PY DA T
Sbjct  365  FGVSRDTVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTCAIPYSDAAT  424

Query  422  EDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            E+G K KP QIL++VM G +RP+FS +CPPRI++IG ACLSL+P  RPTA ELV++L+G
Sbjct  425  ENGGKPKPFQILQDVMMGKLRPTFSQDCPPRIKKIGLACLSLNPMDRPTAKELVKELQG  483

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 2/55 (4%)

Query  52   DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYAS  106
            DP + P I LRDH W +DI  FGG+  F VYV+HTVP   + AW +C LD GY +
Sbjct  131  DPDVAPQIELRDHAWSEDIEAFGGVTQFSVYVIHTVPSAEEAAWGQC-LD-GYGT  183

>PHYRA_84557
Length=643

 Score = 369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 227/572 (40%), Positives = 303/572 (53%), Gaps = 106/572 (19%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQM---------------  45
            +G++TM+ LA+   +     C + NC++P+G   H   +C G QM               
Sbjct  85   LGDHTMSTLALTADEYEAAGCVFGNCTEPDGTEIHINYHCNGAQMNRAAKCLAQEFKDDV  144

Query  46   -LNVSRW----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLD-PAWNECP  99
              N + W      +M P  R+  H W            + V  VHT+  D D P ++ CP
Sbjct  145  SYNAAMWAIGGRASMVPKPRVAKHDWVDGE-------HYVVMAVHTLSSDQDEPGYDSCP  197

Query  100  L----DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEF---AQEDSP--S  150
                   GY S+  PC     FT D +   T V  GS +V+ WL +++   A EDS   +
Sbjct  198  TTSSESAGYGSVVFPCQTTANFTSD-LEKKTVV--GSDWVSNWLVEDYPDAAVEDSNGFN  254

Query  151  QLLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISIS  210
            +LL+  I+  A+ V  +      C+RK     +Q++ +E E  +     +          
Sbjct  255  KLLLVPIVLGALVVVALVALGFYCKRK----RQQRARMEFEESTADVGQTPYLAPTPGDK  310

Query  211  SPQQRRDSAIQSLYCER--------------------------AGSN---KTLLDSEHLE  241
            +  QR  +A  +L                               GSN   K LL SEHL 
Sbjct  311  NFDQRDTNARPTLAVSEDLTTSTYTGADHTIQFPVGYGGDYVSGGSNTTLKILLTSEHLV  370

Query  242  GKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTA  301
            GKRIP +++ FE+ +SKGASGEVWVCE+  QK A KRLLQ K+ KAE V +FA EIEL A
Sbjct  371  GKRIPLENLTFEKALSKGASGEVWVCEYAGQKVAAKRLLQTKEAKAEDVHEFAQEIELNA  430

Query  302  SLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP--------------------  341
            SL HPN+  FIGVAW+SL+NL MV+EY   G L+ +L+                      
Sbjct  431  SLDHPNVGAFIGVAWSSLNNLSMVIEYFPLGDLQRYLKRNADLLSWARDKIHMAIGVASA  490

Query  342  -------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEIL  388
                         R+  S N+LLT  +E K+IDFGVSRG +D +MTAGVGTPFWTAPEIL
Sbjct  491  LEYLHSRSPPIIHRDLKSKNILLTRQLEAKVIDFGVSRGRLDNTMTAGVGTPFWTAPEIL  550

Query  389  EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDE  448
            EG  Y+E+AD+YSFGVVLSELDT ++P+HD ++  G K KP  ILKEVM+GT+RPSFS +
Sbjct  551  EGKRYSEQADIYSFGVVLSELDTCKIPFHDCISSKGKKAKPFHILKEVMAGTLRPSFSAD  610

Query  449  CPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            CPPRIRR+G AC   DP+ RPTA  LV  L+G
Sbjct  611  CPPRIRRVGVACCQQDPARRPTAAVLVAMLQG  642

>PHYRA_84554
Length=686

 Score = 371 bits (952),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 227/596 (38%), Positives = 309/596 (52%), Gaps = 130/596 (22%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++MADLAVP A    V C  +NC+QP+   +    YC G QML  +R          
Sbjct  104  LSGHSMADLAVPLAQFQDVGCVEMNCTQPDTTQSLSNLYCNGDQMLTAARCVAQEFEDDA  163

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+   R H+W       G    + V  +HTV  D +  +  CP 
Sbjct  164  EIHLAMWMTGGNPKVVPNPLFRKHQWVDG--SSGTDQYYTVAAIHTVNMDNEATYGVCPT  221

Query  101  DE---GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
            D+   GY SL +PC+     TDD + +   V  G+ +V+ WL ++++   +P        
Sbjct  222  DDQNGGYGSLVLPCYHLGNITDDVLESLEEV-EGTPWVSRWLVEDYSGA-APKGTGSSSS  279

Query  152  ---------LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssq  202
                     L++P++ G+ + V    L     RRK        S   H            
Sbjct  280  SAGGGFNLVLVVPIVGGILLLVGLTVLVVFLLRRKNSRGDTNNSQEPH----------GN  329

Query  203  errAISISSPQQRRDSAIQSLYCE------------------------------------  226
              +A + + P+   D++ Q+ Y E                                    
Sbjct  330  PYQAYNNADPRTSIDASWQAAYKEVQSPVHNNARHRSTEGSVTSDLETRRCSDITARLRT  389

Query  227  ------RAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVK  277
                   + SN T   LL SE+L  KRIPFDS+ FE  +SKGA GEVW+  +  Q+ AVK
Sbjct  390  PYQGEFSSESNATMKTLLSSEYLVDKRIPFDSLTFENALSKGAMGEVWLGMYQGQQVAVK  449

Query  278  RLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEF  337
            RLLQ    +AE V++FA EIEL+ASL+HPNIV F+GVAWN+L+NLVMVLE+   G L  F
Sbjct  450  RLLQSNTHRAEEVEEFAKEIELSASLVHPNIVLFVGVAWNTLNNLVMVLEFFPEGDLLSF  509

Query  338  LEEP---------------------------------REFMSSNVLLTDSIEPKIIDFGV  364
            L++                                  R+  S+NV+LT+ +EPK+IDFGV
Sbjct  510  LDKNADALSWAKDKIHIAVGIGRAMEYLHSRAPPLIHRDLKSNNVMLTNELEPKLIDFGV  569

Query  365  SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDG  424
            SRG  + +MTAGVGTP+WTAPEILEG  YTE+AD+YSFGV+LSELDTG+ PYHDA+  DG
Sbjct  570  SRGTAESTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVILSELDTGKRPYHDALRSDG  629

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            TK KP QI++ VM+G +RPS SD+CPPRIRRI TAC   D   RPTA ++V+ LEG
Sbjct  630  TKPKPFQIMERVMAGVLRPSLSDDCPPRIRRISTACCQQDSRQRPTAAQVVQMLEG  685

>PHYSO_337957
Length=656

 Score = 369 bits (947),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 222/562 (40%), Positives = 307/562 (55%), Gaps = 96/562 (17%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++MADLAVP        C  + C QP   T++   +C G QML V+R          
Sbjct  106  LNGHSMADLAVPLPQFQAAGCEEMACEQPGNTTSYSNLWCGGAQMLKVARCVVEDFEDND  165

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P   P++++R H+W+    E  G  ++ V+ VHT+    +P+WN C L
Sbjct  166  EIHAAMWVTGGNPAEVPTLKVRKHEWKD---ERDG-NSYVVFAVHTLELADEPSWNSCAL  221

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
               ++GY SL +PC+     T+  +  +     GS +V  WL +++      +       
Sbjct  222  ATQNDGYGSLVLPCYTTANITEG-IKNDMEQTKGSLWVARWLSEDYGTAAKATSKGFNLV  280

Query  152  LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISS  211
            LL+P+I+G  I V   AL  L  RR+ + S + +               +     I    
Sbjct  281  LLVPIIIGAIIVVLLGALLVLVQRRRRQRSRENQ----------LPDTVASPSSNIRAQG  330

Query  212  PQQRRDSAIQSLYCERAGSN-----------------KTLLDSEHLEGKRIPFDSIVFER  254
            P+  RD    +L+   AGS                  K LL SE L GKRIP++SIV +R
Sbjct  331  PRSLRDP--YTLHVAGAGSRFVNNSTMQSSEYGNATLKALLSSERLSGKRIPYESIVLKR  388

Query  255  VISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGV  314
            +ISKGA GEVW+ +   Q+ AVKRLLQ K   AE V++FA EIE++ASLIHPNIV F+GV
Sbjct  389  MISKGAYGEVWLGDIVGQQVAVKRLLQNKTHLAEEVEEFAQEIEISASLIHPNIVAFVGV  448

Query  315  AWNSLDNLVMVLEYLSTGSLKEFLEEP---------------------------------  341
            AWNSL+NL MV+EY  TG L+ +L +                                  
Sbjct  449  AWNSLNNLAMVIEYFPTGDLQTYLRKNFDLLSLPKDKIPIAAGIALALEYLHARTPPLIH  508

Query  342  REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYS  401
            R+  S NVLLT  +E K+IDFGVSRG  + SMTAGVGTP+W+APEILEG  YTE+AD+YS
Sbjct  509  RDLKSKNVLLTKKLEAKLIDFGVSRGRQENSMTAGVGTPYWSAPEILEGRKYTEQADIYS  568

Query  402  FGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACL  461
            FGVV+SELDTG +PY D +T DG KL+P+QIL EV++G +RP+ S +CP +IR I  AC 
Sbjct  569  FGVVMSELDTGMIPYQDTLTSDGKKLEPIQILAEVVAGRLRPTLSKDCPQQIRDIFEACC  628

Query  462  SLDPSSRPTAHELVRQLEGRDS  483
              DP  RPTA ++V+ L+  D+
Sbjct  629  HQDPDQRPTAAQVVKLLQTTDN  650

>PHYSO_325252
Length=656

 Score = 369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 222/562 (40%), Positives = 307/562 (55%), Gaps = 96/562 (17%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++MADLAVP        C  + C QP   T++   +C G QML V+R          
Sbjct  106  LNGHSMADLAVPLPQFQAAGCEEMACEQPGNTTSYSNLWCGGAQMLKVARCVVEDFEDND  165

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P   P++++R H+W+    E  G  ++ V+ VHT+    +P+WN C L
Sbjct  166  EIHAAMWVTGGNPAEVPTLKVRKHEWKD---ERDG-NSYVVFAVHTLELADEPSWNSCAL  221

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
               ++GY SL +PC+     T+  +  +     GS +V  WL +++      +       
Sbjct  222  ATQNDGYGSLVLPCYTTANITEG-IKNDMEQTKGSLWVARWLSEDYGTAAKATSKGFNLV  280

Query  152  LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISS  211
            LL+P+I+G  I V   AL  L  RR+ + S + +               +     I    
Sbjct  281  LLVPIIIGAIIVVLLGALLVLVQRRRRQRSRENQ----------LPDTVASPSSNIRAQG  330

Query  212  PQQRRDSAIQSLYCERAGSN-----------------KTLLDSEHLEGKRIPFDSIVFER  254
            P+  RD    +L+   AGS                  K LL SE L GKRIP++SIV +R
Sbjct  331  PRSLRDP--YTLHVAGAGSTFVNNSTMQSSEYGNATLKALLSSERLSGKRIPYESIVLKR  388

Query  255  VISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGV  314
            +ISKGA GEVW+ +   Q+ AVKRLLQ K   AE V++FA EIE++ASLIHPNIV F+GV
Sbjct  389  MISKGAYGEVWLGDIVGQQVAVKRLLQNKTHLAEEVEEFAQEIEISASLIHPNIVAFVGV  448

Query  315  AWNSLDNLVMVLEYLSTGSLKEFLEEP---------------------------------  341
            AWNSL+NL MV+EY  TG L+ +L +                                  
Sbjct  449  AWNSLNNLAMVIEYFPTGDLQTYLRKNFDLLSLPKDKIPIAAGIALALEYLHARTPPLIH  508

Query  342  REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYS  401
            R+  S NVLLT  +E K+IDFGVSRG  + SMTAGVGTP+W+APEILEG  YTE+AD+YS
Sbjct  509  RDLKSKNVLLTKKLEAKLIDFGVSRGRQENSMTAGVGTPYWSAPEILEGRKYTEQADIYS  568

Query  402  FGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACL  461
            FGVV+SELDTG +PY D +T DG KL+P+QIL EV++G +RP+ S +CP +IR I  AC 
Sbjct  569  FGVVMSELDTGMIPYQDTLTSDGKKLEPIQILAEVVAGRLRPTLSKDCPQQIRDIFEACC  628

Query  462  SLDPSSRPTAHELVRQLEGRDS  483
              DP  RPTA ++V+ L+  D+
Sbjct  629  HQDPDQRPTAAQVVKLLQTTDN  650

>HYAP_14439
Length=414

 Score = 357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/403 (47%), Positives = 262/403 (65%), Gaps = 43/403 (11%)

Query  120  DYMAANTTVPAGSAFVTTWLKQEFAQEDS-PSQLLIPVILGVAIAVAGMALGWLSCRRKL  178
            D +    +VP+GS +VTTWL+ +F       + +++ +IL V   +  +A GW  CR + 
Sbjct  4    DEVKMAMSVPSGSDWVTTWLENDFVVPSGFDTSMVVAIILAVLTMLVILAFGWYCCRHRS  63

Query  179  EASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYC-----ERAGSNKT  233
              S K  S +            +   +  + S+ +  R +   SL+      E AGSN+T
Sbjct  64   SRSKKAASSVYKLAGDAPQYSDAWTSKTGNRSTDRSLRLTHQSSLFSSSGDFESAGSNRT  123

Query  234  L---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESV  290
            L   L S+ L+ KRIP+++++ +  ISKGASGEVW+C +  +  AVKRL+ R  + AE+V
Sbjct  124  LKILLGSKCLQQKRIPYENLMLQEPISKGASGEVWICAYRGKTVAVKRLI-RGSRNAETV  182

Query  291  QKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS----  346
            + FA EIEL+ASL+HPN+V+FIGVAWNSLDNL MVLEY   G+L+ +L +  + +S    
Sbjct  183  RTFAEEIELSASLVHPNVVEFIGVAWNSLDNLAMVLEYFPRGNLQNYLHKNADLLSWARD  242

Query  347  -----------------------------SNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                         +N+LLTD+++PK+IDFGVSRGLVD++MTAGV
Sbjct  243  KIQMAVAIAQALQYLHGRSPAIIHRDLKCNNILLTDNLQPKLIDFGVSRGLVDITMTAGV  302

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GTP+W APEILEG  YTE+AD+YSFGVVLSELDTG++PYH+AVTE G +    QIL++VM
Sbjct  303  GTPYWAAPEILEGKRYTEQADIYSFGVVLSELDTGEIPYHNAVTESGGQATSFQILQDVM  362

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            +G++RPSFS +CPPRIRR+G ACLSLDPS RPT ++L++ LEG
Sbjct  363  AGSLRPSFSRDCPPRIRRVGLACLSLDPSDRPTTNQLIQGLEG  405

>PHYCA_107484
Length=343

 Score = 353 bits (906),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 219/294 (74%), Gaps = 36/294 (12%)

Query  226  ERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQR  282
            E AGSN+T   LL S+HL G RI +D +VF+  +SKGA+GEVW+C++  Q+ AVK+LL  
Sbjct  47   ESAGSNQTFKILLHSQHLYGNRIAYDGLVFQSELSKGAAGEVWICQYGGQQVAVKKLLHT  106

Query  283  KKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-  341
            + QKAE VQ FA EI+LTASLIHP+IV+FIGVAWNSL NL MVLEY+  G+LK++L    
Sbjct  107  RDQKAEDVQAFAEEIDLTASLIHPHIVKFIGVAWNSLSNLAMVLEYVPGGNLKDYLHNNS  166

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                            R+  S+N+LLT++++PK+IDFGVSRG +
Sbjct  167  DLLSWARDKIHMALAIAEALEYLHLQTPAIIHRDLKSNNILLTENLDPKLIDFGVSRGKL  226

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKP  429
            D++MTAGVGTP+WTAPE+LEGN YTEKAD+YSFGVVLSELDTG++PY DA+ +DGTKL P
Sbjct  227  DVTMTAGVGTPYWTAPEVLEGNRYTEKADIYSFGVVLSELDTGRIPYFDALEDDGTKLMP  286

Query  430  VQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRDS  483
             QIL+EVMSGT+RPSF+++CP RI+RIG ACL+LDP  RPTA EL++ LEGR S
Sbjct  287  FQILQEVMSGTLRPSFTEDCPLRIQRIGAACLALDPEQRPTARELIQWLEGRYS  340

>PHYSO_520885
Length=623

 Score = 361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 292/492 (59%), Gaps = 51/492 (10%)

Query  29   PNGVTAHYAQYCTGWQM----------------LNVSRW----DPTMTPSIRLRDHKWEQ  68
            PN  TAH +  C G QM                 N + W    +P+  PS+R+  H+W +
Sbjct  144  PNNTTAHESYLCNGAQMNTAAKCVVEEFTDGKDYNAAMWGTGGNPSAAPSLRVAKHEWWE  203

Query  69   DIPEFGGLITFHVYVVHTVPHDLDPAWNECP---LDEGYASLTVPCHRRIEFTDDYMAAN  125
            +     G   + V  +HTV  D +P WN C     ++G+ SL  PC      T    A  
Sbjct  204  N-----GETHYVVMALHTVGIDQEPGWNACANSLQNDGFGSLVFPCRTTANLTAANEADK  258

Query  126  TTVPAGSAFVTTWLKQEF----AQEDSPS---QLLIPVILGVAIAVAGMALGWLSCRRKL  178
              V  GS +V  WL  ++      EDS      LL+P+I+G  + +A +AL +   R++ 
Sbjct  259  KEV-EGSQWVEDWLVADYMATAKAEDSDGFNMILLVPIIVGALVVLALVALAFYCRRKRK  317

Query  179  EASMK---QKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAGSN---K  232
            + + K   + S     +  +  + S+      +I  P    DS   S     AGSN   K
Sbjct  318  QQAQKQQYEDSSTTTGQTPEDMTVSTYAGADQTIQFPAGY-DSEFAS-----AGSNTTLK  371

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
             LL SE L GKRIP +S++FE+ +SKGASGEVWVCE+  QK A KRLLQ K QKAE V +
Sbjct  372  VLLKSEFLVGKRIPLESLIFEKPLSKGASGEVWVCEYAGQKVAAKRLLQTKDQKAEDVHE  431

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS---SNV  349
            FALEIEL A L HPNI  FIGVAW+SL+NL MV+EY   G L+ +L +  + +S     +
Sbjct  432  FALEIELNAHLQHPNIGAFIGVAWSSLNNLAMVVEYFPQGDLQSYLRKNADLLSWAKDKI  491

Query  350  LLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSEL  409
             +   +E K+IDFGVSRG +D +MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVLSEL
Sbjct  492  HMAVGLEAKVIDFGVSRGRLDNTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSEL  551

Query  410  DTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRP  469
            DT ++P+HD +  +G K KP +IL+EVMSG +RPSFS++CPPRIRRIG  C   DP+ RP
Sbjct  552  DTCKIPFHDCMDTNGKKAKPFRILQEVMSGVLRPSFSEDCPPRIRRIGIMCCQHDPARRP  611

Query  470  TAHELVRQLEGR  481
            TA +LV  L+G+
Sbjct  612  TAAQLVEMLQGQ  623

>PHYCA_107239
Length=649

 Score = 358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 219/559 (39%), Positives = 293/559 (52%), Gaps = 85/559 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G  +MA+LAV K +     CT LNCSQP+  T +  Q+CTG QML  ++          
Sbjct  97   LGGRSMANLAVSKVEFDTTGCTALNCSQPDDSTYYANQFCTGTQMLTAAKCLMDSFDSDT  156

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    DP MTP IR   H W     +   L++     VHT+  D +PA+  C  
Sbjct  157  SSHLAMWSDGGDPEMTPQIRGVLHGWLDSSTDQSYLLS----AVHTMTVDSEPAYGTCNQ  212

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ---------  151
            D GY SL VPC+     + D +A   + P  S +VTTW+KQ   + D+            
Sbjct  213  D-GYGSLVVPCYTMSNTSADIVAV-MSAPVHSPWVTTWIKQYQPKSDTIVNSSSDDGVGF  270

Query  152  ---LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAIS  208
               LL P+IL   IA   +       RR+L +   Q+                    + S
Sbjct  271  NLWLLGPIILAAVIASVLIFFAVCKKRRRLRSVYLQRDSPADSECRSSQKSKPTGPLSSS  330

Query  209  IS-----------SPQQRRDS--AIQSLYCERAGSNK---TLLDSEHLEGKRIPFDSIVF  252
            +S           S Q  R+S  A++  +C  + ++    TL    +L GKRI ++ I  
Sbjct  331  MSPDLQLMPSIRDSIQADRESIPALRETFCRYSAADNVQYTLTTDCNLVGKRIAWERIEL  390

Query  253  ERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFI  312
             R++S+GA GEVW C +  +K AVKRLLQ KK      + F  EI+LTASL HPNIV+FI
Sbjct  391  GRLLSRGAFGEVWACRYAGKKVAVKRLLQTKKHTFLETENFTNEIQLTASLNHPNIVRFI  450

Query  313  GVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS--------------------------  346
            GV W+SL+NL MV EYL  G L+++L+   + M+                          
Sbjct  451  GVTWSSLENLAMVEEYLPRGDLQKYLKRNGDLMTWARDKIDMAIGIARAIDYLHTREVIH  510

Query  347  -----SNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYS  401
                  N+LLT  ++PK+IDFG SR  V   M+AGVGTPFWTAPE+LE   YTEKAD+YS
Sbjct  511  RDVKARNILLTKRLQPKLIDFGTSRLWVPNDMSAGVGTPFWTAPEVLESTEYTEKADIYS  570

Query  402  FGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACL  461
            FGV+L+ELDT + PYH+ +  +G K+KP  ILKEV+ GT+RPS + ECP RIRR   AC 
Sbjct  571  FGVLLTELDTCEAPYHNTLGANGEKMKPFHILKEVVDGTLRPSLTPECPQRIRRAAVACF  630

Query  462  SLDPSSRPTAHELVRQLEG  480
              DP  RP+A ELVR LEG
Sbjct  631  QHDPKLRPSASELVRLLEG  649

>PHYCA_543946
Length=314

 Score = 317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 198/291 (68%), Gaps = 36/291 (12%)

Query  226  ERAGSN---KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQR  282
            E  GSN   K LL SE L GKRIP + ++F++ +SKGASGEVW+CE+  +K A KRLLQ 
Sbjct  23   ESVGSNTTLKVLLPSESLTGKRIPLEHLIFDKALSKGASGEVWICEYAGEKVAAKRLLQT  82

Query  283  KKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-  341
            K+ KAE V +F LEIEL A L HPNI  FIGVAW SL+NL MV+EY   G L+ +L++  
Sbjct  83   KENKAEDVHEFVLEIELNARLQHPNIGAFIGVAWGSLNNLAMVIEYFPLGDLQRYLKKNS  142

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                            R+  S N+LLT  +E K+IDFGVSRG +
Sbjct  143  DLLSWARDKIYMALGVARALEYLHGYSPPIIHRDLKSKNILLTRQLEAKVIDFGVSRGRL  202

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKP  429
            D +MTAGVGTP+WTAPE+LEG  Y+E+AD+YSFGVVLSELDT ++P+HD ++ +G K KP
Sbjct  203  DNTMTAGVGTPYWTAPEVLEGKRYSEQADIYSFGVVLSELDTCKIPFHDCLSANGKKAKP  262

Query  430  VQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
              IL+ VMSGT+RPSFS +CPPRIRRIG AC   DP+ RPTA +L++ L+G
Sbjct  263  FHILQGVMSGTLRPSFSPDCPPRIRRIGVACCQHDPARRPTATQLIQLLQG  313

>PITG_17578
Length=481

 Score = 316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 161/305 (53%), Positives = 203/305 (67%), Gaps = 38/305 (12%)

Query  210  SSPQQRRDSAIQSLYCERAGSN---KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWV  266
            S  Q+RR S     Y   +GSN   K LLDSEHL G RIPFDS+ F R +SKGA GEVW+
Sbjct  172  SGVQKRRSSGYSVDYS--SGSNLTMKILLDSEHLIGMRIPFDSLSFTRALSKGAYGEVWI  229

Query  267  CEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVL  326
             E++ Q+ A+K+L   +  KAE V+ FA EIELTA L HPNIV F+GVAWN+L NL+M L
Sbjct  230  GEYDGQQVAIKKLFSGRDHKAEEVEAFAKEIELTARLAHPNIVSFVGVAWNTLTNLIMAL  289

Query  327  EYLSTGSLKEFLEEP---------------------------------REFMSSNVLLTD  353
            E+L +G L  +L +                                  R+  S N+LLT 
Sbjct  290  EFLPSGDLHGYLTKHADVLSWSKDKMGIAIGVARALEFLHSQVPPLIHRDLKSKNILLTR  349

Query  354  SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
             +EPK+IDFGVSRG  D SMTAGVGTP+WTAPEILEG  YTE+AD+YS GVVL+E+DTG+
Sbjct  350  QLEPKLIDFGVSRGCEDFSMTAGVGTPYWTAPEILEGKRYTEQADIYSLGVVLTEIDTGK  409

Query  414  VPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
            +PYHDA+T +GT  KP  IL +V++G +RPSF++ECPP+IR+IG AC   +P SRPTA E
Sbjct  410  LPYHDALTPEGTIPKPFMILADVIAGILRPSFAEECPPKIRQIGVACCQHNPDSRPTATE  469

Query  474  LVRQL  478
            +V  L
Sbjct  470  VVTLL  474

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 28/49 (57%), Gaps = 0/49 (0%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVS  49
            +  + MA+LAVP A    V+CT   C+QP+   ++  Q CTG  +L  +
Sbjct  101  LNGHNMANLAVPLAQYQAVNCTERTCTQPDDTPSYSNQQCTGVDILKAA  149

>PHYSO_337956
Length=563

 Score = 316 bits (810),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 207/291 (71%), Gaps = 40/291 (14%)

Query  226  ERAGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQR  282
            E AGSNKTL   L S+HL GKRIP+++  F++ ISKG SGEVWVCE+N++K A KRL   
Sbjct  268  EGAGSNKTLRILLASQHLNGKRIPYNNFAFQQAISKGGSGEVWVCEYNQRKVAAKRL---  324

Query  283  KKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL----  338
            ++QKAE V  FA EIEL+ASLIHP+IV+FIGVAW+SL NLVM+LEY+  G+L  FL    
Sbjct  325  QEQKAEKVHAFAEEIELSASLIHPHIVEFIGVAWSSLSNLVMILEYVPGGTLWSFLNTNA  384

Query  339  ------------------------EEP-----REFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                    + P     R+  SSN+LLTD +EPK+IDFGVSRG+ 
Sbjct  385  ELLSWARCKIDIAIGIAQALEYLHDRPPPLIHRDLKSSNMLLTDKLEPKLIDFGVSRGIA  444

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKP  429
            D++MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVLSELDTG  PY     E G +L  
Sbjct  445  DITMTAGVGTPYWTAPEILEGKRYTEQADVYSFGVVLSELDTGIAPYSADEREGGGRLNH  504

Query  430  VQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            +QILK V++GT+RP+FS ECP RI+R+  ACL+ +P +RPTA  L+R+LEG
Sbjct  505  LQILKGVVAGTLRPTFSSECPLRIQRV-EACLAHNPVNRPTAQHLLRELEG  554

 Score = 124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 30/127 (24%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            MG+Y+M D+A+PKADV+ VDCT+LNCSQPN  TA++ + CTG+Q+LN SR          
Sbjct  119  MGDYSMTDIAIPKADVANVDCTFLNCSQPNAETAYFTKTCTGYQILNASRCVVDLFEDPG  178

Query  51   --------WD----PTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNEC  98
                    W     P  TP +RLR+H W QDI EFGG ITF VY VHTVP         C
Sbjct  179  AGSFLGTMWSTGGFPNRTPELRLREHTWTQDIDEFGGNITFSVYSVHTVP--------TC  230

Query  99   PLDEGYA  105
             LD+G++
Sbjct  231  DLDDGFS  237

>PHYSO_337950
Length=575

 Score = 314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 206/519 (40%), Positives = 276/519 (53%), Gaps = 93/519 (18%)

Query  5    TMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----WDPTMTPSI  59
            TMADLAV  AD   V C    CSQP+  T+    YCTG +M+  +R     +D +  P+ 
Sbjct  103  TMADLAVLLADFHAVGCEEKKCSQPDNSTSSSNYYCTGAEMVAAARCVVDDFDDSSNPNT  162

Query  60   RLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDE---GYASLTVPCHRRIE  116
             +                    + +   P D +P++N C   +   G+ SL  PC+    
Sbjct  163  AM--------------------WGIGGDPED-EPSYNTCATSDENGGFGSLVFPCYLARN  201

Query  117  FTDDYMAANTTVPAGSAFVTTWLKQEFA---QEDSPSQLLIPVILGVAIAVAGMALGWLS  173
             +D  ++    V  GSA+V+ WL ++++    E     LLI +I G  +    + L  + 
Sbjct  202  ASDAIISKRQQV-NGSAWVSRWLVEDYSVSSAEGIDMVLLIAIICGAVVFALVVLLAVVY  260

Query  174  CRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAGSNKT  233
             RRK   + ++ SG +    +   S +  +R    +  P    D A +    E   + KT
Sbjct  261  RRRK--CASQRDSGDQPTAPTLEDSDTVPDRL---VGKPNTV-DPAYRDFTSEWNLTLKT  314

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            LL S+ L GK IP++S+ FER ISKGA GEVW+ E+  Q+ AVKRLLQ K  +A+ V++F
Sbjct  315  LLGSKSLTGKCIPYESVKFERAISKGAHGEVWLGEYQGQQVAVKRLLQTKTLQADEVEEF  374

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------  341
            A EIEL+ASL+H NIV FIGVAWNSL NLVMVLEYL TG L+ FL +             
Sbjct  375  AKEIELSASLVHHNIVTFIGVAWNSLSNLVMVLEYLPTGDLQRFLRDNHASMSWNKDLIR  434

Query  342  ---------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTP  380
                                 R+  S N+LLT S+E K+IDFGVSR   +LSMTAGVGTP
Sbjct  435  VAVGIGRALEYFHSRSPPLIHRDLKSRNILLTASLEAKLIDFGVSRDCQELSMTAGVGTP  494

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
            +WTAPEILEG  YTEKAD+YSF                     G + KP+QIL +VM G 
Sbjct  495  YWTAPEILEGKRYTEKADIYSF---------------------GQENKPIQILTDVMVGK  533

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +RPSFSD+CPPRI  I   C  LD   RPTA E+V+ L+
Sbjct  534  LRPSFSDKCPPRILCIAAECCQLDAFKRPTATEVVKMLQ  572

>PHYSO_337967
Length=677

 Score = 316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/291 (54%), Positives = 201/291 (69%), Gaps = 36/291 (12%)

Query  228  AGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            +GSN+TL   L SE L  KR+PF+S+VF+R +SKGA GEVW+ E+  Q+ A+KRLLQ K 
Sbjct  385  SGSNQTLQILLGSEFLVAKRLPFESLVFKRALSKGACGEVWLGEYQCQQLAIKRLLQAKA  444

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
             +A+ V++FA EIEL+ASL+HPNIV FIGVAWNSL+NLVM LE+   G L+ +LE+    
Sbjct  445  HQADEVEEFAQEIELSASLMHPNIVSFIGVAWNSLNNLVMALEFFPMGDLQAYLEKHADL  504

Query  342  ------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDL  371
                                          R+  S N+LLT  +E K+IDFGVSR   + 
Sbjct  505  MTWAKDKIHIAVGVARALEYLHSRTPPLIHRDLKSKNILLTQKLEAKLIDFGVSRNRQEH  564

Query  372  SMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQ  431
            SMTAGVGTP+WTAPEILEG  Y E+ D+YSFGVVLSELDTG++PYHDA+T +G K KP Q
Sbjct  565  SMTAGVGTPYWTAPEILEGKRYMEQVDIYSFGVVLSELDTGKIPYHDALTSEGKKPKPFQ  624

Query  432  ILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            IL +VM+G +RPSFS++CP RIRRIG AC   DP+ RPTA ++ + L+  D
Sbjct  625  ILSDVMAGMLRPSFSEQCPTRIRRIGVACCQHDPARRPTAAQVAKMLQVSD  675

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 78/168 (46%), Gaps = 28/168 (17%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++M DLAVP      V C   NCSQP+   +    YC G QML+  R          
Sbjct  103  LAGHSMTDLAVPLVQFEAVGCVATNCSQPDDTLSLSNLYCNGEQMLHAVRCVMEDFTETV  162

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+ R R H+W+ D       +++ V  +HTV  + + A+N CP 
Sbjct  163  QIHGAMWMTGGNPEVMPTPRARKHQWKDDSTN----VSYTVLAIHTVDQEDEAAYNVCPT  218

Query  101  DE---GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQ  145
             +   GY SL + CH R   TD+  +A       + +V+ WL ++F+ 
Sbjct  219  SKQNGGYGSLVLSCHSRTNITDEVKSAMLEAQP-TPWVSRWLVEDFSN  265

>PITG_17577
Length=510

 Score = 310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 197/291 (68%), Gaps = 36/291 (12%)

Query  228  AGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            +G N TL   L+SE L GKRIP+DS+ F++ +SKGA GEVW+ E+  Q+ A+KRLLQ K 
Sbjct  220  SGPNSTLQILLNSEGLIGKRIPYDSLSFKKSLSKGACGEVWLGEYEGQQVAIKRLLQIKS  279

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
             +A+ V++FA EIEL+ASL+HPNIV FIGVAWNSL NLVM LE+   G L+E+L +    
Sbjct  280  HRADEVEEFAREIELSASLVHPNIVSFIGVAWNSLSNLVMALEFFPMGDLQEYLAKNGDL  339

Query  342  ------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDL  371
                                          R+  S N+LLT  +E K+IDFGVSR   + 
Sbjct  340  LSWPRDKIQIAVGVGRALEYLHCRSPPLIHRDLKSKNILLTSRLEAKLIDFGVSRDRQEY  399

Query  372  SMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQ  431
            SMTAGVGTP+WTAPE+LEG  YTE+AD+YSFGVVL+ELDT +VPYHDA+T +G K KP Q
Sbjct  400  SMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLTELDTSKVPYHDALTAEGKKPKPFQ  459

Query  432  ILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            IL +VM+G +RPSFS+ CP RIRRIG AC   DP  RPTA ++   L+  D
Sbjct  460  ILTDVMAGMLRPSFSENCPLRIRRIGVACCQHDPIRRPTAAQVADMLQAAD  510

 Score = 37.4 bits (85),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPN-GVTAHYAQYCTGWQMLNV  48
            +G ++M+DLAVP      V+C   NC+QP   + +    YC+  +  N+
Sbjct  102  LGGHSMSDLAVPLDQFRAVECEETNCTQPGTTIVSRSNLYCSAKRQRNI  150

>PHYRA_84552
Length=704

 Score = 315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 197/282 (70%), Gaps = 33/282 (12%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            K LLDSE L G+R+P++S+ +++ +SKGA GEVW+ E+  Q+ A+KRLLQ K  +A+ V+
Sbjct  421  KILLDSESLRGRRLPYESLSWKKSLSKGACGEVWLGEYQGQQVAIKRLLQIKTARADDVE  480

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------  341
             FA EIEL+ASL+HPNIV F+GVAWNSL+NLVM LE+   G L+ +L +           
Sbjct  481  AFAQEIELSASLVHPNIVAFLGVAWNSLNNLVMALEFFPMGDLQAYLMKNADLMSWSKDK  540

Query  342  -----------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVG  378
                                   R+  S N+LLT  +E K+IDFGVSR   + SMTAGVG
Sbjct  541  IHIAAGVGRALEYLHSRSPPLIHRDLKSKNILLTRMLEAKLIDFGVSRDRQEHSMTAGVG  600

Query  379  TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMS  438
            TP+WTAPEILEG  YTE+ADMYSFGVVLSELDTG++PYHDA+T +G K KP QIL +VM+
Sbjct  601  TPYWTAPEILEGKRYTEQADMYSFGVVLSELDTGKIPYHDALTSNGKKPKPFQILTDVMA  660

Query  439  GTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            G +RPSFS++CP RIRRIG AC   DP  RPTA ++VR LEG
Sbjct  661  GMLRPSFSEDCPSRIRRIGVACCQNDPIKRPTAAQVVRMLEG  702

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 78/167 (47%), Gaps = 26/167 (16%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++MADLAVP A    V C  +NC+QP+   +    YC G QML  +R          
Sbjct  134  LSGHSMADLAVPLAQFQDVGCVEMNCTQPDTTQSLSNLYCNGDQMLTAARCVAQEFEDDA  193

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+   R H+W       G    + V  +HTV  D +  +  CP 
Sbjct  194  EIHLAMWMTGGNPKVVPNPLFRKHQWVDG--SSGTDQYYTVAAIHTVNMDNEATYGVCPT  251

Query  101  DE---GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFA  144
            D+   GY SL +PC+     TDD + +   V  G+ +V+ WLK+++ 
Sbjct  252  DDQNGGYGSLVLPCYHFGNITDDVLESLEEV-EGTPWVSRWLKEDYG  297

>PPTG_16200
Length=745

 Score = 311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 197/291 (68%), Gaps = 36/291 (12%)

Query  228  AGSNKTL---LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            +GSN TL   L SE L GKR+P+DS+ F + +SKGA GEVW+ E+  Q+ A+KRLLQ K 
Sbjct  455  SGSNSTLQILLKSEFLRGKRLPYDSLSFTKPLSKGACGEVWLGEYEGQQVAIKRLLQVKA  514

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
             +A+ V++FA EIEL+A L+HPNIV FIGVAWNSL+NLVM LE+   G L+ +L +    
Sbjct  515  HRADEVEEFAREIELSACLVHPNIVSFIGVAWNSLNNLVMALEFFPMGDLQAYLAKNGDL  574

Query  342  ------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDL  371
                                          R+  S N+LLT  +E K+IDFGVSR   + 
Sbjct  575  MSWPRDKIHIAVDVGCALKYLHSRSPPLIHRDLKSKNILLTSRLEAKLIDFGVSRDRQEY  634

Query  372  SMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQ  431
            SMTAGVGTP+WTAPE+LEG  YTE+AD+YSFGVVL+ELDTG+VPYHDA+T +G K KP Q
Sbjct  635  SMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLTELDTGKVPYHDALTAEGNKPKPFQ  694

Query  432  ILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            IL +VM+G +RPSFS +CP RIRRIG AC   DPS RPTA ++   L+  D
Sbjct  695  ILTDVMAGMLRPSFSKDCPSRIRRIGVACCQQDPSRRPTAVQVAHMLQEAD  745

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 88/169 (52%), Gaps = 28/169 (17%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQY-CTGWQMLNVSR---------  50
            +G ++M DLAVP    + V C  +NC+QP  V   Y+ + C+G QML  +R         
Sbjct  175  LGGHSMTDLAVPLDQFNAVGCKEMNCTQPGTVIKSYSNFHCSGEQMLKAARCVVQDFEES  234

Query  51   -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99
                   W    +P + P+ ++R H W+ D       +++ V  VHTV  + + A+ ECP
Sbjct  235  ESLHLAMWMTGGNPKVIPTPQIRKHSWKDDYSN----VSYVVVAVHTVLGNDEAAYGECP  290

Query  100  L--DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQE  146
               + GY SL +PC+  +  T++   A  TV  GS +VT WL+QE++ E
Sbjct  291  KTGNGGYGSLVLPCYTTVNITEEVRDAMVTV-EGSPWVTKWLRQEYSDE  338

>PHYSO_253201
Length=540

 Score = 295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 184/502 (37%), Positives = 269/502 (54%), Gaps = 109/502 (22%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++M DLAVP  +   V C  +NC+Q +  T+    +C G QM+N +R          
Sbjct  84   LGGWSMVDLAVPLVEFQAVGCVEINCTQTDNTTSLSNLFCNGEQMVNAARCAVEDFIDKS  143

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+  +  H W+    + G  I++ V  +HTV  D + A+ EC  
Sbjct  144  DTRSAMWKTGGNPEVVPTSLIMRHIWK----DGGSNISYDVAAIHTVGKDDEAAYGECTT  199

Query  101  DE---GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ------  151
             E   G+ S T+PC    + +++       V  GS +V+ WL + +  + S +       
Sbjct  200  KEQNKGFGSRTLPCLSVGKMSEEAKTQMQEVE-GSDWVSRWLVEAYGTQASDASSSNGGN  258

Query  152  --LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISI  209
              +L+ +I  +A + A +     + RR  E ++K+ S  E                    
Sbjct  259  TIILVLLIPIIAGSQATVDDTETASRRLAEEALKRNSTFE--------------------  298

Query  210  SSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEF  269
                  RD + +S              +EHL  KRIPF++I F+R ISKG +GEVWV E+
Sbjct  299  ------RDFSSES--------------NEHLVEKRIPFENIRFDRAISKGVNGEVWVGEY  338

Query  270  NRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYL  329
            + ++ A+KRLLQ +  +AE V++F++EIEL+A+L+HPN V FIGVAWN+L+NLVMVLEY 
Sbjct  339  SGRQVAIKRLLQARDNRAEDVEEFSIEIELSANLVHPNNVTFIGVAWNTLNNLVMVLEYF  398

Query  330  STGSLKEFL-----------------------------EEP----REFMSSNVLLTDSIE  356
              G L  +L                             + P    R+  S N++LT  +E
Sbjct  399  PAGDLLAYLVKNEDLLTWAQDKLGIAVGVARAVRYLHSQSPPLIHRDLKSKNIMLTRKLE  458

Query  357  PKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY  416
            PK+IDFGVSRG  + SMTAGVGTP+W+APEILE   YTE+ D+YSFGVVLSELDTG++PY
Sbjct  459  PKLIDFGVSRGRHEHSMTAGVGTPYWSAPEILEEKRYTEQTDIYSFGVVLSELDTGKLPY  518

Query  417  HDAVTEDGTKLKPVQILKEVMS  438
            HDA+T DG K KP  IL +V++
Sbjct  519  HDALTPDGKKPKPFHILSDVIA  540

>PHYSO_337959
Length=642

 Score = 295 bits (756),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 181/496 (36%), Positives = 266/496 (54%), Gaps = 102/496 (21%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G ++M DLAVP  +   V C  +NC+Q +  T+    +C G QM+N +R          
Sbjct  191  LGGWSMVDLAVPLVEFQAVGCVEINCTQTDNTTSLSNLFCNGEQMVNAARCAVEDFIDKS  250

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+  +  H W+    + G  I++ V  +HTV  D + A+ EC  
Sbjct  251  DTRSAMWKTGGNPEVVPTSLIMRHIWK----DGGSNISYDVAAIHTVGKDDEAAYGECTT  306

Query  101  DE---GYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQE--DSPSQLLIP  155
             E   G+ S T+PC    + +++       V  GS +V+ WL + +  +  D+ S     
Sbjct  307  KEQNKGFGSRTLPCLSVGKMSEEAKTQMQEVE-GSDWVSRWLVEAYGTQASDASSSNGGN  365

Query  156  VILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQR  215
             I+ V +       G  S + +L+     ++G++                   +   +  
Sbjct  366  TIILVLLIPIIAGTGGRSSQEELDL----RTGLQ-------------------LRVQRHA  402

Query  216  RDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAA  275
            +D+ +Q                EHL  KRIPF++I F+R ISKG +GEVWV E++ ++ A
Sbjct  403  KDAPVQ----------------EHLVEKRIPFENIRFDRAISKGVNGEVWVGEYSGRQVA  446

Query  276  VKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLK  335
            +KRLLQ +  +AE V++F++EIEL+ASL+HPN V FIGVAWN+L+NLVMVLEY   G L 
Sbjct  447  IKRLLQARDNRAEDVEEFSIEIELSASLVHPNNVTFIGVAWNTLNNLVMVLEYFPAGDLL  506

Query  336  EFL-----------------------------EEP----REFMSSNVLLTDSIEPKIIDF  362
             +L                             + P    R+  S N++LT  +EPK+IDF
Sbjct  507  AYLVKNEDLLTWAQDKLGIAVGVARAVRYLHSQSPPLIHRDLKSKNIMLTRKLEPKLIDF  566

Query  363  GVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE  422
            GVSRG  + SMTAGVGTP+W+APEILE   YTE+ D+YSFGVVLSELDTG++PYHDA+T 
Sbjct  567  GVSRGRHEHSMTAGVGTPYWSAPEILEEKRYTEQTDIYSFGVVLSELDTGKLPYHDALTP  626

Query  423  DGTKLKPVQILKEVMS  438
            DG K KP  IL +V++
Sbjct  627  DGKKPKPFHILSDVIA  642

>PITG_17583
Length=550

 Score = 290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 184/449 (41%), Positives = 247/449 (55%), Gaps = 64/449 (14%)

Query  57   PSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP---LDEGYASLTVPCHR  113
            P++R+  H+W+    ++       +  +HTV  + +P W  CP   ++ GY SL  PC  
Sbjct  142  PTLRMIKHQWDDQGAKY------EIMALHTVTSENEPGWEACPTSTMNGGYGSLVFPCWT  195

Query  114  RIEFTDDYMAAN---TTVPAGSAFVTTWLKQEF---AQEDSPS---QLLIPVILGVAIAV  164
                TD+  A N        GS +V+ WL  ++   A  DS      LL+P+ILG  +  
Sbjct  196  ----TDNITAENEKQMKNVTGSQWVSEWLVTDYKDAAGTDSSGFNKLLLLPIILGALVIF  251

Query  165  AGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLY  224
            A + L    C++K     +QK+  E++  +     +     A    + Q  +  A     
Sbjct  252  ALIGL-MFYCKKK----RQQKARSEYDATTTDLMAT-----ATYSGADQTIQFPAGYGAE  301

Query  225  CERAGSN---KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
                GSN   K LL SE+L GKRIP + + FE  +SKGASGEVWVCE+  QK A KRLLQ
Sbjct  302  FASGGSNTTLKVLLTSEYLIGKRIPPEHLSFENALSKGASGEVWVCEYAGQKVAAKRLLQ  361

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K+ KAE V +FALEIEL A L HPNI  FIGVAW SL NL MV+EY   G L+++L+  
Sbjct  362  TKENKAEDVHEFALEIELNAHLEHPNIGAFIGVAWGSLHNLTMVIEYFPLGDLQKYLKRN  421

Query  342  REFMSSNVLLTDSIEPKIIDFGVSRGL---------VDLSMTAGVGTPFWTAPEILEGNH  392
             +      LLT + +   +  GV+R L         +D +MTAGVGT FWTAPEILEG  
Sbjct  422  AD------LLTWARDKIHLAVGVARALDQSNRLWSELDNTMTAGVGTLFWTAPEILEGKR  475

Query  393  YTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPR  452
            Y+E+AD+YSFGVVLSELDT ++P+HD    DG K KP  IL+EVM+GT+RP         
Sbjct  476  YSEQADIYSFGVVLSELDTCKIPFHDCAGSDGKKPKPFHILQEVMAGTLRPIL-------  528

Query  453  IRRIGTACLSLDPSSRPTAHELVRQLEGR  481
                   C   DPS RP+  +LV  L+G 
Sbjct  529  -------CCQHDPSRRPSGAQLVEMLQGN  550

>PHYSO_520398
Length=679

 Score = 274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 184/296 (62%), Gaps = 34/296 (11%)

Query  219  AIQSLYCERAGSNK---TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAA  275
            A++  +C  + ++    TL    +L GKRI ++ I   R++S+GA GEVW C +  +K A
Sbjct  384  AMRETFCRYSAADNVQYTLTTDSNLVGKRIAWERIELGRLLSRGAFGEVWACRYAGKKVA  443

Query  276  VKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLK  335
            VKRLLQ KK      +KF  EI+LTASL HPN+V+FIGVAW+SL+NL +V EYL  G L+
Sbjct  444  VKRLLQSKKPTFHETEKFTNEIQLTASLNHPNVVRFIGVAWSSLENLALVEEYLPRGDLQ  503

Query  336  EFLEEP-------------------------------REFMSSNVLLTDSIEPKIIDFGV  364
            ++L                                  R+  + NVLLT  ++PK+IDFG 
Sbjct  504  QYLHRNGDLMTWACDKIHMAVGIAKAIQYLHSREVIHRDLKARNVLLTKRLQPKLIDFGA  563

Query  365  SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDG  424
            SR +    M+AGVGTPFWTAPE+LE   YTEKAD+YSFGV+L+ELDT + P+H  V  +G
Sbjct  564  SRLISPFDMSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLTELDTCEAPFHSVVGANG  623

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
             K+KP  ILK+V+ G +RPS +D CP RIR+   AC   DP  RP+A ELV+ LEG
Sbjct  624  EKMKPFLILKQVVDGLLRPSLTDGCPQRIRKAADACFQHDPKLRPSASELVKLLEG  679

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 67/147 (46%), Gaps = 19/147 (13%)

Query  52   DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPC  111
            DP M P IR   H W     +     ++ VY VHT+    +PA+  C  + GY SL +PC
Sbjct  20   DPDMVPHIRAVLHGWR----DLDNNNSYLVYAVHTMSAKSEPAYGTCNTN-GYGSLVIPC  74

Query  112  HRRIEFTDDYMAANTTVPAGSAFVTTWLKQE--------FAQEDSPSQ-----LLIPVIL  158
            +     + D +A   + P  S ++TTW+KQ          +  DSP       LLIP+IL
Sbjct  75   YPLSNTSADVVAV-MSAPVTSPWLTTWIKQYRPATDTTVHSDSDSPGSGFNLWLLIPIIL  133

Query  159  GVAIAVAGMALGWLSCRRKLEASMKQK  185
                A A +       RR+L +   Q+
Sbjct  134  SALAAAALIFAAVFKKRRRLRSVYWQR  160

>PHYRA_84558
Length=415

 Score = 263 bits (672),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/281 (49%), Positives = 176/281 (63%), Gaps = 33/281 (12%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TLL+   L GKR+P  S+ F+  +S GASGEVW+ +F  Q+ AVK+LL+  +   + V +
Sbjct  126  TLLECPELMGKRVPAQSLHFKATLSSGASGEVWLAQFGNQQVAVKQLLRTIEHTLKDVTE  185

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------  341
            F  EI L+ASL HP+IV FIGVAW+SLDN+ MV+EY   G L+ FL E            
Sbjct  186  FVDEIVLSASLSHPHIVSFIGVAWSSLDNVGMVMEYCPMGDLRRFLAESGRLLSWSRDKI  245

Query  342  ----------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R   S N+LLT++++ KIIDFGVSR   D  MTAGVGT
Sbjct  246  RMTVGITRALQYMHSREPPIIHRALKSKNILLTETLQTKIIDFGVSRSRKDGFMTAGVGT  305

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
            P+W APEILEG  YTE+AD+YSFGVVLSELDT ++P+ D VT++G K KP Q+L  V+ G
Sbjct  306  PYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTDEGKKPKPFQVLHWVLDG  365

Query  440  TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            ++ PSFS+ECP  IR +G  CL  DP  RPTA EL   L  
Sbjct  366  SLSPSFSEECPRWIRSVGMQCLQHDPDLRPTAAELTHMLRA  406

>PITG_17582
Length=707

 Score = 268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/279 (49%), Positives = 174/279 (62%), Gaps = 31/279 (11%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TL    +L GKRI ++ I   R++S+GA GEVW C +  +K AVKRLLQ +       +K
Sbjct  429  TLTTDSNLIGKRIAWERIQLGRLLSRGAYGEVWACRYAGKKVAVKRLLQTRTHTFLETEK  488

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------  341
            F  EI+LTASL HPNIV+FIGV W+SL+NL MV EYL  G L+ +L+             
Sbjct  489  FTNEIQLTASLNHPNIVRFIGVTWSSLENLAMVEEYLPRGDLQNYLKRNGDLMTWARDKI  548

Query  342  --------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
                                R+  + N+LLT  ++PK+IDFG SR      M+AGVGTPF
Sbjct  549  DMAIGIARAIDYLHTRQVIHRDLKARNILLTKRLQPKLIDFGTSRLWEPNDMSAGVGTPF  608

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            WTAPE+LE + YTEKAD+YSFGV+L+ELDT + PYHD +  +G K KP  +LK+V+ GT+
Sbjct  609  WTAPEVLESSEYTEKADIYSFGVLLTELDTCEAPYHDTLGANGEKKKPFHVLKDVVDGTL  668

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            RPS S  CP RI R   AC   DP+ RP+A ELVR LEG
Sbjct  669  RPSLSTGCPQRICRAADACFQHDPTLRPSASELVRMLEG  707

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 65/144 (45%), Gaps = 19/144 (13%)

Query  56   TPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRRI  115
            TP IR   H W     +     ++ +Y VHT+  D +PA+  C    GY SL VPC+   
Sbjct  24   TPEIRAVMHGWL----DASTNDSYLLYAVHTMTVDSEPAYGTCN-KGGYGSLVVPCYPLS  78

Query  116  EFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ-------------LLIPVILGVAI  162
              + D +A   +VP  + +VTTW+KQ     D+                LL P++L   I
Sbjct  79   NTSTDIVAV-MSVPVATPWVTTWIKQYQPTSDTTVNSESDSDGSGFNLWLLGPILLSALI  137

Query  163  AVAGMALGWLSCRRKLEASMKQKS  186
            A   +A      RR+L +   Q++
Sbjct  138  ASILIAFAVFRKRRRLRSVYFQRT  161

>HYAP_14441
Length=832

 Score = 270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/296 (47%), Positives = 183/296 (62%), Gaps = 34/296 (11%)

Query  219  AIQSLYCERAGSNK---TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAA  275
            A++  +C  + ++    TL    +L GKRI ++ I  +R++S GA GEVW+C +  ++ A
Sbjct  537  AMRETFCRYSAADNVQYTLTTDPNLIGKRIAWERIELDRLLSSGAFGEVWLCRYASKQVA  596

Query  276  VKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLK  335
            VKRLLQ KK      + F  EI+LTASL HPNIV+FIGV W+SL+NL MV EYLS G L+
Sbjct  597  VKRLLQSKKPTFRETEAFTSEIQLTASLDHPNIVRFIGVCWSSLENLAMVEEYLSRGDLQ  656

Query  336  EFLEEPREFMS-------------------------------SNVLLTDSIEPKIIDFGV  364
             +L++  + M+                                NVLLT  + PK+IDFG 
Sbjct  657  NYLQQNSDLMTWACDKIDMAIGVARAIACLHGRRVIHRDIKARNVLLTKRLRPKLIDFGA  716

Query  365  SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDG  424
            SR      M+AGVGTPFWTAPE+LE   YTEKAD+YSFGV+LSELDTG+ PYH+ +  +G
Sbjct  717  SRLWAPSDMSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLSELDTGKAPYHNMLRANG  776

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
             K KP  ILK+V+ G++RPS    CP RIR+   AC   DP  RP+A ELV+ L+G
Sbjct  777  EKAKPFLILKKVVDGSLRPSLVMGCPQRIRKAAEACFQHDPKLRPSAAELVKLLDG  832

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 76/168 (45%), Gaps = 26/168 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G   MA LAV + +     CT LNCSQP+G   +  ++CTG QML  ++          
Sbjct  127  LGGRPMAHLAVSEVEFHTTGCTALNCSQPDGTMYYANEFCTGTQMLTTAKCLMDTFESDS  186

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    D  M P IR   H W         L+      VHT   + +PA+  C  
Sbjct  187  SSHLAMWSDGGDMKMVPEIRAVMHGWLDASTNSSYLLA----AVHTAKLESEPAYGACKK  242

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDS  148
            D GY SL VPC+  ++ T   + A   VP  + ++TTW+KQ     D+
Sbjct  243  D-GYGSLVVPCY-SLKHTAADIVAVMAVPVETPWITTWIKQYQVTSDT  288

>PPTG_01981
Length=367

 Score = 257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/360 (42%), Positives = 198/360 (55%), Gaps = 92/360 (26%)

Query  130  AGSAFVTTWLKQEFAQEDSPSQLLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIE  189
            A  A+VTTWLK EFA E     LLIPVIL   + VA M +GW   +R      +Q S  +
Sbjct  52   AEPAWVTTWLKDEFAVEGFEELLLIPVIL---VVVAAMGIGWFCWKRSSLLKREQASSCD  108

Query  190  HerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDS  249
                                       D  +Q  +     +NK     +HL G RIP+DS
Sbjct  109  F--------------------------DVVLQITWMSLL-TNKLFDGRQHLHGNRIPYDS  141

Query  250  IVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIV  309
            +VF+  +SKGA GEVW+C +  Q+ AVK+LL  + QKAE VQ FA EIELTASLIHP+IV
Sbjct  142  LVFQTELSKGAPGEVWICRYGGQEVAVKKLLHIRDQKAEDVQIFAEEIELTASLIHPHIV  201

Query  310  QFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------------------  341
            +FIGVAWNSL NL MVLEY+  G+L+++L                               
Sbjct  202  KFIGVAWNSLSNLSMVLEYVPRGNLRDYLHTNSDILSWARDRIFMAIAVAEALENLHSRT  261

Query  342  -----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEK  396
                 R+  S+ +LLT S++PK+IDFGVSRG++DL+MTAGV                   
Sbjct  262  PAIIRRDLKSNYILLTKSLDPKLIDFGVSRGMMDLTMTAGV-------------------  302

Query  397  ADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRI  456
                      SELDTG++P+ DAV +DGT+L P QIL+E+M+GT+RPSFS +CPPRI+ +
Sbjct  303  ----------SELDTGRIPHFDAVEDDGTRLVPFQILQEIMTGTLRPSFSVDCPPRIQML  352

>PPTG_16191
Length=877

 Score = 270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 137/279 (49%), Positives = 174/279 (62%), Gaps = 31/279 (11%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TL    +L GKRI ++ I   R++S+GA GEVW C +  +K AVKRLLQ +       +K
Sbjct  599  TLTTDSNLIGKRIAWERIELGRLLSRGAFGEVWACRYAGKKVAVKRLLQTRTHTFLETEK  658

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------  341
            F  EI+LTASL HPNIV+FIGV W+SL+NL MV EYL  G L+ +L+             
Sbjct  659  FTNEIQLTASLNHPNIVRFIGVTWSSLENLAMVEEYLPRGDLQNYLKRNGDLMTWARDKI  718

Query  342  --------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
                                R+  + N+LLT  ++PK+IDFG SR      MTAGVGTPF
Sbjct  719  DMAIGIARAIDYLHSRQVIHRDIKARNILLTKRLQPKLIDFGASRLWEPNDMTAGVGTPF  778

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            WTAPE+LE   YTEKAD+YSFGV+L+ELDT + PYH+ +  +G K+KP  ILKEV+ GT+
Sbjct  779  WTAPEVLESTEYTEKADIYSFGVLLTELDTCEAPYHNTLGANGEKMKPFHILKEVVDGTL  838

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            RPS S  CP RI +   AC   DP+ RP+A ELVR LEG
Sbjct  839  RPSLSCNCPQRISKAADACFQHDPNLRPSASELVRMLEG  877

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 96/218 (44%), Gaps = 39/218 (18%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G  +M++LA+ K +     CT LNCSQP+  T +   +CTG QML  ++          
Sbjct  130  LGGRSMSNLAISKVEFDTTGCTALNCSQPDDSTYYANNFCTGTQMLTAAKCLMDNFDSDT  189

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    DP M P IR   H W     +     ++ +Y VHT+  D +PA+  C  
Sbjct  190  SSHLAMWSDGGDPDMVPEIRAVMHGWL----DASTNDSYLLYAVHTMTVDAEPAYGTCN-  244

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ---------  151
              GY SL VPC+     + D +A   + P  + +VTTW+KQ     D+            
Sbjct  245  KGGYGSLVVPCYPMSNTSADIVAV-MSAPVATPWVTTWIKQYQPASDTTVNSESDSDGSG  303

Query  152  ----LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQK  185
                LL P++L   IA   +       RR+L +   Q+
Sbjct  304  FNLWLLGPILLSALIASILIIFAVFRKRRRLRSVYFQR  341

>PHYRA_84556
Length=817

 Score = 268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 186/304 (61%), Gaps = 36/304 (12%)

Query  213  QQRRDS--AIQSLYCERAGSNK---TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVC  267
            Q  R+S  A++  +C  + ++    TL+   +L GKRI ++ I   R++S+GA GEVW C
Sbjct  514  QADRESIPAMRETFCRYSAADNVQYTLVSDSNLAGKRIAWERIELGRLLSRGAFGEVWAC  573

Query  268  EFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLE  327
             +  ++ AVKRLLQ K       ++F  EI+LTASL HPNIV+FIGVAW+SL+NL MV E
Sbjct  574  RYAGKRVAVKRLLQSKAPTFHETEEFTNEIQLTASLNHPNIVRFIGVAWSSLENLAMVEE  633

Query  328  YLSTGSLKEFLEEP-------------------------------REFMSSNVLLTDSIE  356
            YL  G L+++L+                                 R+  + NVLLT  + 
Sbjct  634  YLPRGDLQKYLKRNGDLMTWARDKIYMAVGIARAIRYLHSREVIHRDIKARNVLLTKRLT  693

Query  357  PKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY  416
            PK+IDFG SR      M+AGVGTPFWTAPE+LE   Y+EKAD+YSFGV+LSELDT + PY
Sbjct  694  PKLIDFGASRLWAPSDMSAGVGTPFWTAPEVLESTEYSEKADIYSFGVLLSELDTCEAPY  753

Query  417  HDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVR  476
            H  +  +G K+KP  +LK VM G++RP  +  CP RIR+   AC   DP+ RP+A ELV+
Sbjct  754  HSTLGPNGEKMKPFHVLKLVMDGSLRPGLTAGCPQRIRQAADACFQRDPTLRPSASELVK  813

Query  477  QLEG  480
             LEG
Sbjct  814  LLEG  817

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 98/218 (45%), Gaps = 39/218 (18%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +G  +M++LAV K +     CT L+CSQP+  T +   +CTG QML  ++          
Sbjct  130  LGGRSMSNLAVSKVEFDTTGCTALSCSQPDDSTYNANNFCTGTQMLTAAKCLMDDFNSDA  189

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    DP + P IR   H W+          ++ VY VHT+  + +PA+  C  
Sbjct  190  SSHLAMWSDGGDPDLVPEIRGMMHGWKDSTTN----DSYLVYAVHTMGAEAEPAYGTCN-  244

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ---------  151
              GY SL VPC+     + D +A     P  + +VTTW+KQ     D+            
Sbjct  245  QGGYGSLVVPCYPMSNTSADVVAV-MAQPVATPWVTTWVKQYRPASDTTVNSESDDSDSG  303

Query  152  ----LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQK  185
                LLIP+IL   +A   +    +  RR+L+ +  Q+
Sbjct  304  FNLWLLIPIILASLMATVLVIFAVVKKRRRLQTAYWQR  341

>CCI41501
Length=680

 Score = 254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 177/560 (32%), Positives = 278/560 (50%), Gaps = 105/560 (19%)

Query  5    TMADLAVPKADVSYVDCTYLNCSQPNG-----VTAHYAQYCTGWQMLNVSR---------  50
            +M  +A+P  +   V+CT ++C+  N       T + +  C G  +L VS+         
Sbjct  141  SMDTIAIPAKNYRNVNCTTISCTVHNVPASLVKTTYRSDLCRGDDILKVSQCATEDVFGI  200

Query  51   ------WDPTMT----PSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    T    P   +  H W    P      ++ V  +HT P   + A+ +CP 
Sbjct  201  SGHSALWATGGTEDFDPEPYIIRHAWFD--PSTSK--SYLVNGIHTTPESNEAAFGKCPA  256

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTV--PAGSAFVTTWLK-QEFAQEDSPSQLLIPVI  157
                 S+ +PC    ++T + +A+N ++  PA     T WL+  + A++       + VI
Sbjct  257  TGQSGSIIIPC---AQYTSE-LASNWSLASPAFGQLTTLWLEATKSAKKKDLGTAYVVVI  312

Query  158  LGVAIAVAGMALGWLSC--RRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQR  215
              + I + G+ + ++    +R+LE S+  K               +    AI + +P+  
Sbjct  313  TIICILLVGIIVFFIVQYRKRRLEFSITMKE----------PEDIASPTWAIDVLTPRGN  362

Query  216  RD--SAIQSLYCERAGSNKTLLDSEH---------------------LEGKRIPFDSIVF  252
                 + +S + E   +++T +DS                       LE + I  + I F
Sbjct  363  MTMLQSSKSPFSESELTSRTFMDSGKSDIPSSIRSNTMCTSFFNHPILESRYISMEKIAF  422

Query  253  ERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFI  312
            +++ISKGA GE+W C++  +  AVKRLLQ K       Q+F  EI+LTASL HPNIV FI
Sbjct  423  DQLISKGAYGEIWHCQYQNRSVAVKRLLQNKSHTLHEAQEFIAEIQLTASLQHPNIVTFI  482

Query  313  GVAWNSLDNLVMVLEYLSTGSLKEFLEEP-------------------------------  341
            GVA+ +L+ L MVLE+ + G ++ +L+                                 
Sbjct  483  GVAYTTLEKLCMVLEFCAKGDVQTYLQTNETVLWTRQKLEMAMGVAKALEYLHSFSPPIL  542

Query  342  -REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMY  400
             R+  + NVLL+D ++ K+IDFG+S+ + + +MTAG+GTP+WTAPE L G  Y+EK+DMY
Sbjct  543  HRDIKAKNVLLSDQMQVKVIDFGISKHMHN-AMTAGIGTPYWTAPENLHGLEYSEKSDMY  601

Query  401  SFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTAC  460
            SFGV LSE+DT ++PY D  +E   +L PVQIL  VM+GT++P+FS   P RIR I   C
Sbjct  602  SFGVFLSEVDTCEMPYVDHKSE--LELGPVQILNRVMNGTLQPTFSAHIPRRIRDIAILC  659

Query  461  LSLDPSSRPTAHELVRQLEG  480
            L +D   RP+A  +V  L+G
Sbjct  660  LHIDAGMRPSAKRVVEMLQG  679

>PPTG_16189
Length=437

 Score = 245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 173/279 (62%), Gaps = 33/279 (12%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TLL+S  L GKRIP  ++  +  +S GASGEVW+ ++  ++ AVK+LL+  ++ A+ V+ 
Sbjct  148  TLLESLDLAGKRIPTRNLHIKATLSTGASGEVWLAQYKGRRVAVKQLLRTNERTAKDVKN  207

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------  341
            F  EI L+ASL H ++V FIGVAW+S +NL MV+EY   G L+ FL E            
Sbjct  208  FVEEIILSASLNHLHVVSFIGVAWSSPENLSMVMEYCPMGDLRRFLVESGRLLSWSRDKI  267

Query  342  ----------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R+    N+LLTD++E KI DFG+SR   +  MTAGVGT
Sbjct  268  RMAVGIAQALRYIHGRDSPIIHRDLKPKNILLTDTLEAKISDFGLSRTRREGFMTAGVGT  327

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
            P+W APEILEG  YTE AD+YSFGVVLSELDT + P+ D VT +G K KP+QIL  V+ G
Sbjct  328  PYWIAPEILEGKRYTELADIYSFGVVLSELDTCKTPFSDVVTAEGKKPKPLQILHWVLDG  387

Query  440  TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             + PSF+D+CP  IR +G  CL  DP  RPTA EL + L
Sbjct  388  RLSPSFTDKCPRWIRSVGMQCLQHDPGLRPTAAELTQVL  426

>PITG_17584
Length=404

 Score = 244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 169/271 (62%), Gaps = 37/271 (14%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TLL+S  L GKRIP  S+VF+  +S GASGEVW+ +   Q+ AVK+LLQ  ++  + V+ 
Sbjct  134  TLLESPPLMGKRIPIQSLVFKTTLSTGASGEVWLAQLKGQRVAVKQLLQTNERTLKDVKD  193

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------  341
            F  EI L+ASL H ++V FIGVAW+ +DN+ MV+E+   G L+ FL E            
Sbjct  194  FVDEIRLSASLGHQHVVSFIGVAWSRVDNVAMVMEFCPMGDLRRFLAESGRWLSWSRDKI  253

Query  342  ----------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R+  S N+LLTD++E KI DFGVSR   D  MTAGVGT
Sbjct  254  RMAIGIAQALRYLHEREPPIIHRDLKSKNILLTDTLEAKISDFGVSRSRKDGFMTAGVGT  313

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
            P+W APEILEG  YTE+AD+YSFGVVLSELDT ++P+ D VT +G K KPVQIL  V+ G
Sbjct  314  PYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHWVLDG  373

Query  440  TMRPSFSDECPPRIRR----IGTACLSLDPS  466
             + P+FSD+CP R+ R    +  +C  L PS
Sbjct  374  RLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  404

>CCA19358
Length=682

 Score = 240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 169/560 (30%), Positives = 275/560 (49%), Gaps = 105/560 (19%)

Query  5    TMADLAVPKADVSYVDCTYLNCSQPNGVTA-----HYAQYCTGWQMLNVSR---------  50
            +M ++A+P      V+CT ++C+  N  T+     + +  C G  +L VS          
Sbjct  144  SMENIAIPAKHYRSVNCTTISCTVHNVPTSLVKTTYRSDLCRGNDILKVSLCATEDVFGI  203

Query  51   ------WDPTMT----PSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    T    P   +  H W     +     ++ V  +HT     + A+ +CP 
Sbjct  204  SAHSALWATGGTDDFDPEPHIIRHAWY----DTSNSQSYLVNGIHTTLDTFEAAYGKCPS  259

Query  101  DEGYASLTVPCHRRIEFTDDYMAANTTV--PAGSAFVTTWLK-QEFAQEDSPSQLLIPVI  157
                 S+ +PC    ++T + +A+N ++  P+     T WL+  + A++       + VI
Sbjct  260  TGQSGSIIIPC---AQYTRE-LASNWSLASPSFGQLTTLWLEATKSAKKKDLGTAYVVVI  315

Query  158  LGVAIAVAGMALGWLSC--RRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQR  215
              + I + G+ + ++    +R+LE S+  +   +                 I + +P+  
Sbjct  316  TIICILLVGIIVFFIVQYRKRRLEFSISLREPHD----------LGSPNLVIDVLTPRGN  365

Query  216  RD--SAIQSLYCERAGSNKTLLDSEH---------------------LEGKRIPFDSIVF  252
                 + +S + E   +++T +DS                       L+ ++I  ++I F
Sbjct  366  MTMLQSTKSPFSELDTTSRTFMDSGKSDIPSSIHSNGMCTSFFTHPILQSRQISMENIAF  425

Query  253  ERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFI  312
             ++IS+GA GE+W C++  Q  AVKRLLQ K    +  Q+F  EI+LTASL HPNIV FI
Sbjct  426  VQLISRGAYGEIWQCQYQNQYIAVKRLLQNKTHTLQEAQEFIAEIQLTASLHHPNIVTFI  485

Query  313  GVAWNSLDNLVMVLEYLSTGSLKEFL---EEP----------------------------  341
            GVA+ +L+ L MVLE+ + G ++ +L   E P                            
Sbjct  486  GVAYTTLEKLCMVLEFCARGDVQTYLQAHESPNWTSHKREMALGVAKALEYLHSFSPPIL  545

Query  342  -REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMY  400
             R+  + NVLL+D +  K+IDFG+S+ + + +MTAG+GTP+WTAPE L+G+ Y+E +DMY
Sbjct  546  HRDIKAKNVLLSDQMHVKVIDFGISKHMHN-AMTAGIGTPYWTAPENLQGSEYSESSDMY  604

Query  401  SFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTAC  460
            SFGV LSE+DT + PY D  ++   +L PVQIL  VM+GT++PSFS   P ++ +I   C
Sbjct  605  SFGVFLSEVDTCRTPYVDLKSD--MELGPVQILHRVMNGTLQPSFSCHIPSQLEKIAKLC  662

Query  461  LSLDPSSRPTAHELVRQLEG  480
            L  D   RP A  +V  L G
Sbjct  663  LHRDAKLRPAAKSVVEMLTG  682

>PPTG_09878
Length=612

 Score = 234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 162/546 (30%), Positives = 251/546 (46%), Gaps = 120/546 (22%)

Query  2    GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50
            G++++A+LAVP +  +   CT+ NCSQP+G  ++    C   QML+ +R           
Sbjct  111  GSHSIANLAVPISHFAGAGCTWTNCSQPDGSISYSNLACNAEQMLSKARCFAEDFEDDTW  170

Query  51   -----WD----PTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP--  99
                 W     P M P+ R+    W           T+ V+ +HT+  D +P ++ECP  
Sbjct  171  VLSPTWSTGGWPPMIPTPRVYMDSWTDPADN----TTYTVFAIHTLAFDQEPFYSECPNT  226

Query  100  -LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSP---SQLLIP  155
              + GY SL VPC      +    +  T V  GS +V+ W+ +E++ + +P   +   + 
Sbjct  227  TRNGGYGSLVVPCAPTARVSASSSSEITPV-EGSPWVSRWIAEEYSTKTTPLLSTSATVG  285

Query  156  VILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQR  215
            +I G  I V  + LG++   +      K ++G                            
Sbjct  286  IITG-CIVVVLVILGFIIACKHRSKKNKGQTG----------------------------  316

Query  216  RDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAA  275
                              L D + +  KRIP + +   +++S+GA GEV+   FN ++ A
Sbjct  317  ------------------LWDDDIITAKRIPRNRVQVNQLLSRGAFGEVYAGAFNDRQVA  358

Query  276  VKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLK  335
            VK LL   ++    V +F  E  LTA + HP IV  +GVAW++L +L +VLE++  G L+
Sbjct  359  VKMLLPSTRRDIRLVNEFLAEARLTACMEHPRIVTLVGVAWDTLSDLCIVLEFMEGGDLR  418

Query  336  EFLE----------------------------------EP----REFMSSNVLLTDSIEP  357
              L                                   EP    R+  S N+LL +  E 
Sbjct  419  SLLNNYEKAKRKYPVGFSREKVTIALHVCHALTYLHSLEPPVIHRDLKSRNILLDEMHEA  478

Query  358  KIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYH  417
            K+ DFG+SR  +D +MTAGVGT  W APE++ G  Y +KAD++SFGVVLSELD   +PY 
Sbjct  479  KLTDFGISRERLDRTMTAGVGTSLWMAPEVMMGEKYDDKADIFSFGVVLSELDFHTLPYA  538

Query  418  DAVTE----DGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
                E     G ++    +L+ V  G     FSD  P  +  +G AC+S+DPS RP A E
Sbjct  539  QIKREMERSHGRQMSDATLLQRVAMGATSVEFSDVGPQSMVDLGRACVSVDPSKRPCAAE  598

Query  474  LVRQLE  479
             + +L+
Sbjct  599  ALFKLQ  604

>PHYKE_1813
Length=469

 Score = 229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 177/307 (58%), Gaps = 35/307 (11%)

Query  208  SISSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKR-IPFDSIVFERVISKGASGEVWV  266
            S++S    RDS I     E A        S+   G+R IP+ S+ F RV+SKGA GEVW+
Sbjct  157  SLNSSGNNRDSDITDKSREVAARVLQQFQSDPTLGRRRIPYSSLYFTRVLSKGAFGEVWL  216

Query  267  CEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVL  326
             +   ++ AVKR+L  KK   + ++ F  EI+L AS  HP IV+F+GV+W+S+ ++  V 
Sbjct  217  AQLENKQVAVKRILNEKKNDEKEIECFGAEIKLMASFSHPKIVEFMGVSWSSMQDVCAVT  276

Query  327  EYLSTGSLKEFLEEP---------------------------------REFMSSNVLLTD  353
            EY+S G L  FL+                                   R+  S N+LL D
Sbjct  277  EYMSKGDLYGFLKRRQGQLNWRDHKIFLAEDVADALGYLHGLSPKVIHRDLKSKNILLDD  336

Query  354  SIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTG  412
            +   K+ DFG+SR   V+ +MTAGVGT +WTAPE+L G  YTEKAD++SFG+V+SELDT 
Sbjct  337  AFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTH  396

Query  413  QVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAH  472
             VPY D     G KL+ ++I++ V+   +RP+FS ECPP ++ +   CL  DP  RP+A 
Sbjct  397  AVPYSDKRDNSGKKLQGMKIVQMVIRRQLRPTFSSECPPLVKELADRCLDADPDVRPSAM  456

Query  473  ELVRQLE  479
            EL+R ++
Sbjct  457  ELLRIIQ  463

>PHYSO_519978
Length=644

 Score = 233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 165/547 (30%), Positives = 250/547 (46%), Gaps = 97/547 (18%)

Query  15   DVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLN--------------------VSRWDPT  54
            ++ YV C    C QP+   ++ +Q CTG Q+L                     V+R    
Sbjct  112  ELRYVGCQEHACIQPDSTPSYTSQLCTGDQILKAARCVVQDFSDTSDAHTSIWVTRGKSD  171

Query  55   MTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDE---GYASLTVPC  111
              P+ R+R H W           ++ V+ VH +    +PAWNEC   +   G+ SL +PC
Sbjct  172  AIPTPRVRKHAWTSHFDNN----SYGVFAVHMIDQIYEPAWNECARADQNGGFGSLVLPC  227

Query  112  HRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQED---SPSQLLIPVILGVAIAVAGMA  168
                  + +       V  GS +V+ WL ++F       + S+L+ P  +   I V    
Sbjct  228  RTTANISLEIKTGMQQV-QGSPWVSRWLAEDFGTTSGATNDSKLVSPAAVAAGICVLVGV  286

Query  169  LGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCER-  227
            +G      K +     +  +    +    S ++        +SP+Q  D   +    ER 
Sbjct  287  VGLALFVNKKQYKKNDREAVVPTPKVHNGSSNAGPNN--DTTSPEQLTDVPTEDTDTERV  344

Query  228  -------------------AGSN---KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVW  265
                               + SN   +TL +S  L G+RIP+DS+ FER +S   + EVW
Sbjct  345  IESCPRVNTPARQMESECASDSNVVVETLFNSVSLIGRRIPYDSLTFERSLSTRGAREVW  404

Query  266  VCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMV  325
            +  +  Q+  +K+LL+     +    +F  EIEL+ASL HPNIV   GVAWN+ ++LVMV
Sbjct  405  LGTYRGQQVVIKKLLETDSPTSNDPDQFVKEIELSASLTHPNIVSVFGVAWNNSNSLVMV  464

Query  326  LEYLSTGSLKEFLEEP--------------------------------REFMSSNVLLTD  353
            +EY  TG+L+ +L +                                 R   S NVLLT 
Sbjct  465  VEYYPTGNLQAYLAKNTASLLAKDVLRIAIGIGLAVEYLHSRSPPLLHRGIRSRNVLLTK  524

Query  354  SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
            +++ K++ FG+SR   +  + AG      T  E++EG  Y+E+AD+YSFG VLS LD G 
Sbjct  525  TLKAKLVGFGLSRSPQE-HLEAGA-----TKTEVVEGKRYSEQADIYSFGAVLSALDRGM  578

Query  414  VPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
                   T +  +    QI    MS  +RPSFSDEC  RIR+I  AC  +DP  RPTA +
Sbjct  579  AINEAPTTGEKNRF---QIWANAMSRILRPSFSDECRQRIRQISAACCQIDPVQRPTAPQ  635

Query  474  LVRQLEG  480
            +V+ L+G
Sbjct  636  VVKMLKG  642

>PHYSO_337953
Length=377

 Score = 224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 168/285 (59%), Gaps = 37/285 (13%)

Query  228  AGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKA  287
            AG    LL+S  L  +RIPF  + F+  +S GA G+VW+  +   + AVK+LL+  +   
Sbjct  85   AGILPRLLESPELASRRIPFQRLKFKATLSSGAHGKVWLRLYRGHQVAVKQLLRTNEHSR  144

Query  288  ESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------  341
            + VQ FA EI LTASL HP+IV F+GVA +++D L +VLE+   G L+ FL E       
Sbjct  145  KDVQDFADEILLTASLTHPHIVAFVGVAGSNVDTLALVLEFCPMGDLRRFLRESGRLLSW  204

Query  342  ---------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVD-LSM  373
                                       R+  S NVL T+++E K+ DFGVSR   +  + 
Sbjct  205  NRDKIRMAVGVAKALRYLHDQEPPIIHRDLKSMNVLPTETLETKVGDFGVSRACSEGFTT  264

Query  374  TAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQIL  433
            TAGVGTP+W APE L+G  Y+E+AD+YSFGVVLSELDT + P+ D VT +G K KP QIL
Sbjct  265  TAGVGTPYWIAPESLQGKRYSEQADIYSFGVVLSELDTCRTPFTDGVTAEGKKPKPAQIL  324

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            + V+ G + P+FS +CP  IR +G   L  DP  RPTA EL + L
Sbjct  325  RWVLDGKLSPAFSQDCPRWIRSVG---LQHDPDMRPTATELTQML  366

>PITG_07967
Length=474

 Score = 227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/274 (42%), Positives = 165/274 (60%), Gaps = 34/274 (12%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L G RIP+ S+ F RV+SKGA GEVW+ +   ++ AVKR+L  KK   + ++ F  EI+L
Sbjct  195  LGGMRIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKL  254

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             AS  HP IV+F+GV+W+S+ ++  V EY++ G L  FL+                    
Sbjct  255  MASFSHPKIVEFMGVSWSSMQDVCAVTEYMAKGDLYGFLKRRQGQLNWRDHKIFLAEDVA  314

Query  342  ---------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAP  385
                           R+  S N+LL DS   K+ DFG+SR   V+ +MTAGVGT +WTAP
Sbjct  315  DALGYLHGLSPKVIHRDLKSKNILLDDSFRAKLSDFGISRERSVEDTMTAGVGTIYWTAP  374

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSF  445
            E+L G  YTEKAD++SFG+V+SELDT  VPY D     G KL+ ++I++ V+   +RP+F
Sbjct  375  EVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDASGKKLQGMKIVQMVIRRNLRPTF  434

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            S +CPP ++ +   CL  DP  RP+A EL+R ++
Sbjct  435  SSDCPPLVKELADRCLDSDPDVRPSAMELLRIIQ  468

>PHYSO_565433
Length=472

 Score = 225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 164/270 (61%), Gaps = 34/270 (13%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RIP+ S+ F RV+SKGA GEVW+ +   ++ AVKR+L  KK   + ++ F  EI+L AS 
Sbjct  197  RIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKLMASF  256

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------------  341
             HP IV+F+GV+W+S+ ++  V EY++ G L  FL+                        
Sbjct  257  SHPKIVEFVGVSWSSMQDVCAVTEYMAKGDLYGFLKRRQGQLNWRDHKIFLAEDVADALG  316

Query  342  -----------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILE  389
                       R+  S N+LL D+   K+ DFG+SR   V+ +MTAGVGT +WTAPE+L 
Sbjct  317  YLHGLSPKVIHRDLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVLM  376

Query  390  GNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDEC  449
            G  YTEKAD++SFG+V+SELDT  VPY D     G KL+ ++I++ V+   MRP+FS++C
Sbjct  377  GKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKIVQMVIRRNMRPTFSEDC  436

Query  450  PPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            PP ++ +   CL  +P  RP+A EL+R ++
Sbjct  437  PPLVKELADRCLDSNPDVRPSATELLRIIQ  466

>PPTG_08473
Length=473

 Score = 225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 173/299 (58%), Gaps = 35/299 (12%)

Query  216  RDSAIQSLYCERAGSNKTLLDSEHLEGK-RIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            RDS I     E A        S+   G+ RIP+ S+ F RV+SKGA GEVW+ +   ++ 
Sbjct  169  RDSEITDRSKEVASKVLEQFQSDPTLGRMRIPYSSLYFTRVLSKGAFGEVWLAQLENRQV  228

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            AVKR+L  KK   + ++ F  EI+L AS  HP IV+F+GV+W+S+ ++  V EY++ G L
Sbjct  229  AVKRILNEKKNDEKEIECFGAEIKLMASFSHPKIVEFVGVSWSSMQDVCAVTEYMAKGDL  288

Query  335  KEFLEEP---------------------------------REFMSSNVLLTDSIEPKIID  361
              FL+                                   R+  S N+LL D+   K+ D
Sbjct  289  YGFLKRRQGQLNWRDHKIFLAEDVADALGYLHGLSPKVIHRDLKSKNILLDDAFRAKLSD  348

Query  362  FGVSRGL-VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            FG+SR   V+ +MTAGVGT +WTAPE+L G  YTEKAD++SFG+V+SELDT  VPY D  
Sbjct  349  FGISRERSVEDTMTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKR  408

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               G KL+ ++I++ V+   +RP+FS +CPP ++ +   CL  DP  RP+A EL+R ++
Sbjct  409  DASGKKLQGMKIVQMVIRRNLRPTFSSDCPPLVKELADRCLDSDPDVRPSAMELLRIIQ  467

>PHYCA_107365
Length=269

 Score = 218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 168/281 (60%), Gaps = 47/281 (17%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            K LL S++L GKRIP++ +          S E   CE+N QK   ++L    K  AE +Q
Sbjct  2    KLLLSSKNLRGKRIPYEKLTLP------LSEEDSSCEYNGQKVTARKL-PPSKHNAEGIQ  54

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE------------  339
             FA EI+L ASL HPNIVQFIGVAW    +L +V E+L  GSL  +L+            
Sbjct  55   AFAEEIDLNASLAHPNIVQFIGVAWKYPCDLTLVCEFLPRGSLLAYLQGNVELSWTEEKT  114

Query  340  -------EPREFMS-------------SNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                   +  E++              +NVLLT+ +EPK+I+ G +        T+G   
Sbjct  115  RIALGIAQALEYLHGHRPPVIHGDIKVNNVLLTEDLEPKLIEIGRT--------TSGGEM  166

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
             +WTAPE+LEG   T++AD+YSFGV+LSELDTG+ PY D +T+ G KL+P Q+L+ V +G
Sbjct  167  SYWTAPEVLEGKQMTQQADIYSFGVLLSELDTGKAPYWDTMTKTGIKLQPSQVLQLVKTG  226

Query  440  TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
             +RP  S  CP R++R+G ACL+ +P++RP+A +LVRQLEG
Sbjct  227  KLRPHLSKNCPLRLQRLGAACLAHNPANRPSARQLVRQLEG  267

>PHYCA_511282
Length=465

 Score = 222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/299 (40%), Positives = 172/299 (58%), Gaps = 35/299 (12%)

Query  216  RDSAIQSLYCERAGSNKTLLDSEHLEGK-RIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            RDS I     E A        S+   G+ RIP+ S+ F RV+SKGA GEVW+ +   ++ 
Sbjct  161  RDSEITDRSKEVASKVLEQFQSDPTLGRMRIPYSSLYFTRVLSKGAFGEVWLAQLENRQV  220

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            AVKR+L  KK   + ++ F  EI+L AS  HP IV+F+GV+W+S+ ++  V EY++ G L
Sbjct  221  AVKRILNEKKNDEKEIECFGAEIKLMASFSHPKIVEFLGVSWSSMQDVCAVTEYMAKGDL  280

Query  335  KEFLEEP---------------------------------REFMSSNVLLTDSIEPKIID  361
              FL+                                   R+  S N+LL D+   K+ D
Sbjct  281  YGFLKRRQGQLNWRDHKIFLAEDVADALGYLHGLSPKVIHRDLKSKNILLDDAFRAKLSD  340

Query  362  FGVSRGL-VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            FG+SR   V+ +MTAGVGT +WTAPE+L G  YTEKAD++SFG+V+SELDT  VPY D  
Sbjct  341  FGISRERSVEDTMTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKR  400

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               G KL+ ++I++ V+   +RP+FS +CP  ++ +   CL  DP  RP+A EL+R ++
Sbjct  401  DNSGKKLQGMKIVQMVIRRNLRPTFSSDCPALVKELADRCLDSDPDVRPSATELLRIIQ  459

>PHALS_03626
Length=495

 Score = 221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 172/299 (58%), Gaps = 35/299 (12%)

Query  216  RDSAIQSLYCERAGSNKTLLDSEHLEGK-RIPFDSIVFERVISKGASGEVWVCEFNRQKA  274
            RD  I     E A        S+ + GK RIP+ S+ F RV+SKGA GEVW+ +   ++ 
Sbjct  191  RDLEITDRSKEVASKVLQEFQSDPILGKMRIPYSSLYFTRVLSKGAFGEVWLAQLENRQV  250

Query  275  AVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL  334
            AVKR+L  KK   + ++ F  EI+L AS  HP IV+F+GV+W+S+ ++  V EY+  G L
Sbjct  251  AVKRILNEKKNDEKEIECFGAEIKLMASFSHPKIVEFLGVSWSSMQDVCAVTEYMGKGDL  310

Query  335  KEFLEEP---------------------------------REFMSSNVLLTDSIEPKIID  361
              FL+                                   R+  S N+LL DS   K+ D
Sbjct  311  YGFLKRRQGQLNWRDHKIFLAEDVADALGYLHSLSPKVIHRDLKSKNILLDDSFRAKLSD  370

Query  362  FGVSRGL-VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
            FG+SR   V+ +MTAGVGT +WTAPE+L G  YTEKAD++SFG+V+SEL+T  VPY D  
Sbjct  371  FGISRERSVEDTMTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELETHAVPYSDKR  430

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               G KL+ ++I++ V+   +RP+FS ECP  ++ +   CL  DP +RP+A EL+R ++
Sbjct  431  DNAGKKLQGMKIVQMVIRRNLRPTFSTECPKLVKELADRCLDSDPDARPSALELLRLIQ  489

>PHYRA_81273
Length=445

 Score = 219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/271 (41%), Positives = 162/271 (60%), Gaps = 34/271 (13%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            KRIP+ S+ F RV+SKGA GEVW+ +   ++ AVKR+L  KK   + ++ F  EI+L AS
Sbjct  169  KRIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKLMAS  228

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---------------------  341
              HP IV+F+GV+W+S  ++  V EY+  G L  FL+                       
Sbjct  229  FSHPKIVEFLGVSWSSHQDVCAVTEYMGKGDLYGFLKRRQGQLNWRDHKIFLAEDVADAL  288

Query  342  ------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEIL  388
                        R+  S N+LL D+   K+ DFG+SR   V+ +MTAGVGT +WTAPE+L
Sbjct  289  GYLHGLSPKVIHRDLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVL  348

Query  389  EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDE  448
             G  YTEKAD++SFG+V+SELDT  VPY D     G KL+ ++I++ V+  ++RP+F+ +
Sbjct  349  MGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKIVQMVIRRSLRPTFTSD  408

Query  449  CPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            CP  ++ +   CL  DP  RP+A EL+R ++
Sbjct  409  CPALVKELADRCLDADPDVRPSATELLRIIQ  439

>PHYCA_119381
Length=291

 Score = 213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 165/278 (59%), Gaps = 34/278 (12%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + E +   RIP + ++ E+ IS+G  GEV+V  FN Q+ AVK LL   +++ +SV +F
Sbjct  6    LWNDEAIIAARIPREKVLLEQRISRGGYGEVFVGTFNGQRVAVKMLLPETRKRIQSVNEF  65

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E++L ASL HP IV+FIGVAW+SL +L +V +++  G L+  L               
Sbjct  66   LAEVKLMASLEHPRIVEFIGVAWDSLTDLCVVSQFMEGGDLRALLNRYPSLGFDYTKVKI  125

Query  340  --------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
                          EP    R+  S N+LLT+ ++ K+ DFG SR  VD +MTAG+GT  
Sbjct  126  ALHVAHALTYMHSLEPPLIHRDLKSKNILLTEDLDAKLTDFGASRERVDRTMTAGIGTSL  185

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            W APE++ G  Y EKADM+SFGVVLSE+D+  +PY  A +    +   + IL+ VM G +
Sbjct  186  WMAPEMMTGEKYDEKADMFSFGVVLSEMDSNALPY--ANSGKNRQASDLAILQLVMQGNL  243

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               FS+ CPP I  +G AC+S DP++RPTA + + QL+
Sbjct  244  CVEFSETCPPAIVELGLACVSKDPAARPTAAQALYQLQ  281

>H310_07620
Length=628

 Score = 223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 171/557 (31%), Positives = 261/557 (47%), Gaps = 112/557 (20%)

Query  5    TMADLAVPK-------ADVSYVDCT-----YLNCSQPNGVTAHYAQYCTGWQMLNVSRWD  52
            TM +L VPK          S ++C+     ++     NGV    A  C       VS+ +
Sbjct  97   TMENLMVPKEKFLATDQSASIIECSGFGYSFVRQQVSNGVNLDVAANCA------VSKAN  150

Query  53   P----------------TMTPSIRLRDHKWEQ-DIPEFGGLITFHVYVVHTVPHDLDP--  93
            P                T  P  ++  H+W   D P F        + VHT+P   D   
Sbjct  151  PSTNSHSSMWAQDGVPSTDVPFPKIHRHQWNSTDGPPF------LFFSVHTLPEKYDDEW  204

Query  94   AWNECPLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLK-------------  140
             W  CP ++   SLT PC    E      +    +P+ S  +  WL              
Sbjct  205  PWGSCPENKP-GSLTFPCRVYEE------SKGMCLPSPSTAMNNWLNAIARAKTTSPPAT  257

Query  141  --QEFAQEDSPSQLLIPVILGVAIAVAGMALGWLS--CRRKLEASMKQKSGIEHerrsqr  196
                 +   +PS     V+  VA AVA +A G L    RR+     K ++   ++     
Sbjct  258  TTPVPSPTQAPSLSTGAVVGIVAGAVAFVACGLLCFILRRR-----KARADAINDNDGTP  312

Query  197  ssgssqerrAISISSPQQR-RDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERV  255
            ++ ++    ++  SS Q R   +A Q +    +  N   +D+ +L  +R+P+ S+V  R+
Sbjct  313  TTTTAMYNSSLQNSSGQPRSHHAAAQPIQTNSSKLNSFQVDA-YLCTRRLPYSSVVQTRM  371

Query  256  ISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVA  315
            +SKGA GEVW+  ++    A+K++L  K+     ++ FA EI L ASL HPNIV FIG A
Sbjct  372  LSKGAFGEVWIGSYDGMTVAIKKILDAKRNDETELECFAEEIRLMASLSHPNIVTFIGFA  431

Query  316  WNSLDNLVMVLEYLSTGSLKEFL-EEP-------------------------------RE  343
            WN+L N+  V+EY+  G L  +L   P                               R+
Sbjct  432  WNTLQNMCCVVEYMQHGDLGSYLVAHPKTNWNEKLVLAVGIARALAYLHALVPNKIIHRD  491

Query  344  FMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSF  402
              + NVL++D +E K+ DFG+S+    D +MTAGVGT +WTAPE+L G+ Y+E AD+YSF
Sbjct  492  LKAKNVLVSDQLEAKLSDFGISKERTTDDTMTAGVGTSYWTAPEVLSGHRYSELADVYSF  551

Query  403  GVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLS  462
            G VL+ELDT  +PY +        +  + I++ V +  +RP+F+D CP  ++ +   CLS
Sbjct  552  GCVLNELDTHNIPYANL-----KGVPAMTIVQRVTTQGLRPTFNDSCPKLVKDLAMQCLS  606

Query  463  LDPSSRPTAHELVRQLE  479
              P  RPTA E+VR +E
Sbjct  607  TSPRDRPTAAEIVRLIE  623

>SPRG_08302
Length=647

 Score = 222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 165/522 (32%), Positives = 233/522 (45%), Gaps = 93/522 (18%)

Query  18   YVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPTMTPSIRLRDHKWEQDIPEFGGLI  77
            Y  C   N +  N   +H + +    Q L+         P   L+ H W     EF    
Sbjct  140  YTRCATANVTMGNIKDSHSSMWAQDGQGLSTY-------PLPNLQRHAWNDK--EF----  186

Query  78   TFHVYVVHTVPHDLDPAWNECP---LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAF  134
             + ++ +HT     +P W  CP   +  G A  T PC     F          VP+ S  
Sbjct  187  -WLIFSIHTQELATEPQWGTCPDKTMTPGGA--TFPCQ---VFDGSVPPQGWCVPSNSQA  240

Query  135  VTTWLK----QEFAQEDSPSQ---------------LLIPVILGVAIAVAG--MALGWLS  173
            +  WLK    Q+ +    PS                L    ILG+ I  AG  +ALG   
Sbjct  241  MDAWLKTIANQKISATPLPSSNTPAASSSTTPASTGLSTIAILGIGIG-AGVLLALGIWC  299

Query  174  C--RRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAGSN  231
            C  RR+ +A+      +E                  + + P Q R  + Q +       N
Sbjct  300  CVARRRRQATPDAPGYVE-------LRPRDGRYSVTTSTQPTQTRTGSYQPITTASHTLN  352

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            +   D   L  KR+P+ S+V  R++SKGA GEVW+  FN Q  AVKRLL  K+     ++
Sbjct  353  EFQRDPS-LSQKRLPYSSVVCSRLLSKGAFGEVWLGSFNGQVVAVKRLLDSKRTSEAEIE  411

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------  340
             FA EI L AS  HPNIV+F+G AW+SL NL  V EY+  G L  +L+            
Sbjct  412  AFADEIRLMASFTHPNIVRFVGFAWDSLQNLCAVTEYMPQGDLHTYLQSHLQLQWRRHEK  471

Query  341  ----------------------PREFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAGV  377
                                   R+  S NVL+    E K+ DFG+SR   +D +MTAGV
Sbjct  472  IKIALGIAHALAYLHSLSPTIIHRDLKSKNVLMAAGCEAKLSDFGISRERTLDETMTAGV  531

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GT FWTAPE+L G HY+E AD+YSFGVVL E+DT     H     D   L    ++  + 
Sbjct  532  GTIFWTAPEVLLGEHYSEMADIYSFGVVLCEMDT-----HGPPLADCKGLPQATMIHRIT  586

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +  +RPS +  CP  ++ +   C++ DP +RP ++EL+  L+
Sbjct  587  NEGLRPSLTPTCPQHVQALAARCMARDPKNRPASYELIAILQ  628

>PPTG_16203
Length=403

 Score = 215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 168/283 (59%), Gaps = 35/283 (12%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            + L +  +L   R+P+  I    ++SK  + E+ + E+  Q+  VKRLL+ K+     +Q
Sbjct  122  RILQEDRNLTRIRLPYKEIKLRALLSKSQTREIRLGEYQNQQVVVKRLLKTKRSHIFHIQ  181

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE------------  339
            +F  +I++ ++L HPNIV  +GVAWNS+D++++V+E+   G L  +L+            
Sbjct  182  EFIYQIQIRSTLEHPNIVTLVGVAWNSVDDVMLVMEHYPLGDLLTYLQNHGERTSWEHGK  241

Query  340  ----------------EP-----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV-  377
                            +P     R+  +SNVLLT+++  K+  F  S  L + S    + 
Sbjct  242  YRLAIGIARALVYLHSQPTPIAHRDLRASNVLLTETMRSKLTGFD-SSCLNEHSHRCHIA  300

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            G P+W+APE+L G  YT K+D+Y+FGV+L+ELDT   P+HDAV+  GTKLKP+QIL EVM
Sbjct  301  GAPYWSAPEVLRGRPYTTKSDIYAFGVLLTELDTVNSPFHDAVSPIGTKLKPIQILNEVM  360

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
             GT+RPSFS ECP RIR IG  C   DP  RPTA +L+R LE 
Sbjct  361  QGTLRPSFSPECPRRIRVIGVGCYQHDPDRRPTAAQLLRLLEA  403

>CCA21936
Length=435

 Score = 216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 158/273 (58%), Gaps = 34/273 (12%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L+ + IP+ S+ F R++SKGA GEVW+ +    + AVKR+L  +K   + ++ FA EI+L
Sbjct  156  LKQRYIPYSSLYFTRLVSKGAFGEVWLAQLEDHQVAVKRMLAERKNDEKEIECFAAEIKL  215

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             AS  HP IV+F+G++W ++ +L  V EY+  G L ++L++                   
Sbjct  216  MASFSHPKIVEFVGLSWINVQDLCAVTEYMPRGDLFDYLKKKQGQLRWYDQKLHLAEDIA  275

Query  342  ---------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAP  385
                           R+  S NVLL      K+ DFG+SR   ++ +MTAGVGT +W AP
Sbjct  276  EALSYLHSLQPQVIHRDLKSKNVLLDHQFRAKLSDFGISRERELEETMTAGVGTVYWIAP  335

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSF  445
            E+L G  YTEKAD+YSFGVV+SELDT  +PY D     G K+ PV+I + V    +RP+F
Sbjct  336  EVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRKVTPVKIARAVAQLGLRPTF  395

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            S  CPP++R +   CL  +P  RP AHELV  L
Sbjct  396  SRTCPPQVRILAMRCLDANPDQRPHAHELVHLL  428

>CCA24786
Length=435

 Score = 216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/273 (41%), Positives = 158/273 (58%), Gaps = 34/273 (12%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L+ + IP+ S+ F R++SKGA GEVW+ +    + AVKR+L  +K   + ++ FA EI+L
Sbjct  156  LKQRYIPYSSLYFTRLVSKGAFGEVWLAQLEDHQVAVKRMLAERKNDEKEIECFAAEIKL  215

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             AS  HP IV+F+G++W ++ +L  V EY+  G L ++L++                   
Sbjct  216  MASFSHPKIVEFVGLSWINVQDLCAVTEYMPRGDLFDYLKKKQGQLRWYDQKLHLAEDIA  275

Query  342  ---------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAP  385
                           R+  S NVLL      K+ DFG+SR   ++ +MTAGVGT +W AP
Sbjct  276  EALSYLHSLQPQVIHRDLKSKNVLLDHQFRAKLSDFGISRERELEETMTAGVGTVYWIAP  335

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSF  445
            E+L G  YTEKAD+YSFGVV+SELDT  +PY D     G K+ PV+I + V    +RP+F
Sbjct  336  EVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRKVTPVKIARAVAQLGLRPTF  395

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            S  CPP++R +   CL  +P  RP AHELV  L
Sbjct  396  SRTCPPQVRILAMRCLDANPDQRPHAHELVHLL  428

>PPTG_17293
Length=417

 Score = 214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 166/281 (59%), Gaps = 37/281 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L   E +   RIP + ++ ++ IS+G  GEV+V  FN Q+ A+K LL   +++ +SV +F
Sbjct  132  LWTDEAIIAARIPREKVILQQRISRGGYGEVYVGTFNDQRVAIKMLLPETRKRIQSVNEF  191

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E++L ASL HP IV+FIGVAW+SL +L +V E++  G ++  L               
Sbjct  192  LAEVKLMASLEHPRIVEFIGVAWDSLTDLCVVSEFMEGGDVRALLNRYQNERNIGFDYTK  251

Query  340  -----------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVG  378
                             +P    R+  S N+LLT+  + K+ DFG SR  VD +MTAG+G
Sbjct  252  VKIALHVAHALTYMHSFDPPLIHRDLKSKNILLTEDYDAKLTDFGASRARVDRTMTAGIG  311

Query  379  TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMS  438
            T  W APE++ G  Y EKAD++SFGVVLSELD+  +PY  A T    +   + IL+ VM 
Sbjct  312  TSLWMAPEMMTGEKYDEKADIFSFGVVLSELDSNALPY--ANTGKNRQPSDLAILQLVMQ  369

Query  439  GTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            G +R SFS+ CPP I  +G AC+++DP++RPTA E + +L+
Sbjct  370  GKLRVSFSETCPPAILELGMACVAVDPTARPTAAEALYRLQ  410

>PPTG_02132
Length=665

 Score = 219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 169/288 (59%), Gaps = 50/288 (17%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            +R+PF  I   R IS GA G+VW+        AVKRL++ ++++   ++ FA EI+L AS
Sbjct  378  RRVPFVDISLIRQISSGAYGDVWLGRLRGDIVAVKRLIRERRRQVHELEVFAAEIQLMAS  437

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-----------------------  339
            L HPN++   GVAWN+L+NL++++EY+  G L+  L+                       
Sbjct  438  LDHPNVLGLTGVAWNTLENLLLIMEYMERGDLQHVLQCQNGAKDASSGNNSIDEFSWASH  497

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAG  376
                              +P    R+  S NVL+ D  E K+ DFGVSR    D +MT+G
Sbjct  498  KAKIARDISCGLQYLHSLKPIVVHRDLKSKNVLIGDKYEAKLSDFGVSRMRRGDETMTSG  557

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEV  436
            VGT +W APE+L G+ Y+EKAD+YS GVVL+ELDTG++P+ DA T DG K++ + IL  V
Sbjct  558  VGTAYWIAPEVLAGHKYSEKADIYSLGVVLAELDTGELPFFDARTSDGDKMEAIHILSLV  617

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAH----ELVRQLEG  480
            +SG ++PSF+ +CP  +R++   CL+ +P SRP+A     EL R LEG
Sbjct  618  VSGELQPSFTLDCPEDVRKLALVCLNPNPDSRPSAKMVLDELNRLLEG  665

 Score = 37.4 bits (85),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  6   MADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVS  49
           M++L + ++      CT   CS PNG   + + +CT +QM NVS
Sbjct  31  MSELQLSRSAYRSAGCTEQRCSSPNGELFYQSMFCTDYQMGNVS  74

>PHALS_00921
Length=631

 Score = 217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/292 (40%), Positives = 165/292 (57%), Gaps = 34/292 (12%)

Query  222  SLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
            S YC+ +    T L    +  K I FD + F  ++SKGA GEVW+ +FN Q+ A+KRLL 
Sbjct  308  SEYCDESEELTTFLQHPEVLSKCIAFDQLTFLSLLSKGAYGEVWLGQFNTQRVAIKRLLP  367

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K Q   S+++FA EI+L   L H NIV F G++WN L NL  VLEY+  G L   L++ 
Sbjct  368  EKCQLTSSLEQFAGEIQLMCMLQHRNIVSFEGLSWNRLQNLCAVLEYMEAGDLDAVLKQN  427

Query  342  RE---------------------------------FMSSNVLLTDSIEPKIIDFGVSRG-  367
            R+                                   S NVLL + +  K+ DFGVSR  
Sbjct  428  RDCFSWQQEKISIAMDIAEGLVYLHCLRPVIVHRDLKSKNVLLNEKMHAKLSDFGVSRKT  487

Query  368  LVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             ++ +MT+GVGT  WTAPEI+EG  Y+EKAD+YS GVVLSE+DT + P+ D ++E G +L
Sbjct  488  FINETMTSGVGTLLWTAPEIIEGKKYSEKADVYSLGVVLSEMDTCESPFSDVISEKGGRL  547

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +Q+   V  G +R S  D+CP  +R++   C  LDP +RP++ ++   L+
Sbjct  548  PGMQLAHFVRLGNIRVSLRDDCPTILRKLIMDCTQLDPDARPSSMQVAYTLK  599

>SPRG_14253
Length=610

 Score = 217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/273 (42%), Positives = 156/273 (57%), Gaps = 39/273 (14%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L  KR+P+ S+V  R++SKGA GEVW+  FN Q  AVKRLL  K+     ++ FA EI L
Sbjct  339  LSQKRLPYSSVVCSRLLSKGAFGEVWLGSFNGQVVAVKRLLDSKRTSEAEIEAFADEIRL  398

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             AS  HPNIV+F+G AW+SL NL  V EY+  G L  +L+                    
Sbjct  399  MASFTHPNIVRFVGFAWDSLQNLCAVTEYMPQGDLHTYLQSHLQLQWRRHEKIKIALGIA  458

Query  342  ---------------REFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAGVGTPFWTAP  385
                           R+  S NVL+    E K+ DFG+SR   +D +MTAGVGT FWTAP
Sbjct  459  HALAYLHSLSPAIIHRDLKSKNVLMAAGCEAKLSDFGISRERTLDETMTAGVGTIFWTAP  518

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSF  445
            E+L G HY+E AD+YSFGVVL E+DT + PY +        +  V ++  + +  +RP+F
Sbjct  519  EVLLGEHYSEMADIYSFGVVLCEIDTREAPYPNM-----KAVPQVTMVHRITNEGLRPAF  573

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            S+ CP +++ I + CL  DP+ RP+A ELV  L
Sbjct  574  SEACPAQLQTIASRCLDADPTMRPSARELVTIL  606

>PHYCA_122066
Length=344

 Score = 209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 161/292 (55%), Gaps = 34/292 (12%)

Query  222  SLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
            S YC  +      +    +  KRI FD + F R++SKGA GEVW+ +   +  A+KRLL 
Sbjct  16   SEYCNESEILTDFMQDPEVFTKRIAFDELTFLRMLSKGAYGEVWLGQLETRHVAIKRLLP  75

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K Q   S+++FA EI+L  +L H NIV F+GV+WN L NL  V+EY+  G L + L++ 
Sbjct  76   EKCQFTASLEQFAGEIQLMCTLQHRNIVSFVGVSWNRLQNLCAVVEYMEAGDLDDVLKKN  135

Query  342  RE---------------------------------FMSSNVLLTDSIEPKIIDFGVSRGL  368
            RE                                   S NVLL      K+ DFGVSR  
Sbjct  136  REKFTWQREKISIAMDVTEGLVYLHCLRPVVVHRDLKSKNVLLNRKYHAKLSDFGVSRKT  195

Query  369  -VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             V+ +MT+GVGT  WTAPEI+EG  Y+EKAD+YS GVVLSE+DT   P+ D  ++ G +L
Sbjct  196  HVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCDAPFSDVTSDKGERL  255

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +QI + V  G +R +   +CPP + ++   C  LDP +RP++ ++   L+
Sbjct  256  PGMQIAQLVRLGKIRVTLRKDCPPNLHKLVMDCTQLDPDARPSSMQVAFTLK  307

>PHYCA_511287
Length=515

 Score = 214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 155/265 (58%), Gaps = 34/265 (13%)

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            IP+DS+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI+L A L 
Sbjct  240  IPYDSLYFTRSISKGAFGEVWLAQLENTQVAVKKILDEKKHDTKEIECFGAEIKLMALLK  299

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HP IV FIGV+W+   +L  V E+++ G L  +LE                         
Sbjct  300  HPKIVGFIGVSWSDNQDLCAVTEFMAKGDLYGYLERRKGKLNWPDHKVWLAEDIAEALVY  359

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEG  390
                      R+  S N+LL +    K+ DFG+SR   V+ +MTAGVGT +WTAPE+L G
Sbjct  360  LHSLNPKVIHRDLKSKNILLDNKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  419

Query  391  NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECP  450
              YTEKAD+YSFG+V+SE+DT +VPY D     G KL+ ++I++ V+   +RPSF D+CP
Sbjct  420  KKYTEKADIYSFGIVMSEMDTCEVPYSDKRDNAGKKLQGMKIIQMVIRMALRPSFRDDCP  479

Query  451  PRIRRIGTACLSLDPSSRPTAHELV  475
             +++ +   CL  DP +RP A EL+
Sbjct  480  EQVKALAARCLDADPDTRPDAPELL  504

>SDRG_05105
Length=610

 Score = 216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 165/531 (31%), Positives = 240/531 (45%), Gaps = 93/531 (18%)

Query  5    TMADLAVPKADVSYVDCTYLNCSQPNG-----VTAHYAQYCTGWQMLNVSRWDP-----T  54
            + AD  V     S ++ TY+     NG     +T       TG    + S W       +
Sbjct  106  SQADATVRTCTSSAINTTYVRQENSNGGKLAPLTKCMVANVTGVADSHSSMWAQDGQGLS  165

Query  55   MTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRR  114
              P   +  H W   I EF     + +Y +HT     +  +  C        LT+PC  R
Sbjct  166  TYPLPNIMRHAWS--INEF-----WLIYAIHTQTAGDEIGFGFCGPSSTPGGLTIPC--R  216

Query  115  IEFTDDYMAANTTVPAGSAFVTTWLKQ-EFAQEDSPSQLLIPVI---------LGVAIAV  164
            + F          +P  SA +T  L Q   A++ +P+    P I         L V + V
Sbjct  217  V-FDGSMPPTGWCLPTPSATMTQSLAQIALAKKSTPAPTPAPTIGSSSSNHTVLIVCLVV  275

Query  165  AGMALG---WLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQ  221
              + LG   W   RR+ + +        +                   ++P+    S   
Sbjct  276  GAVLLGLGAWCYIRRRRKQTTAHSDFTTYRS-----------------NAPRGATGSPPT  318

Query  222  SLYCERAGSNKTLLDSEH---LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKR  278
            S Y   A ++ TL + +    L  KR+P+ ++   R++SKGA GEVW+  FN Q  A+KR
Sbjct  319  S-YQPIATASHTLNEFQRDPSLSQKRVPYSAVTCSRLLSKGAFGEVWLGSFNGQVVAIKR  377

Query  279  LLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL  338
            LL  K+     ++ FA EI L AS  HPNIV+F+G AW+SL NL  V EY+  G L  +L
Sbjct  378  LLDSKRTSEAEIEGFADEIRLMASFTHPNIVRFVGFAWDSLQNLCAVTEYMPQGDLHTYL  437

Query  339  EEP---------------------------------REFMSSNVLLTDSIEPKIIDFGVS  365
            +                                   R+  S NVL+    E K+ DFG+S
Sbjct  438  QSHLQLQWRRHEKIKIALGIAHALAYLHSLSPTIIHRDLKSKNVLMAAGCEAKLSDFGIS  497

Query  366  RGLV-DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDG  424
            R    D +MTAGVGT FWTAPE+L G HY+E AD+YSFGVVL E+DT + PY +      
Sbjct  498  RERTQDETMTAGVGTIFWTAPEVLLGEHYSEMADIYSFGVVLCEIDTREAPYPNM-----  552

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELV  475
              +  V ++  + +  +RP+FS+ CP +++ I   CL  DP+ RP+A ELV
Sbjct  553  KAVPQVAMVHRITNEGLRPAFSESCPAQLQVIAARCLDADPAMRPSARELV  603

>PITG_07968
Length=526

 Score = 213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 155/265 (58%), Gaps = 34/265 (13%)

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            IP+DS+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI+L A L 
Sbjct  251  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDTKEIECFGAEIKLMALLK  310

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HP IV FIGV+W+   +L  V E+++ G L  +LE                         
Sbjct  311  HPKIVGFIGVSWSDKQDLCAVTEFMAKGDLYGYLERRKNKLNWPDHKMWLAEDIAEALVY  370

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEG  390
                      R+  S N+LL +    K+ DFG+SR   V+ +MTAGVGT +WTAPE+L G
Sbjct  371  LHSLNPKVIHRDLKSKNILLDNKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  430

Query  391  NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECP  450
              YTEKAD+YSFG+V+SE+DT +VP+ D     G KL+ ++I++ V+   +RPSF ++CP
Sbjct  431  KKYTEKADIYSFGIVMSEMDTCEVPFSDKRDSSGKKLQSMKIIQMVIRSALRPSFREDCP  490

Query  451  PRIRRIGTACLSLDPSSRPTAHELV  475
             +I+ +   CL  DP +RP A EL+
Sbjct  491  EQIKALADRCLDADPDARPDAPELL  515

>H257_07477
Length=626

 Score = 215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 151/480 (31%), Positives = 231/480 (48%), Gaps = 79/480 (16%)

Query  53   PTMTPSIRLRDHKWEQ-DIPEFGGLITFHVYVVHTVPHDLDP--AWNECPLDEGYASLTV  109
            PT  P   +  H+W   D P F       ++ VHTVP   D    W  CP  +   SL +
Sbjct  168  PTDVPFPVIMRHQWNSTDGPPF------LIFAVHTVPEKYDGEWPWGTCPTKQP-GSLVL  220

Query  110  PCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVIL-----------  158
            PC        +   +   +P+ S+ +  WL+   A   S   L  P++            
Sbjct  221  PCK-----VYEGAGSGMCLPSPSSRMNDWLE---AIARSKMTLPPPIVTTTGPTPIPPPP  272

Query  159  -----GVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQ  213
                 G  + +   A+ +L+C       ++++        +     S      +  SS Q
Sbjct  273  PSLATGAIVGIVAGAIAFLACGLWCLLLLRRRRRATDGHATAAPYTSD-----VRHSSGQ  327

Query  214  QRRDSAI-QSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQ  272
             R  +A  Q +    +  N   +D  +L  +R+P+ S+V  R++SKGA GEVWV   +  
Sbjct  328  PRSSAAQHQPIQTNSSKLNNFQID-PYLCSRRLPYSSVVQTRMVSKGAFGEVWVGSLDGV  386

Query  273  KAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTG  332
              A+K++L  K+   E ++ FA EI L ASL HPNIV FIG AWN+L NL  V+EY+  G
Sbjct  387  TVAIKKVLDAKRNDVEELECFAEEIRLLASLSHPNIVTFIGFAWNTLQNLCCVVEYMQHG  446

Query  333  SLKEFLEEP--------------------------------REFMSSNVLLTDSIEPKII  360
             L  +L                                   R+  + NVL++D ++ K+ 
Sbjct  447  DLGSYLAAHQEAKWDDKLVLAVGIARALAYLHALTPNKIIHRDLKAKNVLVSDQLDAKLS  506

Query  361  DFGVSR-GLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA  419
            DFG+S+    D +MTAGVGT +WTAPE+L G+ Y+E AD+YSFG VL+ELDT  +PY + 
Sbjct  507  DFGISKERTTDETMTAGVGTTYWTAPEVLSGHRYSELADVYSFGCVLNELDTHNIPYANM  566

Query  420  VTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
                   +  + I++ V +  +RP+F+D CP  I+ +   CL+ +P  RPTA E+VR +E
Sbjct  567  -----KGVPALTIVQRVTTMGLRPTFNDTCPKLIKDLAERCLATNPRDRPTAIEIVRLIE  621

>PHYKE_9428
Length=503

 Score = 212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 110/277 (40%), Positives = 159/277 (57%), Gaps = 34/277 (12%)

Query  238  EHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEI  297
            E  + + IP+DS+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI
Sbjct  221  EDFQDRWIPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDDKKHDLKEIECFGAEI  280

Query  298  ELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------  341
            +L A   HP IV+F+GV+W++  +L  V E+++ G L  +LE                  
Sbjct  281  KLMAQFKHPKIVEFVGVSWSTEHDLCAVTEFMAKGDLYGYLERRQKHLNWRDHKTYLAED  340

Query  342  -----------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWT  383
                             R+  S N+LL      K+ DFG+SR   V+ +MTAGVGT +WT
Sbjct  341  IAEALVYLHSLSPKIIHRDLKSKNILLDSKYRAKLSDFGISRKRSVEETMTAGVGTIYWT  400

Query  384  APEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRP  443
            APE+L G  YTEKAD+YSFG+V+SE+DT  VP+ D   + G KL+ +++L+ V+  ++RP
Sbjct  401  APEVLMGKKYTEKADIYSFGIVMSEMDTCAVPFSDKRDDAGKKLQGMKVLQMVIRMSLRP  460

Query  444  SFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            SF  +CP  I+ +   CL  DP +RP A ELV  L G
Sbjct  461  SFKPDCPVPIKALADRCLDADPDTRPDAPELVSILRG  497

>PPTG_08474
Length=531

 Score = 213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 155/265 (58%), Gaps = 34/265 (13%)

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            IP+DS+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI+L A L 
Sbjct  256  IPYDSLYFTRSISKGAFGEVWLAQLENTQVAVKKILDEKKHDTKEIECFGAEIKLMALLK  315

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HP IV FIGV+W+   +L  V E+++ G L  +LE                         
Sbjct  316  HPKIVGFIGVSWSDKQDLCAVTEFMAKGDLYGYLERRKNKLNWPDHKVWLAEDIAEALVY  375

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEG  390
                      R+  S N+LL +    K+ DFG+SR   V+ +MTAGVGT +WTAPE+L G
Sbjct  376  LHSLNPKVIHRDLKSKNILLDNKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  435

Query  391  NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECP  450
              YTEKAD+YSFG+V+SE+DT +VPY D     G KL+ ++I++ V+   +RPSF ++CP
Sbjct  436  KKYTEKADIYSFGIVMSEMDTCEVPYSDKRDNSGKKLQGMKIIQMVIRMALRPSFREDCP  495

Query  451  PRIRRIGTACLSLDPSSRPTAHELV  475
             +I+ +   CL  DP +RP A EL+
Sbjct  496  EQIKALAARCLDADPDARPDAPELL  520

>SDRG_17342
Length=630

 Score = 214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 156/514 (30%), Positives = 225/514 (44%), Gaps = 86/514 (17%)

Query  18   YVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPTMTPSIRLRDHKWEQDIPEFGGLI  77
            Y  C   N +  N   +H + +    Q L  +       P   L+ H W     EF    
Sbjct  139  YTRCATANITMGNIKDSHSSMWAQDGQGLGAA-------PYPNLQRHAWNDK--EF----  185

Query  78   TFHVYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTT  137
             + ++ +HT     +P W  CP     A  T PC     F          VP+ S  +  
Sbjct  186  -WLIFAIHTQELVSEPQWGTCPDKTTPAGATFPCQ---VFDGSVPPTGWCVPSNSQAMDA  241

Query  138  WLKQEFAQEDS----------------------PSQLLIPVILGVAIAVAGMALGWLSCR  175
            WLK    Q+ +                      P   +I + +G  + +       LS R
Sbjct  242  WLKTIATQKANATPRPSTSAPTAASTMASASSFPIAAIIGIAIGGGLLLGLGVWWCLSRR  301

Query  176  RKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERAGSNKTLL  235
            RK   +      IE           +      + + P Q R  + Q +       N+   
Sbjct  302  RKHSETDVHTDYIE-------MESRAPRYSMTNSTQPTQTRTGSYQPITTASHTLNEFQR  354

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D E ++ KR+P+ ++V+ R++SKGA GEVW+  FN Q  A+KRLL  K+     ++ FA 
Sbjct  355  DQELIK-KRVPYSAVVYSRLLSKGAFGEVWLGSFNGQVVAIKRLLDSKRTSEAEIEGFAD  413

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE---------------  340
            EI L AS  HPNIV+ IG AWNSL NL  V EY++ G L  +L                 
Sbjct  414  EIRLMASFTHPNIVRLIGFAWNSLQNLCAVTEYMANGDLYGYLHSHQQLQWQRDEKIKIA  473

Query  341  ------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLV-DLSMTAGVGTPF  381
                               R+  S NVL+ D  E ++ DFG+SR    D +MTAGVGT F
Sbjct  474  LGIAHALAYLHSLSPKIIHRDLKSKNVLIGDDGEAELSDFGISRKRTQDETMTAGVGTIF  533

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            WTAPE+L G HY+E AD+YSFGVVL E+DT     H +   +   L    ++  + +  +
Sbjct  534  WTAPEVLLGEHYSEMADIYSFGVVLCEMDT-----HASPLAEYKGLPQATMIHRITNEGL  588

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHELV  475
            RPS    CP  ++ +   C++ DP  RP+AHE+V
Sbjct  589  RPSLLPTCPEHVQSLAARCMARDPKDRPSAHEVV  622

>PHYRA_84546
Length=406

 Score = 208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 160/281 (57%), Gaps = 34/281 (12%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L +   L  KRIP++ +     + K  + EV + E+  Q+  +KRLL+ K+ +   + +F
Sbjct  126  LQEDRRLARKRIPYEEVKLRARLGKSQTREVRLGEYENQQVVIKRLLKTKRSQILHIHEF  185

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS-------  346
              +I+L ++L HPNIV  +GVAW S+ ++++V+E+L  G L+ +L+   E++S       
Sbjct  186  VYQIQLRSTLDHPNIVALVGVAWTSMADVMVVVEHLPRGDLESYLDRNGEYISWEHSKYR  245

Query  347  ---------------------------SNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                       +NVLLT++++ K+  F       D       G 
Sbjct  246  LAIDIARALAYLHRQQPSPVVHRDLRATNVLLTEAMQAKLTGFDSCCLNKDNHCCHATGA  305

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
            PFW+APE+L G   T K+D+Y+FGV+L+ELDT + P+HDA +  GT LKP+Q+L EVM  
Sbjct  306  PFWSAPEVLRGEQLTTKSDVYAFGVLLTELDTAKAPFHDAWSPIGTTLKPIQVLNEVMQR  365

Query  440  TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            T+RPSFS +CP R+R IG  C   DPS RPTA +L+R LE 
Sbjct  366  TLRPSFSPDCPRRVRVIGVGCYQQDPSRRPTADQLLRLLEA  406

>PHYCA_543949
Length=195

 Score = 201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 128/192 (67%), Gaps = 33/192 (17%)

Query  324  MVLEYLSTGSLKEFLEEPREFMS---------------------------------SNVL  350
            MVL++L TG L+ +L++  E MS                                  NVL
Sbjct  1    MVLDFLPTGDLQSYLKKNAEIMSWAKDKIHIATGIGRAVEYLHCRTPPLIHRDLKSKNVL  60

Query  351  LTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELD  410
            LT ++E K+IDFGVSRGL + +MTAGVGTP+WTAPEIL+G  YTE+AD+YSFGV+LSELD
Sbjct  61   LTTNLEAKLIDFGVSRGLAENTMTAGVGTPYWTAPEILQGGRYTEQADIYSFGVILSELD  120

Query  411  TGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPT  470
            TG+ PYHD +  D  K +P QI++EVM+G +RPSFS++CPPRIRRI TAC   DP+ RPT
Sbjct  121  TGKFPYHDVLRPDRKKPRPFQIMEEVMAGKLRPSFSEDCPPRIRRISTACCQHDPTRRPT  180

Query  471  AHELVRQLEGRD  482
            A ++VR L G D
Sbjct  181  AAQVVRILNGDD  192

>PHYSO_341117
Length=900

 Score = 218 bits (554),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 166/292 (57%), Gaps = 34/292 (12%)

Query  222  SLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
            S YC  + +    +    +  KRI FD + F R++SKGA GEVW+ +   +  A+KRLL 
Sbjct  433  SEYCNESETLTEFMQDPEVFTKRIAFDELTFLRMLSKGAYGEVWLGQLETRHVAIKRLLP  492

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K Q   S+++FA EI+L  +L H NIV F+GV+WN L NL  V+EY+  G L+E L++ 
Sbjct  493  EKCQFTTSLEQFAGEIQLMCTLQHRNIVSFVGVSWNRLQNLCAVVEYMDAGDLEEVLKKN  552

Query  342  RE---------------------------------FMSSNVLLTDSIEPKIIDFGVSRGL  368
            RE                                   S NVLL      K+ DFGVSR  
Sbjct  553  REKFTWQREKISIAMDIAEGLVYLHCLRPIVVHRDLKSKNVLLNRKFHAKLSDFGVSRKT  612

Query  369  -VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             V+ +MT+GVGT  WTAPEI+EG  Y+EKAD+YS GVVLSE+DT + P+ D  ++ G +L
Sbjct  613  HVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEQPFSDVTSDKGERL  672

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +Q+ + V  G +R S  ++CPP +R++   C  LDP +RP++ ++   L+
Sbjct  673  PGMQLAQLVRLGKIRVSLREDCPPNLRKLVMDCTQLDPDARPSSMQVAFTLK  724

>PPTG_09853
Length=761

 Score = 216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 164/292 (56%), Gaps = 34/292 (12%)

Query  222  SLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
            S YC+ +      +    +  KRI FD + F R++SKGA GEVW+ +   +  A+KRLL 
Sbjct  420  SEYCDESEILTDFMQDPEIFTKRIAFDELTFLRMLSKGAYGEVWLGQLETRHVAIKRLLP  479

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K Q   S+++FA EI+L  +L H NIV F+GV+WN L NL  V+EY+  G L E L++ 
Sbjct  480  EKCQFTASLEQFAGEIQLMCTLQHRNIVSFVGVSWNRLQNLCAVVEYMEAGDLDEVLKKN  539

Query  342  RE---------------------------------FMSSNVLLTDSIEPKIIDFGVSRGL  368
            R+                                   S NVLL      K+ DFGVSR  
Sbjct  540  RDKFSWQREKISIAMDIAEGLVYLHCLRPVVVHRDLKSKNVLLNRKFHAKLSDFGVSRKT  599

Query  369  -VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             V+ +MT+GVGT  WTAPEI+EG  Y+EKAD+YS GVVLSE+DT + P+ D  ++ G +L
Sbjct  600  HVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEAPFADVTSDKGERL  659

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +Q+ + V  G +R S   +CPP +R++   C  LDP +RP++ ++   L+
Sbjct  660  PGMQLAQLVRLGKIRVSLRKDCPPNLRKLVMECTQLDPDARPSSMQVAFTLK  711

>PHYRA_81274
Length=518

 Score = 210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/269 (41%), Positives = 153/269 (57%), Gaps = 34/269 (13%)

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            IP+DS+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI+L A L 
Sbjct  243  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDVKEIECFGAEIKLMALLK  302

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HP IV FIGV+W++  +L  V E+++ G L  +LE                         
Sbjct  303  HPKIVGFIGVSWSTTQDLCAVTEFMAKGDLYGYLERRKGKLNWRDHKMWLAEDIAEALGY  362

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEG  390
                      R+  S N+LL      K+ DFG+SR   V+ +MTAGVGT +WTAPE+L G
Sbjct  363  LHSLSPKVIHRDLKSKNILLDSKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  422

Query  391  NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECP  450
              YTEKAD+YSFG+V+SE+D   VPY D     G  L+ ++I++ V+   +RPSF ++CP
Sbjct  423  KKYTEKADIYSFGIVMSEMDMCAVPYSDKRDNSGKPLQGMKIIQMVIRSALRPSFQEDCP  482

Query  451  PRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +IR +   CL  DP  RP A EL+  L+
Sbjct  483  EQIRALADRCLDADPDVRPDAPELLDILQ  511

>PYAR_13094
Length=478

 Score = 208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/300 (37%), Positives = 167/300 (56%), Gaps = 35/300 (12%)

Query  217  DSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAV  276
            D+      C R+G  K  +    +  KR+ F  + F RV+SKGA+GEVW+ +F  +  A+
Sbjct  164  DTLSNDALCHRSGVLKRFVSDPTIITKRLAFSQLNFLRVLSKGANGEVWLGQFESRYVAI  223

Query  277  KRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKE  336
            K LL  K+++  ++++F+ EI L + L HP IV F G+AW+SL NL +V EY+  G L+ 
Sbjct  224  KCLLPTKRREVRALEQFSEEIRLASMLEHPRIVAFCGIAWHSLVNLSIVTEYMEKGDLES  283

Query  337  FLEEP----------------------------------REFMSSNVLLTDSIEPKIIDF  362
             L +P                                  R+  S NVL+ + +  K+ DF
Sbjct  284  VLSQPMAESLTWQKEKLTLAKDIADALVYLHSLMPVVIHRDLKSKNVLMDNQLRAKLSDF  343

Query  363  GVSRGL-VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT  421
            G+SR    + +MT GVGT  W+APE+LEG  Y EKAD++S+G+VLSE+DT  +PY     
Sbjct  344  GLSRETSTEETMTNGVGTILWSAPEVLEGKRYDEKADIFSYGIVLSEIDTCALPYGFNKD  403

Query  422  EDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGR  481
            +   K+K +QI+  V  G + P+F D+CP  +  +  +CL LDPS RP+A ++V  L  +
Sbjct  404  KTRNKMKSMQIVHLVAEGKLLPTFRDDCPEELVELARSCLDLDPSKRPSAMQVVFTLRSK  463

>PITG_14156
Length=747

 Score = 213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 163/292 (56%), Gaps = 34/292 (12%)

Query  222  SLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
            S YC+ +      +    +  KRI FD + F R++SKGA GEVW+ +   +  A+KRLL 
Sbjct  418  SEYCDESEVLTDFMQDPEIFTKRIAFDELTFLRMLSKGAYGEVWLGQLETRHVAIKRLLP  477

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K Q   ++++FA EI+L  +L H NIV F+GV+WN L NL  V+EY+  G L E L++ 
Sbjct  478  EKCQFTANLEQFAGEIQLMCTLQHRNIVSFVGVSWNQLQNLCAVVEYMEAGDLDEVLKKN  537

Query  342  RE---------------------------------FMSSNVLLTDSIEPKIIDFGVSRGL  368
            R+                                   S NVLL      K+ DFGVSR  
Sbjct  538  RDKFSWQREKIQIAMDIAEGLVYLHCLRPVVVHRDLKSKNVLLNRKYHAKLSDFGVSRKT  597

Query  369  -VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             V+ +MT+GVGT  WTAPEI+EG  Y+EKAD+YS GVVLSE+DT + P+ D  ++ G +L
Sbjct  598  HVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEAPFSDVTSDKGERL  657

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +Q+ + V  G +R S   +CPP +R +   C  LDP +RP++ ++   L+
Sbjct  658  PGMQLAQLVRLGKIRVSLRKDCPPNLRNLVLDCTQLDPDARPSSMQVAFTLK  709

>HYAP_03658
Length=522

 Score = 207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 155/268 (58%), Gaps = 34/268 (13%)

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            IP+DS+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI+L A L 
Sbjct  246  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDVKEIECFGAEIKLMALLK  305

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------------------  341
            HP IV+FIG++ +   +L  V E+++ G L  +LE                         
Sbjct  306  HPKIVRFIGLSCSDKQDLCAVTEFMAKGDLHGYLERRKAKITWPADKIWLAEDIAEALGY  365

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEG  390
                      R+  S N+LL      K+ DFG+SR   ++ +MTAGVGT +WTAPE+L G
Sbjct  366  LHSLSPKVIHRDLKSKNILLDSKYRAKLSDFGISRKRSLESTMTAGVGTIYWTAPEVLMG  425

Query  391  NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECP  450
              YTEKAD+YSFG+V+SE+DT +VPY D    DG KL+ ++I++ V+   +RP+F   CP
Sbjct  426  KKYTEKADIYSFGIVMSEMDTCEVPYSDKRDSDGKKLQSMKIIQLVIRQALRPTFLGTCP  485

Query  451  PRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +I+ +   CL  DP +RP A EL++ L
Sbjct  486  EQIKTLAGRCLDADPDARPDASELLKFL  513

>HYAP_14838
Length=323

 Score = 201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/271 (40%), Positives = 154/271 (57%), Gaps = 34/271 (13%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            KRI FD + F R++SKGA GEVW+ +   +  A+KRLL  K Q   S+++FA EI+L   
Sbjct  2    KRITFDELTFLRILSKGAYGEVWLGQLETRHVAIKRLLPEKCQLTASLEQFAGEIKLMGL  61

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS----------------  346
            L H NIV FIGV WN L N+  V+EY+  G L E L+  RE  S                
Sbjct  62   LQHRNIVLFIGVCWNWLQNMCAVVEYMDAGDLDEILKRKREQFSWQHEKISIAMDITEGL  121

Query  347  -----------------SNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEIL  388
                              NVLL    + K+ DFGVSR   V+ +MT+GVGT  WTAPEI+
Sbjct  122  VYLHCLRPVIVHRDLKPKNVLLNRDFQAKLSDFGVSRKTRVNETMTSGVGTLLWTAPEII  181

Query  389  EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDE  448
             G  Y+EKAD+YS GV+LSE+DT + P+ D  ++ G +L  +Q+ + V  G +R +   +
Sbjct  182  AGKKYSEKADIYSLGVLLSEMDTCEPPFSDVTSDKGERLPGMQLAQLVRLGKIRVTLRKD  241

Query  449  CPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            CPP++ ++   C  LDP +RP++ ++   L+
Sbjct  242  CPPKLCKLVMDCTQLDPDARPSSMQVAFTLK  272

>CCI41041
Length=413

 Score = 204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 153/268 (57%), Gaps = 34/268 (13%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            ++ + IP+ S+ F RV+SKGA GEVW+ +   ++ AVKR+L  +K   + ++ FA EI+L
Sbjct  133  IQQRYIPYSSLYFTRVVSKGAFGEVWLAQLEDRQVAVKRMLAERKNDEKEIECFAAEIKL  192

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             AS  HP IV+F+G++W ++ +L  V EY+  G L + L++                   
Sbjct  193  MASFSHPKIVEFVGLSWINVQDLCAVTEYMPRGDLFDHLKKKQGQLRWYDQKLYLAEDIA  252

Query  342  ---------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAP  385
                           R+  S NVLL      K+ DFG+SR   ++ +MTAGVGT +W AP
Sbjct  253  EALSYLHSLQPKVIHRDLKSKNVLLDHQFRAKLSDFGISRERELEETMTAGVGTVYWIAP  312

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSF  445
            E+L G  YTEKAD+YSFGVV+SELDT  +PY D     G ++ PV+I + V    +RP+F
Sbjct  313  EVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRRVTPVKIARAVAQLGLRPTF  372

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHE  473
            S  CP ++R +   CL  +P  RP A E
Sbjct  373  SRACPQKVRLLAMRCLDANPDRRPPADE  400

>PHYRA_83716
Length=960

 Score = 214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 163/292 (56%), Gaps = 34/292 (12%)

Query  222  SLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQ  281
            S YC  +    T +    +  KRI FD + F R++SKGA GEVW+ +      A+KRLL 
Sbjct  435  SEYCNESEILTTFMQDPEVFTKRIAFDELTFLRMLSKGAYGEVWLGQLETGHVAIKRLLP  494

Query  282  RKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP  341
             K Q   S+++FA EI+L  +L H N+V F+GV+WN L NL  V+EY+  G L E L++ 
Sbjct  495  EKCQFTASLEQFAGEIQLMCTLQHRNVVSFVGVSWNRLQNLCAVVEYMEAGDLDEVLKKN  554

Query  342  RE---------------------------------FMSSNVLLTDSIEPKIIDFGVSRGL  368
            R+                                   S NVLL      K+ DFGVSR  
Sbjct  555  RDKFSWQREKISIAMDVAEGLVYLHCLRPVVVHRDLKSKNVLLNRKFHAKLSDFGVSRKT  614

Query  369  -VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             V+ +MT+GVGT  WTAPEI+EG  Y+EKAD+YS GVVLSE+DT + P+ D  ++ G +L
Sbjct  615  HVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEPPFSDVTSDKGERL  674

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +Q+ + V  G +R S   +CPP +R++   C  LDP +RP++ ++   L+
Sbjct  675  PGMQLAQLVRLGKIRVSLRQDCPPNLRKLVMDCTQLDPDARPSSMQVAFTLK  726

>PHYCA_129660
Length=289

 Score = 200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 158/282 (56%), Gaps = 38/282 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + E +   RIP + ++    IS+G  GEV+V  +N +K A+K LL   +++ +SV +F
Sbjct  1    LWNDEVIVAARIPREKVLMHERISRGGFGEVYVGVYNGRKVAIKMLLPEIRKRIQSVNEF  60

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
             +E++L A+L HP IV+FIGVAW+SL +L +V E +  G L+  L +             
Sbjct  61   LVEVKLMAALEHPRIVEFIGVAWDSLTDLCVVSELMERGDLRALLSQFQAENHPHGFDHD  120

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LLT+  + K+ DFG SR  VD +MTAGV
Sbjct  121  KVKIALHVAHALTYMHSFSPPIVHRDLKSKNILLTNEFDAKLTDFGASRERVDRTMTAGV  180

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GT  W APEI+ G  Y EKADM+SF VVLSELD+  +PY     E  T+   V IL+ V+
Sbjct  181  GTSLWMAPEIMAGEKYDEKADMFSFAVVLSELDSHVLPYTKLRQE--TRASDVAILQLVL  238

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             G  +  FSD CP  I  +G AC + DP++RPTA + + +L+
Sbjct  239  QGKTQIDFSDACPSSIAALGMACAAKDPTARPTAAQALYELQ  280

>PHYSO_529022
Length=517

 Score = 206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/268 (40%), Positives = 154/268 (57%), Gaps = 34/268 (13%)

Query  245  IPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLI  304
            IP++S+ F R ISKGA GEVW+ +    + AVK++L  KK   + ++ F  EI+L A L 
Sbjct  241  IPYESLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDVKEIECFGAEIKLMALLK  300

Query  305  HPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE------------------------  340
            HP IV FIGV+W++  +L  V E+++ G L  +LE                         
Sbjct  301  HPKIVGFIGVSWSNTQDLCAVTEFMAKGDLYGYLERRKGKLNWPDHKMWLAADVAEALVY  360

Query  341  ---------PREFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTPFWTAPEILEG  390
                      R+  S N+LL      K+ DFG+SR   V+ +MTAGVGT +WTAPE+L G
Sbjct  361  LHSLSPKVIHRDLKSKNILLDSKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  420

Query  391  NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECP  450
              YTEKAD+YSFG+V+SE+DT  VPY D   + G  L+ ++I++ V+   +RPSF  +CP
Sbjct  421  KKYTEKADIYSFGIVMSEMDTCAVPYSDKRDDSGKVLQGMKIIQMVIRMALRPSFRKDCP  480

Query  451  PRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +++ +   CL  +P +RP A EL+  L
Sbjct  481  EQVKALADRCLDANPDARPDAPELLNIL  508

>PHYSO_520489
Length=608

 Score = 208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 157/276 (57%), Gaps = 38/276 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + E +   RIP + ++    IS+G  GEV+V  FN ++ A+K LL   ++K +SV  F
Sbjct  332  LWNDEIIVAARIPREKVLLHEKISRGGYGEVYVGTFNGRRVAIKMLLPETRKKIQSVNDF  391

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL------EEP------  341
              E++L ASL HP IVQFIGVAWNSL +L +V E++  G L+  L      + P      
Sbjct  392  LAEVKLMASLEHPRIVQFIGVAWNSLTDLCVVSEFMVGGDLRALLSRYIAEDRPSGFDYN  451

Query  342  ------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL + ++ K+ DFG SR  +D +MTAGV
Sbjct  452  KVKIALHVAHALTYMHSLDPPMVHRDLKSKNILLNNDLDAKLTDFGASRERIDRTMTAGV  511

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GT  W APE++ G  Y+EKADM+SFGVVLSELD+  +PY +A    G +   + +L+ VM
Sbjct  512  GTSLWMAPEMMTGEKYSEKADMFSFGVVLSELDSNALPYANA--GKGRQGSDLVVLQLVM  569

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
             G ++  FSD CP  I  +G  C+S DP++RP A +
Sbjct  570  QGKLQVEFSDSCPSIIAELGMGCVSRDPTARPAAAQ  605

>PHYCA_543955
Length=190

 Score = 194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 122/189 (65%), Gaps = 33/189 (17%)

Query  324  MVLEYLSTGSLKEFLEEP---------------------------------REFMSSNVL  350
            MVLE+  TG L+ FL +                                  R+  S N+L
Sbjct  1    MVLEFFPTGDLQTFLAKKEDLLSWSRDKIRIALGVGRALEYLHSRSPPLIHRDLKSKNIL  60

Query  351  LTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELD  410
            LTD +E K+IDFGVSR   +  MTAGVGTP+WTAPEILEG  YTE+AD+YSFGVVLSELD
Sbjct  61   LTDQLEAKLIDFGVSRIRQEHPMTAGVGTPYWTAPEILEGKRYTEQADLYSFGVVLSELD  120

Query  411  TGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPT  470
            TG++PYHDA+T +G KLKP QIL +VM+G +RPSFS+ CP +IRRIG AC   D S RPT
Sbjct  121  TGKLPYHDALTSEGKKLKPFQILADVMAGMLRPSFSEGCPSKIRRIGVACCQHDQSRRPT  180

Query  471  AHELVRQLE  479
            A ++V  L+
Sbjct  181  AAQVVAMLQ  189

>PHYCA_505050
Length=382

 Score = 201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 162/290 (56%), Gaps = 39/290 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C ++   +  +    +  KRI F  + F R+++KG SGEVW+ ++  +  A+K LL  K+
Sbjct  39   CRKSSILRAFVADPAIVTKRISFAQLHFLRLLAKGGSGEVWLGQYEARYVAMKCLLPTKR  98

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  E++++FA EI + + L HP IV F GVAW SL +L  V EY++ G L+  L  P   
Sbjct  99   EDPEALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAVTEYMARGDLESLLANPVAQ  158

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  159  KELSWSREKLMLSSDIVEALVYLHSLVPVVIHRDLKSKNVLLDRRLRAKLSDFGLSRERS  218

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            V+ +MT G+GT  W+APEILEG  Y EK+D++SFGVVLSE+DT  +PY         K++
Sbjct  219  VEDTMTNGIGTILWSAPEILEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMR  275

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +QI+  V  G + P+F D+CPP IR +   CL+LDP++RPTA E+  +L
Sbjct  276  SMQIVHLVSEGKLLPNFRDDCPPAIRDLAQRCLNLDPAARPTAMEVAFEL  325

>PPTG_02066
Length=305

 Score = 198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/281 (39%), Positives = 154/281 (55%), Gaps = 36/281 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            ++ D   L   RI    +   +++S+G  GEVW+  +  +  A+KRLL  KK   +++  
Sbjct  18   SIWDDPDLLAARIEHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDALA-  76

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR----------  342
            FA EI+  A L HP IV FIGV+W +   +  V E++  G LK  L+  R          
Sbjct  77   FATEIKTMARLDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLK  136

Query  343  ------------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGV  377
                                    +  S NVL+      K+ DFG+SR    D +MTAGV
Sbjct  137  CQIAIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRNRSFDETMTAGV  196

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GT  W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V 
Sbjct  197  GTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVS  256

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            +G ++PSFSD CPP I ++  ACLS DP+ RP+A  +  +L
Sbjct  257  AGKLQPSFSDSCPPSIVKLARACLSFDPAQRPSAIHISYEL  297

>PHYRA_78868
Length=905

 Score = 210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 168/285 (59%), Gaps = 49/285 (17%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            +R+PF  +   R I+ GA GEVW+     +  AVKRL + ++++   ++ FA EI+L AS
Sbjct  510  RRVPFVDVSLVRQITTGAYGEVWLGRMRGEIVAVKRLTRDRRRQLHELEVFAAEIQLMAS  569

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-----------------------  339
              H N++  +GVAWN+L+N+++++EY+  G L+  L+                       
Sbjct  570  FSHLNVLGLLGVAWNTLENMLLIMEYMERGDLQHVLQYHTDQAAQAKGSVGNTSVEEFSW  629

Query  340  ---------------------EP----REFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSM  373
                                 +P    R+  S NVL+  + E K+ DFG+SR    + +M
Sbjct  630  ASHKARISRDVACGLKYLHSRQPIVVHRDLKSKNVLIDSNYEAKLCDFGISRLRRGEETM  689

Query  374  TAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQIL  433
            T+GVGT +WTAPE+L G+ Y+EKAD+YS GVVL+ELDTG++P++DA T DG K++ + IL
Sbjct  690  TSGVGTAYWTAPEVLAGHKYSEKADVYSLGVVLTELDTGELPFYDARTSDGDKMEAIHIL  749

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
              V+SG ++PSF+ +CP  +R++  ACL+  P  RP+A E++ +L
Sbjct  750  SLVVSGELQPSFTLDCPDDVRKLALACLNPKPERRPSAKEILNEL  794

 Score = 41.6 bits (96),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 27/44 (61%), Gaps = 0/44 (0%)

Query  6    MADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVS  49
            M++L + ++    V CT   C+ PNG   + + YC+G+QM NVS
Sbjct  142  MSELQISRSAFRSVGCTAQRCASPNGELFYQSLYCSGYQMGNVS  185

>PHYRA_80666
Length=555

 Score = 204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/313 (37%), Positives = 169/313 (54%), Gaps = 44/313 (14%)

Query  210  SSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEF  269
            SSP + R     +   +R    K L D + + G RIP + + F+++I++G  GEV+V  +
Sbjct  238  SSPAKARSVTAATSVSDRRSPTK-LWDDDVIVGARIPREKVKFQKLINRGGYGEVYVGSY  296

Query  270  NRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYL  329
            N ++ AVK LL   K+    V  F  E++L ASL HP IV FIGVAW+ L ++ +V EY+
Sbjct  297  NGRQVAVKMLLPETKKTMSQVNAFLSEVKLMASLDHPRIVSFIGVAWDQLIDICVVSEYM  356

Query  330  STGSLKEFLEE------------------------------------PREFMSSNVLLTD  353
            + G LK  L E                                     R+  S N+LL +
Sbjct  357  AGGDLKVLLTEFDKQGHPVGFDHTKVKIALHVSIALTYLHSCAPPVIHRDLKSKNILLDE  416

Query  354  SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
            +++ K+ DFG+SR  +D +MT G+GT FW APE++ G  Y +KADM+SFGVVLSELD+  
Sbjct  417  AMDAKVTDFGISRERIDATMTGGIGTSFWMAPEVMMGERYDDKADMFSFGVVLSELDSHV  476

Query  414  VPY-------HDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPS  466
             PY         + +    KL    IL+ V +G +R  FS+  P  I  +G +C+SLDP+
Sbjct  477  TPYALSRSSSTTSSSSHQNKLPHAAILQMVAAGKLRVHFSEAGPQSIVDLGLSCVSLDPT  536

Query  467  SRPTAHELVRQLE  479
             RPTA E + +L+
Sbjct  537  ERPTAAEALYKLQ  549

>PITG_17575
Length=792

 Score = 208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/261 (40%), Positives = 159/261 (61%), Gaps = 15/261 (6%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            + L + ++L   RIP+  I    ++S+  + E+ + E+  Q+  VKRLL+ K+     VQ
Sbjct  535  RLLQEDQNLARIRIPYKEIKIRALLSRSQTREIRLGEYRNQQVVVKRLLKAKRSHLFHVQ  594

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS-----  346
            +F  +I++ ++L HPNIV  +GVAWNS+ ++++V+E+  +G L  +L+    + S     
Sbjct  595  EFIYQIQIRSTLAHPNIVTLLGVAWNSVADVMLVMEHYPSGDLFSYLQNYSNYTSWERGK  654

Query  347  -------SNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADM  399
                   +  L+    +P  +     R ++ + +      P+W+APE+L G  YT K+D+
Sbjct  655  YRLAIGIARALVYLHSQPTPVAHRELRAIIIVPLLVH---PYWSAPEVLRGRPYTAKSDV  711

Query  400  YSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTA  459
            Y+FGV+L+ELDT   P+HDAV+  GTKLKP+QIL EVM GT+RPSFS ECP RIR IG  
Sbjct  712  YAFGVLLTELDTATAPFHDAVSPIGTKLKPIQILNEVMQGTLRPSFSPECPRRIRVIGVG  771

Query  460  CLSLDPSSRPTAHELVRQLEG  480
            C   DP  RPTA +L+R LE 
Sbjct  772  CYQHDPDRRPTATQLLRLLEA  792

 Score = 38.5 bits (88),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 67/179 (37%), Gaps = 34/179 (19%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGW--QML------------  46
            + N TMAD+AV         C  + C+  NG        C+    QML            
Sbjct  176  LDNRTMADIAVSAEAFEEAGCDAVTCTASNGDNVEMYSSCSQGPAQMLAASKCVVEMFDS  235

Query  47   ----NVSRW----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHT-VPHDLDPAWNE  97
                N + W    + +  P IR+          E G    + +Y + T   ++   A   
Sbjct  236  TESSNATLWSTSGNSSTVPDIRVAK---STGTAECG--CGYTIYSIQTATSNEQATATGV  290

Query  98   CPLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWL-----KQEFAQEDSPSQ  151
            CP  E   SL +PC+      +  +AA  T P G+ +VT W+      +   +  +PSQ
Sbjct  291  CPAGEWSGSLVIPCYGSDSIPES-IAARVTPPKGTDWVTRWILEHGGPRRTTESSAPSQ  348

>PHYCA_118320
Length=527

 Score = 201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 163/288 (57%), Gaps = 40/288 (14%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            K L D + +  KRIP D ++ + ++S+GA GEV+   +NRQ+ AVK LL   +   + V 
Sbjct  232  KGLWDDDVITAKRIPRDKVIVKNLLSRGAYGEVYNGVYNRQEVAVKMLLSSTRGNIQHVN  291

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL------EEP----  341
             F  E +LTA++ HP+IV FIGVAW+SL N+ +VLE++  G L+  L      + P    
Sbjct  292  DFLAEAKLTATMDHPHIVTFIGVAWDSLSNVCVVLEFMDGGDLRTLLASYEATKRPVGFN  351

Query  342  --------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTA  375
                                      R+  S N+LL  ++E K+ DFGVS+  +D +MTA
Sbjct  352  KQKATIALHVCHALTYLHSLMPPVIHRDLKSRNILLNRNLEAKLTDFGVSKERLDQTMTA  411

Query  376  GVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY----HDAVTEDGTKLKPVQ  431
            GVGT  W APE++    Y  KAD++SFGVVLSELD   +PY      ++   G K+    
Sbjct  412  GVGTSLWMAPEVMMSERYDVKADIFSFGVVLSELDVHTLPYTQTKERSLASTGRKMADAT  471

Query  432  ILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +L++V +G ++  FSD  P  +  +G AC+S+DP +RPTA E + +L+
Sbjct  472  LLQKVTAGEVQVEFSDSIPRSLLELGLACVSVDPLNRPTAAEALYRLQ  519

>PHYCA_107158
Length=188

 Score = 191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 3/158 (2%)

Query  322  LVMVLEYLSTGSLKEFLEEPREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
            + + LEYL T          R+  S N+L++ +++PK+ DFGVSRG  D SMT GVGTP+
Sbjct  33   IALALEYLHTKCPPIIH---RDLKSKNILISKNLDPKLSDFGVSRGRQDNSMTTGVGTPY  89

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            W+APEILEGN YTE+AD+YSFGVVLSELDTG+ PYHDA+T +G   KPV+IL EV++G +
Sbjct  90   WSAPEILEGNRYTEQADIYSFGVVLSELDTGKNPYHDALTPEGKNEKPVKILAEVIAGNL  149

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            RP+FS  CP  IRRIG AC   DP+SRPTA ++V+ L+
Sbjct  150  RPTFSAHCPDNIRRIGEACCQHDPASRPTASQIVKILQ  187

>PITG_17579
Length=472

 Score = 200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 131/374 (35%), Positives = 200/374 (53%), Gaps = 52/374 (14%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            + +Y+MA+LAVPK++   V+CT  +C+QP+G  ++    C G  ML  +R          
Sbjct  101  LNDYSMAELAVPKSEYEAVNCTVNSCTQPSGSISYSNFKCLGSDMLRAARCVVQDFDDAT  160

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+ R+  H+W +D+ +    I   V+ VHT+    +P W+EC  
Sbjct  161  GIHAAMWVTGGNPAVVPTPRVNKHEW-KDVHDNKSYI---VFAVHTIDVKDEPGWDECAT  216

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFA------QEDSPSQ  151
               + GY SL +PCH       +       V  GS +V+ WL ++++       ED  S 
Sbjct  217  ADRNSGYGSLVLPCHNIASIVPEIDREKQEV-TGSDWVSRWLVEDYSSIAGVSDEDGKSS  275

Query  152  LLI--PVILGVAIAVAGMALGWLSCRRKL---------EASMKQKSGIEHerrsqrssgs  200
            +L+  P+  GV + +  + L     RR+          ++ + Q +  ++         S
Sbjct  276  VLLVAPIAAGVLVVIGLVGLFVFLKRRRQTKDDRECLHQSPVCQDTYYQNPEFIADRDRS  335

Query  201  sqerrAISISSPQQRRDSAIQ--SLYCER--AGSNKTL---LDSEHLEGKRIPFDSIVFE  253
            +      + ++  +  D  IQ    Y E   +GSN+TL    +SE+L GKR+P+DSIVF+
Sbjct  336  TARTIEDTETATYRGVDRTIQLRPSYPEEFGSGSNRTLNILHNSEYLVGKRLPYDSIVFK  395

Query  254  RVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIG  313
            R +SKGA+GEVW CE+  ++ AVKRLLQ     A  V++FA EIEL+ASL HPNIV F+G
Sbjct  396  RALSKGANGEVWQCEYQNEQIAVKRLLQHHNHHAHEVEEFAKEIELSASLNHPNIVTFVG  455

Query  314  VAWNSLDNLVMVLE  327
            VAWNSL+NLVM LE
Sbjct  456  VAWNSLNNLVMALE  469

>PITG_08967
Length=556

 Score = 201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/283 (39%), Positives = 161/283 (57%), Gaps = 37/283 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP + +V ER+I++G  GEV+V  +N  + AVK LL  +K+    V  F
Sbjct  267  LWDDEAIIAARIPREKVVVERLINRGGFGEVYVGTYNGHQVAVKMLLPERKKSLTQVNAF  326

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLST---GSLKEFLEE----------  340
              E++L ++L H +IVQF+GVAW+SL +L +V EY+       L +F E+          
Sbjct  327  LSEVKLMSTLDHAHIVQFVGVAWDSLTDLCVVTEYMVIDLKALLAKFEEQRMPVGFDHDK  386

Query  341  ----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVG  378
                                   R+  SSN+LL ++++ K+ DFG+SR  +D +MTAGVG
Sbjct  387  VKVALHVAHALTYLHSCAPPVIHRDLKSSNILLNEAMDAKVTDFGISRERIDATMTAGVG  446

Query  379  TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILKEV  436
            T  W APE++ G  Y +KAD++SFG+VLSELD   +PY  A   T+ G +L    IL+ V
Sbjct  447  TSLWMAPEVMLGERYDDKADLFSFGIVLSELDRHVLPYSYAKKNTQSGQRLTDTAILQMV  506

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +G +R  FSD  P  + ++G  C+S DP  RPTA E + +L+
Sbjct  507  AAGKLRVQFSDAAPQSMVQLGLECVSTDPKERPTAAEALYRLQ  549

>PPTG_18534
Length=516

 Score = 200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 157/292 (54%), Gaps = 38/292 (13%)

Query  226  ERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQ  285
            ER  S   L D + +   RIP + I  E +IS+G  GEV+   FN    AVK +L   ++
Sbjct  215  ERPRSKVNLWDDDVITTARIPKEKIEVENLISQGGYGEVYKGTFNGLSVAVKMMLPAHRK  274

Query  286  KAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----  340
                V  F +E++L ASL HP IVQF+GVAW+SL ++  V+E++  G L+  L       
Sbjct  275  SVAHVNNFLMEVKLIASLDHPRIVQFVGVAWDSLSDVCAVIEFMDGGDLRGLLTSYHNQH  334

Query  341  -------------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                            R+  S N+LLT  ++ K+ DFGVSR   
Sbjct  335  HPVGFNCAKVKIALHIAHALTYLHSLSPVVIHRDLKSRNILLTTDLDAKLTDFGVSRERA  394

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT--KL  427
            D +MTAGVGT  W APE+L G  Y +KAD++SFGVVLSELD   +PY  A   DG+  ++
Sbjct  395  DHTMTAGVGTSLWMAPEVLMGERYDDKADIFSFGVVLSELDLQVLPYAHATESDGSCHRM  454

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + + IL+ +  G +R  FS      +  +G AC+SLDP  RPTA E++ +L+
Sbjct  455  RDLAILQRMAMGKLRVQFSRNALASMVDVGVACVSLDPKDRPTAAEVLYRLQ  506

>HYAP_01722
Length=546

 Score = 201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/285 (39%), Positives = 155/285 (54%), Gaps = 42/285 (15%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D + +   RIP D +  E ++S+G  GEV++  +   + AVK LL  KK+    V  F  
Sbjct  254  DDDVVVAARIPRDQVKIEELLSRGGYGEVYIGRYKGSQVAVKMLLPEKKKAMSQVNAFLC  313

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE---------------  340
            E++L A L HP IV FIGVAW+ L ++ +V EY+S G LK  L E               
Sbjct  314  EVKLMACLDHPRIVSFIGVAWDQLVDICVVSEYMSGGDLKALLTEYEHRDYPVGFDHLKV  373

Query  341  ---------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R+  S N+LL ++++ K+ DFG+SR  +D +MT GVGT
Sbjct  374  KIAFHVAIALTYLHSCSPPVIHRDLKSKNILLDEAMDAKVTDFGISRERIDATMTGGVGT  433

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV-----TEDGTK-LKPVQIL  433
             FW APE++ G  Y +K DM+SFGVVLSELD+  +PY  A         GT+ L    IL
Sbjct  434  SFWMAPEVMMGERYDDKVDMFSFGVVLSELDSHVLPYASASRSSTNRSSGTRNLPSAAIL  493

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            + V +G +R  FS+  P  I  +G AC+SLDP+ RPTA E V++L
Sbjct  494  QMVAAGVLRVEFSEASPRSIVDLGLACVSLDPNERPTAAEAVQKL  538

>PPTG_10355
Length=569

 Score = 201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 162/286 (57%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +  KRIP D +  ER+IS+G+ GEV+V  FN  K AVK LL   + K + V  F
Sbjct  266  LWNDDIITAKRIPRDKVQTERLISRGSFGEVYVGSFNDHKVAVKMLLPAMRGKIQHVNDF  325

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ HP+IV FIGVAW+SL ++ +VLEY+  G L+  L++             
Sbjct  326  LAEAKMTATMDHPHIVSFIGVAWDSLSDICVVLEYMDGGELRSLLDKFQKDKHPIGFTRE  385

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL   ++ K+ DFG+SR  +D +MTAGV
Sbjct  386  KTTIALEVCHALTYLHSLSPPIIHRDLKSRNILLNSDMKAKLSDFGISRERLDRTMTAGV  445

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED-GTKLKPVQ---IL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELD   +PY  A TE+  +K  P+    +L
Sbjct  446  GTSLWMAPEVMLGERYDDKADVFSFGVVLSELDVHTLPYARAKTENLDSKGNPIPDSILL  505

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V  G ++  FSD  P  I  +G AC S+ P+ RPTA E + +L+
Sbjct  506  QRVALGIVKVEFSDASPEAIVDLGRACTSVYPTERPTAAEALYKLQ  551

>PHYCA_509624
Length=567

 Score = 200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 168/295 (57%), Gaps = 41/295 (14%)

Query  226  ERAGSNKT-LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            E A S +T L + + +  KR+P D +  ++++S+GA GEV+   FN Q+ AVK LL   +
Sbjct  264  EAAMSGQTGLWNDDVITAKRVPRDKVKVKKLLSRGAYGEVYTGVFNGQQVAVKMLLPSTR  323

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----  340
               + V  F  E +LTAS+ HP+IV F+GVAW+SL +L ++LE++  G L+  L +    
Sbjct  324  GNLQHVTDFLTEAKLTASMDHPHIVTFVGVAWDSLSDLCVILEFMDGGDLRSLLNKYEAT  383

Query  341  --------------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGL  368
                                             R+  S N+LL   +E K+ DFG+S+  
Sbjct  384  KHPVGVDREKATIALHVCHALTYLHSLIPPVIHRDLKSRNILLNKGMEAKLTDFGISKER  443

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA----VTEDG  424
            +D +MTAGVGT  W APE++ G +Y  KAD++SFGVVLSELD   +PY  A    +  +G
Sbjct  444  LDQTMTAGVGTSLWMAPEVMLGENYDVKADIFSFGVVLSELDVHTLPYAQAKQRSLDTNG  503

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             K+    +L+++ +G +R  FSD  P  +  +G+AC++++P+ RPTA E + +++
Sbjct  504  RKMADATLLQKITAGEVRVDFSDTSPQAMVELGSACIAVNPADRPTAAEALYRIQ  558

>PHYCA_543324
Length=296

 Score = 193 bits (490),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 154/282 (55%), Gaps = 38/282 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D + +   RIP D ++ E ++S+GA GEV+   +N Q  A K LL   ++    V  F  
Sbjct  8    DDDIIVAARIPRDKVILESLVSRGAFGEVYKGTYNGQLIAAKILLVDTRRSIPHVNAFMA  67

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL---EEP-----------  341
            E++++A + HP+I +FIGVAW+SL +L  V E++  G LK  L   EE            
Sbjct  68   EVKMSAVMDHPHIAKFIGVAWDSLSDLCSVTEFMEGGDLKALLVKYEEEGHPLGFNYSKV  127

Query  342  ----------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R+  S N+LL+  +E K+ DFG+SR  +D +MTAGVGT
Sbjct  128  KIALHVAHALTYLHSLDPPVIHRDLKSRNILLSKELEAKLTDFGISRERIDATMTAGVGT  187

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILKEVM  437
              W APE++ G  Y +KADM+SFG+VLSELD   +PY  A   +  G +L    IL+ V 
Sbjct  188  SLWMAPEVMLGERYDDKADMFSFGIVLSELDQHTLPYSHAKNNSHSGQRLTDTAILQMVA  247

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +G +R  FS   P  + ++G AC+S DP  RP+A E + +L+
Sbjct  248  AGKLRVQFSQAAPESLVQLGIACVSTDPKQRPSAAEALYRLQ  289

>PHYCA_106001
Length=297

 Score = 193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 158/291 (54%), Gaps = 45/291 (15%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + + G RIP + +   ++I++G  GEV+V  ++ +  AVK LL   K+    V  F
Sbjct  1    LWDDDVIVGARIPREKVTVVKLINRGGYGEVYVGSYHGKTVAVKMLLPETKKTMSQVNAF  60

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E++L ASL HP IV FIGVAW+ L ++ +V EY++ G LK  L E             
Sbjct  61   LSEVKLMASLDHPRIVSFIGVAWDQLIDICVVSEYMAGGDLKALLTEYDNDGHPVGFDCV  120

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL ++++ K+ DFG+SR  +D +MT G+
Sbjct  121  KVKIALHVSIALTYLHSCAPPVIHRDLKSKNILLDEALDAKVTDFGISRERIDATMTGGI  180

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY---------HDAVTEDGTKLK  428
            GT FW APE++ G  Y +KADM+SFGVVLSELD+  +PY           + + +  KL 
Sbjct  181  GTSFWMAPEVMMGERYDDKADMFSFGVVLSELDSHVMPYALSKSNSSTESSSSANPNKLP  240

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               IL+ V  G +R  FS+  P  +  +G AC+SLDP+ RPTA E + +L+
Sbjct  241  SAAILQMVAVGRLRVHFSEAGPQSMVDLGNACVSLDPNERPTAAEALYKLQ  291

>SPRG_03075
Length=565

 Score = 199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 154/284 (54%), Gaps = 36/284 (13%)

Query  235  LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFA  294
             D   L+  RI    +   + I++GA GEV +  +   + AVK+LL     + E + KF 
Sbjct  280  FDVSDLDMYRISHAQLTIIKPIAQGAYGEVLLASYQGMRVAVKKLLPNDNARVE-LPKFI  338

Query  295  LEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-------------  341
             EI+L A +  P IVQFIG +W    ++++V E+L  G L+ FL+               
Sbjct  339  AEIKLLAKMESPYIVQFIGASWLRPSDIMLVTEFLEAGDLRNFLQGTSTASVSWHEKLQL  398

Query  342  --------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
                                R+  S NVLLTD +  K+ DFG++R + D +MTAG+GT  
Sbjct  399  AYDILQGLVYLHTLEHKVIHRDLKSRNVLLTDDLHAKLTDFGIAREMDDATMTAGIGTYR  458

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            W APE+L+  HY E ADM+SFGV+LSELDT Q+PY D V   G       I+ +VM+G +
Sbjct  459  WMAPEVLQEGHYAESADMFSFGVILSELDTHQLPYADKVNGSGRPYTDTAIMAKVMTGEL  518

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHE--LVRQLEGRDS  483
            RPSFS+ CP   R +G+ C++L P  RPTA E     Q+E R+S
Sbjct  519  RPSFSESCPRWYRDLGSCCMALKPEDRPTAMEASYAVQVEMRNS  562

>PPTG_21833
Length=579

 Score = 199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/303 (37%), Positives = 166/303 (55%), Gaps = 37/303 (12%)

Query  214  QRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQK  273
            Q+  +A  +L          L D E +   RIP + +V E +I++G  GEV+V  +N Q+
Sbjct  270  QKTGTASTTLASSDGAIPSKLWDDEAIIAARIPREKVVAEHLINRGGFGEVYVGTYNGQQ  329

Query  274  AAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLST--  331
             A+K LL  +K+    V  F  E++L ++L H +IV+FIGVAW+SL +L +V EY+    
Sbjct  330  VAIKMLLPERKKSLTQVNAFLSEVKLMSTLDHAHIVEFIGVAWDSLTDLCVVTEYMVIDL  389

Query  332  -GSLKEFLEE--------------------------------PREFMSSNVLLTDSIEPK  358
               L +F E+                                 R+  SSN+LL ++++ K
Sbjct  390  KALLSKFEEQRMPVGFDHDKVKVALHVAHALTYLHSCAPPVIHRDLKSSNILLNEAMDAK  449

Query  359  IIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD  418
            + DFG+SR  +D +MTAGVGT  W APE++ G  Y +KADM+SFGVVLSELD   +PY  
Sbjct  450  VTDFGISRERIDATMTAGVGTSLWMAPEVMLGERYDDKADMFSFGVVLSELDQHALPYSH  509

Query  419  AV--TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVR  476
            A   T  G +L    IL+ V +G +R  FS+  P  + ++G  C+S DP  RPTA E + 
Sbjct  510  AKNNTHSGQRLTDTAILQMVAAGKLRVQFSEAAPESMVQLGLECVSTDPKQRPTAAEALY  569

Query  477  QLE  479
            +L+
Sbjct  570  RLQ  572

>PHYCA_9190
Length=325

 Score = 193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 151/276 (55%), Gaps = 38/276 (14%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RI +DS+   + I++GA GEVWV ++   + AVKRL+Q +   A S + F  E++L A L
Sbjct  48   RIDYDSVTLVKKIAQGAFGEVWVGQYRNTRVAVKRLIQEQVSLAAS-EAFLREVKLMAWL  106

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------------  341
             HP IVQF+GVAW  L +++ V+EY+  G L+  L++                       
Sbjct  107  EHPKIVQFVGVAWTKLVDMLAVIEYMDGGDLRTLLDKKSPKKLPWEESGLKLQYAQDTID  166

Query  342  --------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LL      KI DFGVS       MTAGVGT  W APEI
Sbjct  167  AIVYLHSLSPVIIHRDLKSRNILLDSKKGAKIGDFGVSATKRLHDMTAGVGTTRWLAPEI  226

Query  388  LEGNH-YTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFS  446
              G   YTE  D+YSFG++LSELDT Q+P+ DA T  G  L  + IL+ V SG ++ +FS
Sbjct  227  ARGEEKYTEAVDVYSFGIILSELDTHQLPFADAKTSTGAALNDMAILQGVSSGKLQVTFS  286

Query  447  DECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
              CP  +  +  +C+SLDP+ RPTA ++  +L  +D
Sbjct  287  PSCPQNLEALARSCMSLDPADRPTAAQIAYELRKKD  322

>PITG_07549
Length=545

 Score = 198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 161/286 (56%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +  KRIP D +  E++IS+G+ GEV+   +N +K AVK LL   + + + V+ F
Sbjct  244  LWNDDVITAKRIPRDKVQTEKLISRGSYGEVYAGTYNERKVAVKMLLPAMRGRIQHVKDF  303

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ HP++V FIGVAW+SL ++ +VLEY+  G L+  L+              
Sbjct  304  LAEAKMTATMDHPHVVAFIGVAWDSLSDICVVLEYMDGGELRALLDRYEKDKHPIGFTRE  363

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL+  ++ K+ DFG+SR  +D +MTAGV
Sbjct  364  KTTIALEVCHALTYLHSLSPSIIHRDLKSRNILLSSDMKAKLSDFGISRERLDKTMTAGV  423

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED----GTKLKPVQIL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELD   +PY  A  E+    G  +    +L
Sbjct  424  GTSLWMAPEVMLGERYDDKADVFSFGVVLSELDVHSLPYATAKKENLDAKGNPIPDSILL  483

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V  G ++  FSD CP  I  +G AC S+ P+ RPTA E + +L+
Sbjct  484  QRVALGIVKVEFSDACPEAIVELGRACTSVYPTERPTAAEALYKLQ  529

>PHYCA_10461
Length=470

 Score = 196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 156/285 (55%), Gaps = 40/285 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP D +  +++IS+GA GEV+   FN Q+ AVK L+   +   + V +F
Sbjct  176  LWDDDIITAKRIPRDKVQTQKLISRGAFGEVYSGIFNGQQVAVKVLIPATRTNLKHVNEF  235

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++ A++ HP++V F+GVAW+SL +L +VLEY+  G L+  L++             
Sbjct  236  LAEAKMNATMDHPHVVTFVGVAWDSLSDLCVVLEYMHGGELRSLLDQYLKTNHPTGFNKQ  295

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+L +  +E K+ DFG+SR  +D +MTAGV
Sbjct  296  KATTALQVCHALTYLHSLDPPVIHRDLKSRNILFSSDMEAKLSDFGISRERMDQTMTAGV  355

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KADM+SFGVVLSELD   +PY  A  E    +G  +    +L
Sbjct  356  GTSLWMAPEVMMGERYDDKADMFSFGVVLSELDVHTMPYAKAKQESLESNGRAMVDSVLL  415

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            + V  G +   FSD  P  +  +G ACL +DPS RP A E + +L
Sbjct  416  QRVAMGQVHAEFSDSSPEAMVELGRACLDVDPSKRPNAAEALYKL  460

>PHYRA_82498
Length=558

 Score = 199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 158/285 (55%), Gaps = 40/285 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP D +  +++IS+GA GEV+   FN Q+ A+K LL   +   + V +F
Sbjct  264  LWDDDVITAKRIPRDKVQKQKIISRGAFGEVYAGVFNGQQVAIKMLLPATRTNLKQVNEF  323

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E ++ A++ HP+IV F+GVAW+SL +L +VLEY+  G L+  L+              
Sbjct  324  LAEAKMNANMDHPHIVAFVGVAWDSLSDLCVVLEYMQGGELRSLLDSYLKANHPVGFDKQ  383

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              EP    R+  S N+L    +E K+ DFG+SR   D +MTAGV
Sbjct  384  KTTIALQVCHALTYLHSLEPPVIHRDLKSRNILFNSDMEAKLSDFGISRERPDQTMTAGV  443

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA----VTEDGTKLKPVQIL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELD   +PY  A    +   G  +    +L
Sbjct  444  GTSLWMAPEVMMGERYDDKADIFSFGVVLSELDVHTMPYARAKKANLESSGRAMVDSVLL  503

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++V  GT++  FSD  P  +  +G AC+S+DP+ RP A E + +L
Sbjct  504  QKVAMGTLQAEFSDASPEAVVELGRACMSVDPADRPKAAEALYKL  548

>PITG_01017
Length=468

 Score = 196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 156/285 (55%), Gaps = 40/285 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP D +  +++IS+GA GEV+   FN Q+ AVK LL   +   + V +F
Sbjct  176  LWDDDVITAKRIPRDKVQTQKLISRGAFGEVYAGIFNGQQVAVKVLLSSTRTNIKHVNEF  235

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++ A++ HP+IV F+GVAW+SL +L +VLEY+  G L+  L++             
Sbjct  236  LAESKMNATMDHPHIVAFVGVAWDSLSDLCVVLEYMHGGELRSLLDQYLKSKLPVGFNKQ  295

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+L +  +E K+ DFG+SR  +D +MTAGV
Sbjct  296  KATSALQICHALTYLHSLDPPVIHRDLKSRNILFSSDMEAKLSDFGISRERLDQTMTAGV  355

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KADM+SFGVVLSELD   +PY  A  E     G  +    +L
Sbjct  356  GTSLWMAPEVMMGERYDDKADMFSFGVVLSELDVHTMPYAHAKKETLESSGRAMVDSVLL  415

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++V  GT++  FS+  P  I  +  ACL +DP  RP A E + +L
Sbjct  416  QKVALGTIQAEFSEATPEAIVELARACLDVDPMKRPNAAEALYKL  460

>PPTG_14170
Length=768

 Score = 201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 162/290 (56%), Gaps = 39/290 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C ++   +  +    +  KRI F  + F R+++KG SGEVW+ ++  +  A+K LL  K+
Sbjct  425  CRKSSILRAFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVWLGQYEARYVAMKCLLPAKR  484

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  E++++FA EI + + L HP IV F GVAW SL +L  V EY++ G L+  L  P   
Sbjct  485  EDPEALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAVTEYMARGDLESLLANPVAQ  544

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  545  KELSWSREKLTLSSDIVEALVYLHSLVPVVIHRDLKSKNVLLDRRLRAKLSDFGLSRERS  604

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            V+ +MT G+GT  W+APE+LEG  Y EK+D++SFGVVLSE+DT  +PY         K++
Sbjct  605  VEDTMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMR  661

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +QI+  V  G + P+F D+CPP IR +   CLSLDP++RPTA E+  +L
Sbjct  662  SMQIVHLVSEGKLLPNFRDDCPPAIRDLAQRCLSLDPAARPTAMEVAFEL  711

>PHYCA_128924
Length=556

 Score = 197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 156/283 (55%), Gaps = 38/283 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP + +V ++ I++G  GEV++  FN Q+ AVK LL   ++  + V  F
Sbjct  266  LWDDEVIATARIPREKVVIQQQINRGGGGEVYLGLFNEQQVAVKMLLPEMRKSVKHVNAF  325

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL---------------  338
              E++L A+L HP IVQF+GVAW+SL +L +V E++  G L+E L               
Sbjct  326  LAEVKLMATLDHPRIVQFVGVAWDSLTDLCVVSEFMEGGDLRELLTIYEKEKQPTGFDRT  385

Query  339  ------------------EEP---REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              E P   R+  S NVLLT  +E K+ DFG+SR  VD +MTAGV
Sbjct  386  KVTIALHVAHALTYLHSLETPVLHRDLKSKNVLLTSDLEAKLTDFGISREQVDRTMTAGV  445

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILKE  435
            GT  W APE++ G  Y +KADM+SFGV+LSELD   +PY  A   ++   K+    IL+ 
Sbjct  446  GTSLWMAPEVMLGERYDDKADMFSFGVLLSELDVHTIPYSHAKDNSDSDRKMPETVILQM  505

Query  436  VMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            V  G +R  FS      +  +G AC+SLD   RPTA E + +L
Sbjct  506  VALGKLRVEFSSNSLESMVALGLACVSLDTKERPTAAEALYKL  548

>SDRG_00883
Length=571

 Score = 198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 153/284 (54%), Gaps = 36/284 (13%)

Query  235  LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFA  294
             D   L+  RI    +   + I++GA GEV +  +   + AVK+LL     + E + KF 
Sbjct  286  FDVSDLDMYRISHAQLAIIKPIAQGAYGEVLLASYQGMRVAVKKLLPNDNARVE-LPKFI  344

Query  295  LEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-------------  341
             EI+L A +  P IVQFIG +W    ++++V E+L  G L+ +L+               
Sbjct  345  AEIKLLAKMESPYIVQFIGASWLRPSDIMLVTEFLEAGDLRNYLQGTSTGSVPWHQKLQL  404

Query  342  --------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
                                R+  S NVLLTD +  K+ DFG++R + D +MTAG+GT  
Sbjct  405  AYDILQGLVYLHTLEHKVIHRDLKSRNVLLTDDVHAKLTDFGIAREMDDATMTAGIGTYR  464

Query  382  WTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTM  441
            W APE+L+  HY E ADM+SFGV+LSELDT Q+PY D V   G       I+ +VM+G +
Sbjct  465  WMAPEVLQEGHYAESADMFSFGVILSELDTHQLPYADKVNSSGRPYTDTAIMAKVMTGEL  524

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHE--LVRQLEGRDS  483
            RPSFS  CP   R +G+ C++L P  RPTA E     Q+E R+S
Sbjct  525  RPSFSGSCPRWYRDLGSCCMALKPEDRPTAMEASYTVQVEMRNS  568

>PITG_05112
Length=699

 Score = 200 bits (509),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 152/278 (55%), Gaps = 36/278 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   RI    +   +++S+G  GEVW+  +  +  A+KRLL  KK   +++  FA 
Sbjct  415  DDPDLLAARIEHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDAL-AFAT  473

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-------------  342
            EI+  A L HP IV FIGV+W +   +  V E++  G LK  L+  R             
Sbjct  474  EIKTMARLDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQI  533

Query  343  ---------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTP  380
                                 +  S NVL+      K+ DFG+SR    D +MTAGVGT 
Sbjct  534  AIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRNRSFDETMTAGVGTA  593

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V +G 
Sbjct  594  RWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGK  653

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++PSFSD CPP I ++  ACLS DP+ RP+A  +  +L
Sbjct  654  LQPSFSDSCPPSIVKLARACLSFDPAQRPSAIHISYEL  691

>PHYRA_77379
Length=773

 Score = 201 bits (511),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 161/290 (56%), Gaps = 39/290 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C ++   +  +    +  KRI F  + F R+++KG SGEVW+ ++  +  A+K LL  K+
Sbjct  419  CRKSAILRAFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVWLGQYETRYVAMKCLLPTKR  478

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  E++++FA EI + + L HP IV F GVAW SL +L  V EY+  G L+  L  P   
Sbjct  479  EDPEALEQFAEEIRMASFLAHPRIVAFCGVAWQSLLHLCAVTEYMPRGDLENLLANPIAQ  538

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  539  KELSWNREKLTLSSDIVEALVYLHSLVPIVIHRDLKSKNVLLDRRLRAKLSDFGLSRERS  598

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            V+ +MT G+GT  W+APE+LEG  Y EK+D++SFGVVLSE+DT  +PY         K++
Sbjct  599  VEDTMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMR  655

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +Q++  V  G + P+F D+CPP IR +   CLSLDP++RPTA E+  +L
Sbjct  656  SMQVVHLVSEGKLLPNFRDDCPPAIRALAQRCLSLDPAARPTAMEVAFEL  705

>PHYSO_324311
Length=623

 Score = 199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 159/286 (56%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +   RIP + +    ++S+GA GEV+   FN Q+ A+K LL   ++  + V  F
Sbjct  330  LWDDDVITANRIPREKVRVNELVSRGAFGEVYTGVFNDQRVAIKMLLPSTRRDIKLVNDF  389

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E +LTAS+ HP IV  IGVAW+SL +L +V+E++  G L+  L               
Sbjct  390  LAEAKLTASMDHPRIVTCIGVAWDSLSDLCVVMEFMEGGDLRTLLSNYEKTGHPVGFNRE  449

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              EP    R+  S N+LL D+ E K+ DFG+SR  +D +MTAGV
Sbjct  450  KVAIALHVCHALTYLHSLEPSVIHRDLKSRNILLNDANEAKLTDFGISRERLDRTMTAGV  509

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y EKADM+SFGVVLSELD+  +PY  A  E     G ++    +L
Sbjct  510  GTSLWMAPEVMTGERYDEKADMFSFGVVLSELDSHTLPYAQAKQEMQQSHGRQMSDATLL  569

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V  GT+   FSD  P  +  +G AC+S+DP+ RP+A E + +L+
Sbjct  570  QKVAMGTVSVEFSDAAPRSMVDLGCACVSVDPTLRPSAAEALFKLQ  615

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 75/166 (45%), Gaps = 28/166 (17%)

Query  2    GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50
            G +++ADLA+P +D     C + NC+Q +  T++    C G QML  +R           
Sbjct  105  GTHSIADLAIPVSDFEGAGCVWNNCTQTDRTTSYSNLLCDGDQMLTATRCLVEDFNDSSE  164

Query  51   -----W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL-  100
                 W     P   P   +  H W            F+V  +HTVP   + A+ +CP  
Sbjct  165  THTAMWSTGGSPESVPLPYIFKHSWTDASTN----KPFNVLAIHTVPTMDEVAYGQCPTG  220

Query  101  --DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFA  144
              + G++SL +PC      +D   A  TTV  GS +V+ WLK+ ++
Sbjct  221  SENGGFSSLVIPCASTANLSDMPGAMMTTVK-GSDWVSRWLKENYS  265

>PITG_18347
Length=547

 Score = 197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/286 (37%), Positives = 160/286 (56%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +  KRIP D +  E++IS+G+ GEV+   +N +K AVK LL   + + + V+ F
Sbjct  244  LWNDDVITAKRIPRDKVQTEKLISRGSYGEVYAGTYNERKVAVKMLLPAMRGRIQHVKDF  303

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ HP++V FIGVAW+SL ++ +VLEY+  G L+  L+              
Sbjct  304  LAEAKMTATMDHPHVVAFIGVAWDSLSDICVVLEYMDGGELRALLDRYEKDKHPIGFTRE  363

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL+  ++ K+ DFG+SR  +D +MTAGV
Sbjct  364  KTTIALEVCHALTYLHSLSPSIIHRDLKSRNILLSSDMKAKLSDFGISRERLDKTMTAGV  423

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED----GTKLKPVQIL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELD   +PY  A  E+    G  +    +L
Sbjct  424  GTSLWMAPEVMLGERYDDKADVFSFGVVLSELDVHSLPYAKAKKENLDAKGNPIPDSILL  483

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V  G ++  FSD CP  I  +G  C S+ P+ RPTA E + +L+
Sbjct  484  QRVALGIVKVEFSDACPEAIVELGRVCTSVYPTERPTAAEALYKLQ  529

>PHYCA_504276
Length=696

 Score = 199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 154/278 (55%), Gaps = 36/278 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   RI    +   +++S+G  GEVW+  +  +  A+KRLL  KK   +++  FA 
Sbjct  412  DDPDLLAARIEHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDAL-AFAT  470

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-------------  342
            EI++ A L HP IV+FIGV+W +   +  V E++  G LK  L+  R             
Sbjct  471  EIKVMARLDHPKIVRFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQI  530

Query  343  ---------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTP  380
                                 +  S NVL+      K+ DFG+SR    D +MTAGVGT 
Sbjct  531  AIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTA  590

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V +G 
Sbjct  591  RWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGK  650

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++PSF+D CPP I ++  ACLS DP+ RP+A  +  +L
Sbjct  651  LQPSFTDSCPPSIVKLARACLSFDPAQRPSAIHISYEL  688

>PPTG_10369
Length=558

 Score = 197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 167/286 (58%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP D +  +  IS+GA GEV+   FN ++ AVK LL   ++  + V +F
Sbjct  266  LWDDDVIITKRIPRDKVRIQTRISQGAFGEVYTGMFNGRQVAVKMLLPSMRENLQLVNQF  325

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ HPN+V FIGVAW+SL ++ +VLEY+  G L+  L +             
Sbjct  326  LGEAKMTAAMDHPNVVTFIGVAWDSLSDVCVVLEYMDGGDLRFLLSQYEAKHQPVGFNRQ  385

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL+ S+E K+ DFG+S+  +D ++TAGV
Sbjct  386  KATIALQVCHALAYLHSLIPPVVHRDLKSRNILLSRSMEAKLTDFGISKERLDTTLTAGV  445

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TED--GTKLKPVQIL  433
            GT  W APE++ G +Y +KAD++SFGVVLSELD   +PY +A   T D  G ++    ++
Sbjct  446  GTSLWMAPEVMLGEYYDDKADIFSFGVVLSELDVHTLPYTNARKGTRDPYGREVTDTALM  505

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V SG ++  FS   PP I ++G  C+++DPS RP+A E++ +L+
Sbjct  506  QQVASGKVQVEFSKVGPPSITQLGYVCVAIDPSLRPSAAEILYRLQ  551

>SPRG_03078
Length=494

 Score = 195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 147/271 (54%), Gaps = 32/271 (12%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L+  R+    I   R +++GA GEV +  +     A+KRLL    Q  E V+KF  E +L
Sbjct  217  LDMHRVDIGDITIMRTLAQGAYGEVLLGRYQGAVVAIKRLLP-TTQTREDVEKFICEAQL  275

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             A L    +V F+GVAW     L+++ E+L  G L+  LE                    
Sbjct  276  VARLDSTYVVAFVGVAWTKPQELLLMTEFLPRGDLRSLLEADASLPWAAKLRIAHDIAEG  335

Query  342  -------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEIL  388
                         R+  S NVLLTD +  K+ DFG++R + D +MTAG+GT  W APE+L
Sbjct  336  LVYLHMLEHKVVHRDLKSRNVLLTDDLHAKLTDFGIAREMDDATMTAGIGTYRWMAPEVL  395

Query  389  EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDE  448
            +  HY E ADMYSFGV+L ELD+ ++PY DAVT  G  L    I+ +VM G +RP+FSD 
Sbjct  396  QDGHYDESADMYSFGVILFELDSHKLPYSDAVTSTGRPLTDTAIMAKVMLGHLRPTFSDA  455

Query  449  CPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             P  +R +GT CLS DP +RP A E   +++
Sbjct  456  SPSWLRELGTRCLSDDPYARPRAAEAAYKIQ  486

>PPTG_10361
Length=564

 Score = 197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 165/295 (56%), Gaps = 41/295 (14%)

Query  226  ERAGSNKT-LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            E A S +T L + + +  KRIP D +  ++++S+GA GEV+   FN Q+ AVK LL   +
Sbjct  261  EAAMSGQTGLWNDDVITAKRIPRDKVKMKKLLSRGAYGEVYTGRFNGQQVAVKMLLPSTR  320

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----  340
               + V  F  + +LTAS+ HP+IV F+GVAW+SL +L +VLE++  G L+  L +    
Sbjct  321  GNLQHVTDFLTKAKLTASMDHPHIVTFVGVAWDSLSDLCVVLEFMDGGDLRTLLNKYEAV  380

Query  341  --------------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGL  368
                                             R+  S N+LL  S E K+ DFG+S+  
Sbjct  381  KHPAGVDLEKATIALHVCHALTYLHSLMPPVIHRDLKSRNILLNQSKEAKLTDFGISKER  440

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA----VTEDG  424
            +D +MTAGVGT  W APE++ G  Y  KAD++SFGV+LSELD   +PY  A    +   G
Sbjct  441  LDQTMTAGVGTSLWMAPEVMLGEKYDVKADIFSFGVMLSELDVHTLPYAQAKQRSLDTTG  500

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             K+    +L+++ +G +R  FS+  PP +  +G AC+++D + RPTA E + +++
Sbjct  501  RKMADATLLQKITAGEVRVEFSESSPPSMVELGYACVAVDSADRPTAAEALYRIQ  555

>SDRG_05099
Length=620

 Score = 198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/295 (37%), Positives = 163/295 (55%), Gaps = 40/295 (14%)

Query  220  IQSLYCERAGSNKTLLDSEH---LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAV  276
            +Q +    A ++  L   EH   L  +R+P+ ++   R++SKGA GEVW+  F  ++ A+
Sbjct  323  LQEMNVGTAAASLKLNAFEHDPFLFSRRLPYGAVTCHRILSKGAYGEVWIGSFRGKEVAI  382

Query  277  KRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKE  336
            K++L  K+     ++ F  EI + A+L HP+IV  IG AW++L NL  V EYL+ G +  
Sbjct  383  KKILHAKRHDTFELECFTEEIRIMAALDHPHIVHLIGFAWDTLTNLCAVTEYLAKGDVTG  442

Query  337  FL---------------------------EEP----REFMSSNVLLTDSIEPKIIDFGVS  365
            +L                             P    R+  S N+L++D+ E K+ DFG+S
Sbjct  443  YLVANMDLNWDAKLRLAVGTARALAYLHGRSPAIIHRDLKSKNILVSDTGEAKLSDFGIS  502

Query  366  RGLV-DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDG  424
            R  V D +MT GVGT +WTAPE+L G  YTE+ D+YSFGVVL ELDT + PY D      
Sbjct  503  RTRVADETMTVGVGTVYWTAPEVLLGQKYTEQVDIYSFGVVLCELDTHRAPYADM-----  557

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             ++  + I + V +   RP FS +CP  ++ +   C++ DPS+RP A E+V  +E
Sbjct  558  QEVAQMAIAQRVATHQFRPPFSAKCPKLVKDLADRCMAQDPSARPNAQEIVDLIE  612

>PPTG_10353
Length=526

 Score = 196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 158/286 (55%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +  KRIP D ++ +++IS+GA GEV    FN  + A+K LL   +   E V +F
Sbjct  234  LWNDDVITTKRIPRDKVLVKKLISRGAYGEVHAGLFNNHQVAIKMLLPASRGSLEYVNEF  293

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA+L HPNIV FIGVAW+SL +L +VLE++    L+  L +             
Sbjct  294  LAEAKMTATLDHPNIVTFIGVAWDSLSDLCVVLEFMEGSDLRSLLNKYQASNQPVGFNTE  353

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S NVLL   ++ K+ DFG+SR  +D +MTA V
Sbjct  354  KLTIALNVCQALTYLHSLMPPVIHRDLKSRNVLLDGKMKAKLSDFGISRERLDRTMTACV  413

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY----HDAVTEDGTKLKPVQIL  433
            GT  W APE++ G  Y  KADM+SFGVVLSELD   +PY     D +   G ++  V + 
Sbjct  414  GTSLWMAPEVMLGERYDVKADMFSFGVVLSELDVHTMPYARVSKDDLGSSGREMASVTLF  473

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +++  GT++  FSD  P  I  +G AC+++DPS RP+A E + +L+
Sbjct  474  QKIALGTVQVEFSDASPRSIEELGRACMNIDPSERPSAAEAMYRLQ  519

>PHALS_05409
Length=698

 Score = 199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/278 (40%), Positives = 152/278 (55%), Gaps = 36/278 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   RI    I   +++S+G  GEVW+  +  +  A+KRLL  KK   +++  FA 
Sbjct  414  DDPDLLAARIEHRDIEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDAL-AFAT  472

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-------------  342
            EI++ A L HP IV FIGV+W +   +  V E++  G LK  L+  R             
Sbjct  473  EIKVMARLDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQI  532

Query  343  ---------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTP  380
                                 +  S NVL+      K+ DFG+SR    D +MTAGVGT 
Sbjct  533  AIDVADALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTA  592

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE++ G HYTE AD+YSFGVVLSELDT + P+HDA   +G K++ V IL+ V +G 
Sbjct  593  RWIAPEVILGGHYTEFADVYSFGVVLSELDTCKAPFHDATNTNGGKMQDVTILQLVSAGK  652

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++PSFSD CP  I ++  ACLS DP+ RP+A  +  +L
Sbjct  653  LQPSFSDSCPHSIVKLARACLSFDPAQRPSAIHISYEL  690

>PHYCA_55944
Length=294

 Score = 189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 159/286 (56%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP + +   ++IS+GA GEV+   +N  + AVK LL   ++  + V +F
Sbjct  2    LWDDEVIISNRIPREKVKTLKLISRGAFGEVYTGLYNDDQVAVKMLLPNTRRDMKMVNEF  61

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E +LTA++ HP IV FIGVAW+S  +L +VLE++  G L+  L               
Sbjct  62   LAEAKLTATMDHPRIVSFIGVAWDSFSDLCVVLEFMDGGDLRSLLNTYERSGHTVGFDRE  121

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              EP    R+  S N+LL +  E K+ DFG+SR  +D +MTAGV
Sbjct  122  KVTIALHVAHALTYLHSLEPSVIHRDLKSRNILLNEMHEAKVTDFGISRERLDRTMTAGV  181

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELD   +PY  A  E     G ++    +L
Sbjct  182  GTSLWMAPEVMTGEKYDDKADIFSFGVVLSELDLHTLPYTAARFEMQQSQGRQMTDATLL  241

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V  GT+  +FSD     ++ +G AC+S+DP++RP+A E + +L+
Sbjct  242  QGVAMGTICVNFSDTGVQSVKDLGNACVSVDPANRPSAAEALFKLQ  287

>SDRG_05104
Length=632

 Score = 197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 150/521 (29%), Positives = 227/521 (44%), Gaps = 69/521 (13%)

Query  2    GNYTMADLAVPKADVSYVDCT--YLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPTMTPSI  59
            GNYT  + A        V C    L  + PN   + +AQ             D T  P  
Sbjct  119  GNYTRQENAHGMFLGKVVKCAVPLLPDTTPNSYASMWAQ----------DGLDATTVPDP  168

Query  60   RLRDHKWEQDIPEFGGLITFHVYVVHTVPHDL-DPAWNECPLDEGYASLTVPC--HRRIE  116
            RL  H+W        G  +F ++ +HTVP    + AW +CP      SL VPC  ++   
Sbjct  169  RLWRHEWHSI-----GFPSFLLFAIHTVPAQFTETAWGKCPATTAPGSLIVPCTVYKPGN  223

Query  117  FTDDYMAANTT---VPAGSAFVTTWL-----KQEFAQEDSPSQLLIPVILGVAIAVAGMA  168
            F+    +   T   +P  S+ +  WL      +    E  P+   + ++L   +A   + 
Sbjct  224  FSSLVFSPPNTEWCLPRPSSAMDKWLTAIHDAKTNRDEVKPAVSTLTIVLIAVLAFLLLG  283

Query  169  LGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERA  228
            +    C R+         G +    S   +            S Q +     Q++     
Sbjct  284  VIAYVCLRRPRRPRGDHDGSQSPTSSYYHATRPTLGTGSGHGSSQAK-----QTITTSSK  338

Query  229  GSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWV---CEFNRQKAAVKRLLQRKKQ  285
              N    +  +L  KR+P+ SI + R++SKGA GEVW+    + + +  A+KR+L  K+ 
Sbjct  339  ALNA-FQEDPYLCSKRLPYSSITYSRMLSKGAFGEVWLGTLTDTSPRPVAIKRILDAKRA  397

Query  286  KAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE------  339
             A  ++ FA EI L A   HPNIV F+G  WN+L N+  V EYL+ G +  +L       
Sbjct  398  DAAELECFADEIRLMALFSHPNIVHFLGFGWNTLQNMCAVTEYLANGDVSGYLAVHRAVA  457

Query  340  ---------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRG-LVDLSM  373
                                 +P    R+    NVLL+D++  K+ DFG+SR  + D +M
Sbjct  458  YDVKIAIGLGVLNAVQYLHTLDPPVIHRDLKGRNVLLSDALVAKLSDFGISRQRIADETM  517

Query  374  TAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQIL  433
            T GVGT FWTAPE+L G  Y    D+YSFGV+++ELDT   PY D        +      
Sbjct  518  TVGVGTAFWTAPEVLLGLKYDASVDVYSFGVIMTELDTQHAPYADIKGVPSMHIVQKVTG  577

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHEL  474
            ++     +RP+ + + P        AC+  DP+ RPT  EL
Sbjct  578  QDGAPAPLRPTLTRDAPAWFVATANACMERDPTRRPTISEL  618

>PPTG_06854
Length=486

 Score = 194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 156/288 (54%), Gaps = 38/288 (13%)

Query  226  ERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQ  285
            +R+ +   L D + +   RIP D I+ E +IS+G  GEV+   FN    AVKR+L   ++
Sbjct  183  DRSRNKVNLWDDDVITTARIPKDKIIMENLISQGGYGEVYKGTFNGLSVAVKRMLPAHRK  242

Query  286  KAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----  340
                V  F  E++L ASL H  IV+F+GVAW++L ++  V+E++  G L+  L       
Sbjct  243  SVAHVNNFLAEVKLMASLEHSCIVEFVGVAWDALSDVCAVIEFMDGGDLRGLLTSYHNHH  302

Query  341  -------------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                            R+  S N+LLT  ++ K+ DFGVSR  V
Sbjct  303  HPVGFDCDKVKIALHVAHALTYLHSLSPVVIHRDLKSRNILLTSDLDAKLTDFGVSRERV  362

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT--KL  427
            D +MTAGVGT  W APE+L G  Y +KAD++SFGVVLSELD   +PY  A   DG+  ++
Sbjct  363  DHTMTAGVGTSLWMAPEVLMGERYDDKADIFSFGVVLSELDLQVLPYSHATDSDGSGHRM  422

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELV  475
            + + IL+ +  G +R  FS +    +  +G AC+SL P  RPTA E++
Sbjct  423  RDLAILQRMAMGKLRVQFSCDALASMVDLGNACVSLAPKDRPTAAEVL  470

>PHYRA_77817
Length=552

 Score = 196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 159/286 (56%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +  KRIP D +  ++++S+GA GEV+   FN Q+ AVK LL   +   + V  F
Sbjct  260  LWNDDVITAKRIPRDKVKIKKLLSRGAYGEVYTGVFNGQQVAVKMLLPATRGNLQHVTDF  319

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TAS+ HP+IV F+GVAW+SL +L +VLE++  G L+  L +             
Sbjct  320  LTEAKMTASMDHPHIVTFVGVAWDSLSDLCVVLEFMDGGDLRSLLNQYEATKHPVGIDRE  379

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL  + E K+ DFG+SR  +D +MTAGV
Sbjct  380  KATIALHVCHALTYLHSLIPPIIHRDLKSRNILLNQAKEAKVTDFGISRERLDQTMTAGV  439

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA----VTEDGTKLKPVQIL  433
            GT  W APE++ G  Y  KAD++SFGVVLSELD   +PY  A    +  +G K+    +L
Sbjct  440  GTSLWMAPEVMLGEQYGVKADIFSFGVVLSELDVHTLPYSQAKQRSLDTNGRKMADATLL  499

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +++ +G +   FS   P  +  +G AC+S+DP+ RP++ E + +L+
Sbjct  500  QKITAGEVHVEFSASNPKALVELGYACVSVDPADRPSSAEALYRLQ  545

>PPTG_10350
Length=593

 Score = 196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 158/284 (56%), Gaps = 36/284 (13%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
            + L + E +  KRIP + +  ++++S+GA GEV+   F +++ AVK L    +   + V 
Sbjct  302  RGLWNDEVITAKRIPRNKVKVKKLLSRGAFGEVYSGVFYQRRVAVKMLPSSTRTSLQHVN  361

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------  340
             F  E ++TA++ HP+IV FIGVAW+SL +L + LE++  G L+  L +           
Sbjct  362  AFLTEAKITATMDHPHIVPFIGVAWDSLSDLCVALEFMEGGDLRALLNKYEASNHHVGFD  421

Query  341  -------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTA  375
                                      R+  S N+LL  ++E K+ DFG+SR  +D +MTA
Sbjct  422  RQKTAIALHVCHALAYLHSLASPIIHRDLKSKNILLNGAMEAKLSDFGISRQRLDETMTA  481

Query  376  GVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKE  435
            GVGT  W APE++ G  Y EKADM+SFGVVLSELD   +PY  A   +G +L    +L+ 
Sbjct  482  GVGTSLWLAPEVMLGGRYDEKADMFSFGVVLSELDVHTLPYAQARESEGRELTDPSLLQR  541

Query  436  VMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            V +G +R  FS   P  I  +G AC+S+DP  RPTA E + +L+
Sbjct  542  VATGEIRVEFSYFSPRSIVNLGHACVSVDPGDRPTAAEALYRLQ  585

>HYAP_05922
Length=783

 Score = 199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 161/290 (56%), Gaps = 39/290 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C  +   +  +    +  +RI F  + F R+++KG SGEVW+ ++  +  A+K LL  K+
Sbjct  423  CRESTILRAFVSDPSIVTRRISFAQLHFLRLLAKGGSGEVWLGQYETRYVAMKCLLPAKR  482

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  E++++FA EI + + L HP IV F GVAW SL +L  V EY+  G L+  L  P   
Sbjct  483  EDPEALERFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAVTEYMPRGDLESLLANPIAR  542

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSR-GL  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  543  KELSWSREKLTLSSDIAEALVYLHSLVSIVIHRDLKSKNVLLDRRLRAKLSDFGLSREQS  602

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            ++ +MT G+GT  W+APE+LEG  Y EK+D++SFGVVLSE+DT  +PY  +      K++
Sbjct  603  IEDTMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYGFS---RHAKMR  659

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +QI+  V  G + PSF D+CPP IR +   CLSLDP++RPTA E+  +L
Sbjct  660  SMQIVHLVSEGKLLPSFRDDCPPPIRALAQRCLSLDPAARPTAMEVTFEL  709

>PYU1_G014939
Length=663

 Score = 198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 157/292 (54%), Gaps = 36/292 (12%)

Query  223  LYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQR  282
            + C  A    ++ +   L   RI    +   +++S+G  GEVW+  +  +  A+KRLL  
Sbjct  366  VLCLIATGTSSIWNDPELLAVRIDHKDVEAIKLLSRGGFGEVWLGLYMNENVAIKRLLSD  425

Query  283  KKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR  342
            KK   +++  FA EI + A L HP IV+FIGV+W +   +  V E++  G LK  L+  R
Sbjct  426  KKSMDDAL-AFASEIRIMARLEHPKIVRFIGVSWTNYLTIQAVTEFMDCGDLKSLLDSNR  484

Query  343  ----------------------------------EFMSSNVLLTDSIEPKIIDFGVSRGL  368
                                              +  S NVL+      K+ DFG+SR  
Sbjct  485  ASSLTWANLKCQISIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRDR  544

Query  369  -VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKL  427
             V+ +MTAGVGT  W APE++ G HYTE AD+YSFGVVLSELDT + P+HDA   +G K+
Sbjct  545  SVEETMTAGVGTARWIAPEVVLGGHYTEAADIYSFGVVLSELDTCKAPFHDATNTNGAKM  604

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V IL+ V +G ++PSF+D CPP I ++  ACL  DP+ RP A  +  +L 
Sbjct  605  QDVTILQLVSAGKLQPSFTDLCPPAILKLARACLEFDPARRPNAIHISYELR  656

>PITG_06480
Length=1856

 Score = 202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 163/290 (56%), Gaps = 39/290 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C ++   +  +    +  KRI F  + F R+++KG SGEVW+ ++  +  A+K LL  K+
Sbjct  425  CRKSSILRAFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVWLGQYETRYVAMKCLLPAKR  484

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  E++++FA EI + + L HP IV F GVAW SL +L  V EY++ G L+  L  P   
Sbjct  485  EDREALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAVTEYMARGDLENLLANPVAQ  544

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  545  KELTWSREKLTLSSDIVEALVYLHSLVPVVIHRDLKSKNVLLDRRLRAKLSDFGLSRERS  604

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            V+ +MT G+GT  W+APE+LEG  Y EK+D++SFGVVLSE+DT  +PY  +      K++
Sbjct  605  VEDTMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYGFS---RHAKMR  661

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +QI+  V  G + P+F D+CPP IR +   CLSLDP++RPTA E+  +L
Sbjct  662  SMQIVHLVSEGKLLPNFRDDCPPAIRDLAQRCLSLDPAARPTAMEVAFEL  711

>PHYRA_72889
Length=365

 Score = 191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 148/270 (55%), Gaps = 33/270 (12%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
             R+ +D +   R IS+G  G V+   +  +  A+K++   K  +A+ +++F  EI L A 
Sbjct  69   NRLAYDEVKLGRCISRGGFGLVFTGTYRSRPVAIKKIRVNKDAEADQIEQFIREIALMAI  128

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---------------------  341
            L HP IV+FIGVAW ++ +L  V E ++ G L   L                        
Sbjct  129  LRHPRIVEFIGVAWEAVVDLSAVTELMTRGDLSTVLRANQLTWGDHKATIALHIVEALAY  188

Query  342  ----------REFMSSNVLLTDSIEPKIIDFGVSRGL--VDLSMTAGVGTPFWTAPEILE  389
                      R+  S+NVLL + +E K+IDFG+SR     +  MTAG+GT FW APE+L 
Sbjct  189  LHSLNPKVIHRDLKSNNVLLNEEMEAKLIDFGISRERHGTETHMTAGMGTSFWIAPEVLR  248

Query  390  GNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDEC  449
            G  Y EKAD++SFGVVLSELDT   PY +A    G KL+  +IL  V +G MRPSFS EC
Sbjct  249  GQDYNEKADVFSFGVVLSELDTNDYPYWNATNPPGGKLQEGEILLLVAAGQMRPSFSTEC  308

Query  450  PPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            P  I  + + CL + P  RP+A EL++  +
Sbjct  309  PAPILGVASHCLQVRPEDRPSAAELLQVFQ  338

>PHYSO_289074
Length=532

 Score = 195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 153/279 (55%), Gaps = 36/279 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   RI    +   +++S+G  GEVW+  +  +  A+KRLL  KK   +++  FA 
Sbjct  248  DDPDLLAARIDHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLGDKKTMQDAL-AFAT  306

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-------------  342
            EI+  A L HP IV+FIGV+W++   +  V E++  G LK  L+  R             
Sbjct  307  EIKTMARLEHPKIVRFIGVSWSNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQI  366

Query  343  ---------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTP  380
                                 +  S NVL+      K+ DFG+SR    D +MTAGVGT 
Sbjct  367  AIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRNRSFDETMTAGVGTA  426

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V +G 
Sbjct  427  RWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGK  486

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++PSF + CPP I ++  ACLS DP+ RP+A  +  +L 
Sbjct  487  LQPSFEESCPPSIVKLARACLSFDPAQRPSAIHISYELR  525

>PPTG_18615
Length=605

 Score = 196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 176/316 (56%), Gaps = 44/316 (14%)

Query  207  ISISSPQQRRDSAIQSLYCERAGSN----KTLLDSEHLEGKRIPFDSIVFERVISKGASG  262
            +++  P + R + + S+   R G        L  +E + G R+P + +V +R+IS+G  G
Sbjct  283  LAMEIPMETRPTNVSSVESNRDGGEGEEESALWRNEVILGARVPREKVVAKRLISRGGYG  342

Query  263  EVWVCEFNRQKAAVKRLL-QRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDN  321
            EV+V  +NR++ A+K LL + +K KA  +  F  E++L A+L HP IV+ IG+AW+S ++
Sbjct  343  EVYVGAYNRRRVALKMLLPETRKSKAHRIS-FLAEMKLMATLEHPRIVRLIGIAWDSPND  401

Query  322  LVMVLEYLSTGSLKEFLEE------------------------------------PREFM  345
            L  ++E++  G L+  L +                                     R+  
Sbjct  402  LCGLIEFIPGGDLRALLNKYAEAHRPIGFTYEKAKIASHVAHALTYLHSLIPAVIHRDLK  461

Query  346  SSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVV  405
            S N+LLT  ++ K+ DFGVSR  VD +MTAGVGT  W +PE++ G  Y +KAD++S GVV
Sbjct  462  SKNILLTRELDAKLTDFGVSREHVDRTMTAGVGTSLWISPEVMMGERYDDKADIFSLGVV  521

Query  406  LSELDTGQVPYHDAVTEDGT--KLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSL  463
            LSEL+T  +PY  A   DG+  +L    IL+ V  G +R  FS   P  + ++G AC++L
Sbjct  522  LSELNTHAMPYAHAKPRDGSGDRLPDTAILQLVAGGKLRADFSQGGPEALMQLGLACVAL  581

Query  464  DPSSRPTAHELVRQLE  479
            DP  RPTA E++ +L+
Sbjct  582  DPKDRPTAPEVLYRLQ  597

>PHYSO_518438
Length=241

 Score = 186 bits (473),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 140/239 (59%), Gaps = 36/239 (15%)

Query  276  VKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLK  335
            VKRLL+ K+     V +F  +++L  +L HPNIV  +GVAWNS+ ++++++E+   G L 
Sbjct  3    VKRLLKSKRSHVFHVHEFVYQLQLRVTLSHPNIVTLVGVAWNSVADVMLIMEHYPLGDLL  62

Query  336  EFLEEPREFMS---------------------------------SNVLLTDSIEPKIIDF  362
             +L    E+++                                 SNVLLT+++  K+  F
Sbjct  63   SYLTHYGEYLTWERSKYRLAVSIARALTYLHSQPTPVAHRDIRASNVLLTETMGAKLTGF  122

Query  363  GVSRGLVDLSMTAGVG--TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV  420
              S  L + S    V   +PFW+APE+L G  YT KAD+++FGV+L+ELDT   P+HDAV
Sbjct  123  D-SSCLDEQSHRCHVAGPSPFWSAPEVLCGRPYTAKADVFAFGVLLTELDTATAPFHDAV  181

Query  421  TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +  GTKLKP+Q+L EVM GT+RPSFS  CP RIR IG  C   D + RPTA +L+R LE
Sbjct  182  SPAGTKLKPIQVLNEVMQGTLRPSFSAHCPRRIRMIGVGCYQHDANRRPTADQLLRLLE  240

>PHYSO_413418
Length=318

 Score = 189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 158/283 (56%), Gaps = 37/283 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +   R+P D + FE V+S+G  GEV+   +N ++ A+K L    ++  + V  F
Sbjct  29   LWNDDTIVATRVPRDQVKFEAVLSRGGFGEVYRGTYNNEQVAIKMLFPEMRKDLKKVNAF  88

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E +L ASL+HP++V+F+GVAW +L +L ++ E +  G L+  L++             
Sbjct  89   LAEAKLMASLVHPHVVRFVGVAWGNLADLCVLTELMQGGDLRTLLKDFNAKGHPQGMDQD  148

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S NVLLT+ ++ K+ DFG SR   + +MTAGV
Sbjct  149  KLRIAYHIAQALTYMHSLSPVVIHRDLKSKNVLLTEDLKAKLTDFGASRERQEHTMTAGV  208

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY-HDAVTEDGTKLKPVQILKEV  436
            GT  W APE++    YTEKAD++SFGV+LSELD   +PY H  +   G K+    IL++V
Sbjct  209  GTMLWMAPEVMMAERYTEKADVFSFGVLLSELDLQTLPYSHARIDSSGMKVPDALILQKV  268

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             SG ++  FS +C   +  +G  C++LDPS+RP+A  +V +L+
Sbjct  269  ASGALQVQFSSKCLAAVVELGKDCVALDPSARPSAPMVVFRLQ  311

>PHYKE_2247
Length=526

 Score = 194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/281 (38%), Positives = 156/281 (56%), Gaps = 36/281 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            ++ D   L   RI    +   +++S+G  GEVW+  +  +  A+KRLL  KK  ++++  
Sbjct  239  SIWDDPDLLAARIEHRDVEAIKLLSRGGFGEVWLGLYMNENVAIKRLLGDKKTMSDAL-A  297

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR----------  342
            FA EI++ A L HP IV F+GV+W +   +  V E++  G LK  L+  R          
Sbjct  298  FATEIKVMARLEHPKIVHFVGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLK  357

Query  343  ------------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGV  377
                                    +  S NVL+      K+ DFG+SR    D +MTAGV
Sbjct  358  CQIAIDVADALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGV  417

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GT  W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V 
Sbjct  418  GTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVS  477

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            +G ++PSF++ CPP I ++  ACLS DP+ RP+A  +  +L
Sbjct  478  AGKLQPSFNESCPPSIVKLARACLSFDPAHRPSAIHISYEL  518

>PHYCA_56389
Length=470

 Score = 193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 132/379 (35%), Positives = 189/379 (50%), Gaps = 57/379 (15%)

Query  1    MGNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR----------  50
            +  ++M DLAVP    + V C   NCSQP+G  +    YC G QMLN +R          
Sbjct  98   LAGHSMMDLAVPLVQFNAVGCQEKNCSQPDGTWSLSNLYCNGEQMLNAARCVMEDFNDPK  157

Query  51   ------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPL  100
                  W    +P + P+  +R H W+    +    I++ V  VHTV    +PA++EC  
Sbjct  158  GVHLAMWITGGNPKVVPTPTVRKHAWQ----DASSNISYVVLAVHTVDIADEPAYDECAT  213

Query  101  ---DEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQ----------ED  147
               +EGY SL + CH +   TD    A   V  GS +V+ WL ++++            D
Sbjct  214  ESQNEGYGSLVLACHTKANITDGIRGALDEV-QGSPWVSRWLAEDYSNGGGGLNSDSSAD  272

Query  148  SPSQ--------LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssg  199
            S S          L+P+ILG  + VA + L  L  RR+   +  Q S   H      +  
Sbjct  273  STSMTDGGFKMIYLVPIILGALLIVALVVLVLLLTRRRSRNADNQ-SFENHAASPNAAYH  331

Query  200  ssqerrAI----------SISSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDS  249
                   I          SI S  +   +  +    +   S + L+ S HL+GKRIPFDS
Sbjct  332  RDPVTPPIHEDTETGSRRSIESTIRFGQTYEREFSSDSNQSMRILMSSRHLQGKRIPFDS  391

Query  250  IVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIV  309
            + FER +SKG +GE+W+   + Q  A+KRLLQ     A+ V++FA EIEL+ASL HPNI+
Sbjct  392  LTFERPLSKGVNGEIWLGRHHGQAVAIKRLLQTNTHHADEVEEFAREIELSASLSHPNII  451

Query  310  QFIGVAWNSLDNLVMVLEY  328
             FIGVAW +L+NLVMVL++
Sbjct  452  SFIGVAWTTLENLVMVLDF  470

>PHYSO_354036
Length=437

 Score = 192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 156/293 (53%), Gaps = 41/293 (14%)

Query  227  RAGSNK---TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRK  283
            R+G  +   +L D   +   RIP D +    ++S+G  GEV+   +  Q  AVK LL   
Sbjct  132  RSGGGRHSSSLWDDPVIVAARIPVDRVELGELLSRGGFGEVYRGRYRDQNVAVKTLLPST  191

Query  284  KQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL-----  338
            ++    ++ F  EI+L A++ HP IVQFIGVAW SL  L  V E++  G L+  L     
Sbjct  192  RKDMNHIEAFLSEIKLMATMEHPQIVQFIGVAWESLSELYAVSEFMEGGDLRTLLIKYYE  251

Query  339  -EEPREF------------------------------MSSNVLLTDSIEPKIIDFGVSRG  367
             + PR F                               S N+LLTDS++ KI DFG SR 
Sbjct  252  NDHPRGFDPAKIKMALQVAHALTYLHSLDPVVLHRDLKSRNILLTDSLDAKITDFGASRE  311

Query  368  LVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGT  425
              D +MTAGVGT FW APE++ G  Y  KAD++SFGVVLSELDT ++PY  A   +E G 
Sbjct  312  RSDKTMTAGVGTSFWMAPEVVLGEQYGAKADVFSFGVVLSELDTHELPYSHAKENSETGR  371

Query  426  KLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             L    +L+ V+ G ++  FSD  P  + ++   CL ++P  RPTA E++ +L
Sbjct  372  PLPDAAVLQLVLMGRLQVQFSDVGPTEMTQLAQQCLQMEPEDRPTAAEVLYRL  424

>PHYCA_569895
Length=319

 Score = 189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 155/283 (55%), Gaps = 37/283 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + E +   R+P D +  E  IS+G  GEV+  ++N Q  AVK L    +   + V  F
Sbjct  28   LWNDETIIATRVPRDQVRVEGCISRGGFGEVYRGKYNNQDVAVKMLFPEARSDLKKVNAF  87

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE------EP------  341
              E++L ASL HP+IVQF+GV+W SL +L ++ E +  G L+  L+       P      
Sbjct  88   LAEVKLMASLSHPHIVQFVGVSWGSLTDLCVLTELMKGGDLRSLLKGFEDQKHPQGIDHD  147

Query  342  ------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S NVLLT+ ++ K+ DFG SR   + +MTAGV
Sbjct  148  KIQIAYQIAQALTYLHSLSPIVIHRDLKSKNVLLTEDLDAKLTDFGASRERQEQTMTAGV  207

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY-HDAVTEDGTKLKPVQILKEV  436
            GT  W APE++   HY EKAD++SFGV++SELD   +PY H  +   G K     IL++V
Sbjct  208  GTMLWMAPEVMMAEHYDEKADIFSFGVLMSELDLQSLPYAHARIDSAGKKSPDAVILQKV  267

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             SG ++ +FS  C   + ++G  C+SLDPS+RP+A  +V +L+
Sbjct  268  ASGALQVAFSPHCLASLVQLGKECISLDPSNRPSAPMVVFRLQ  310

>PHYCA_45835
Length=442

 Score = 192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 105/277 (38%), Positives = 158/277 (57%), Gaps = 40/277 (14%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            KRIP   ++ E++IS+G+ GEV+   FN ++ AVK LL   +     V +F  E ++TA+
Sbjct  164  KRIPRAKVLTEKLISRGSFGEVYEGVFNDKQVAVKMLLPASRDNITLVNEFLAEAKMTAT  223

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----------------------  340
            + HP+IV FIGVAW+SL +L +VLEY++ G L+  L                        
Sbjct  224  MDHPHIVSFIGVAWDSLSDLCVVLEYMNGGELRSLLNNYLDSNHPIGFNRQKATIALQVC  283

Query  341  --------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPE  386
                           R+  S N+LL  ++  K+ DFG+SR  +D +MTAGVGT  W APE
Sbjct  284  HALTYLHSLMPSVIHRDLKSRNILLDSNMVAKLSDFGISRERLDRTMTAGVGTSLWMAPE  343

Query  387  ILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQILKEVMSGTMR  442
            ++ G  Y +KADM+SFGVVLSELD   +PY  A  E    +G ++    +L++V  GT++
Sbjct  344  VMLGERYDDKADMFSFGVVLSELDVHSLPYTRARKENLDSNGREIADSILLQKVALGTVQ  403

Query  443  PSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              FS+  P  +  +G AC+S+DP+ RP+A E + +L+
Sbjct  404  VEFSNPKPRSLGELGQACISIDPTDRPSAAEALYRLQ  440

>PHYSO_515035
Length=497

 Score = 193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 151/267 (57%), Gaps = 13/267 (5%)

Query  227  RAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQK  286
            R   N+ LL+   +   RI +  +   + ISKG  G V+  E+  ++ A+K++   +   
Sbjct  200  RREVNQALLEDPVIVTNRIEYKQLRLGKCISKGGFGLVFTGEYKGRRVAIKKIRPDRSGD  259

Query  287  AESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL-----EEP  341
               ++ F  EI + A L HP IV+FIGV W++L +L  V E++  G L+E L     + P
Sbjct  260  VSEIEVFLKEIIMMAVLYHPRIVEFIGVTWDNLRHLAAVTEFMDNGDLREALAYLHSQHP  319

Query  342  ----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLS--MTAGVGTPFWTAPEILEGNHYTE  395
                R+  S NVLL    E K+ DFG+SR   D+   MTAGVGT FW APEIL G  Y E
Sbjct  320  KVIHRDLKSKNVLLNLYYEAKLSDFGISRMRYDMETHMTAGVGTSFWIAPEILLGRDYDE  379

Query  396  KADMYSFGVVLSELDTGQVPYHDAVTEDGT--KLKPVQILKEVMSGTMRPSFSDECPPRI  453
            +AD+YSFGVVLSE+DT   PY +         K++  +IL +V  G MRP FS +CP  I
Sbjct  380  RADIYSFGVVLSEIDTDDYPYWNDNNPHAARGKIQEAEILSQVAVGHMRPEFSVDCPEEI  439

Query  454  RRIGTACLSLDPSSRPTAHELVRQLEG  480
              +  ACL  DP +RPTA E+V  L+ 
Sbjct  440  LALADACLQKDPRNRPTAAEIVMILQN  466

>PHYRA_77814
Length=565

 Score = 194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 156/286 (55%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +   RIP D +  + +IS+GA GEV    FN ++ AVK LL   +   + V  F
Sbjct  272  LWDDDVITANRIPRDKVRVKGIISRGAFGEVCEGAFNGKQVAVKMLLPHMRGNLQQVNDF  331

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ HP++V FIGVAW+SL +L +VLE++  G L+  L +             
Sbjct  332  LAEAKMTATMDHPHVVGFIGVAWDSLSDLCVVLEFMDGGDLRALLNKYETTNHRVGFDRE  391

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL+ + + K+ DFG+SR  +D +MTAGV
Sbjct  392  KTTIALQVCHALTYLHSLMPPVIHRDLKSRNILLSQARDAKLTDFGISRERLDQTMTAGV  451

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y  KADM+SFGVVLSELD   +PY  A  +    +G +L    IL
Sbjct  452  GTSLWMAPEVMLGERYDVKADMFSFGVVLSELDVHTLPYAQAKEQVRDSNGRRLPDAAIL  511

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V  G +   FS   P  +  +G AC+SL+PS RPTA E + +L+
Sbjct  512  QQVAMGYLHVEFSQASPANMVELGRACISLNPSDRPTAAEALYRLQ  557

>PHYSO_421999
Length=294

 Score = 187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 150/278 (54%), Gaps = 40/278 (14%)

Query  242  GKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTA  301
             KR+P D I  + +IS+GA GEV+   FNR   A+K L+   +     V  F  E ++TA
Sbjct  10   AKRVPRDKIHVKSLISRGAYGEVYSGRFNRHPVAIKMLIPSTRCSLPHVSDFLAEAKMTA  69

Query  302  SLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP--------------------  341
            S+ HP+IV+ IGV+W+SL +L +VLE++  G L+  L +                     
Sbjct  70   SMDHPHIVKLIGVSWDSLSDLCVVLEFMDGGDLRALLNKHEVSKHPVGFDRKKATVALQV  129

Query  342  ----------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAP  385
                            R+  S N+LL  +++ K+ DFG SR  +D +MTAGVGT  W AP
Sbjct  130  CHALTYLHSLMPPVIHRDVKSRNILLNRAMDAKLTDFGTSRERLDQTMTAGVGTSLWMAP  189

Query  386  EILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT----EDGTKLKPVQILKEVMSGTM  441
            E++ G  Y  KADM+SFGVVLSELD   +PY  A       DG  +    +L+++ +G +
Sbjct  190  EVMLGERYDVKADMFSFGVVLSELDNHTLPYTRAKQRSQDNDGRPMTDASLLQKITTGAV  249

Query  442  RPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            R  FS   P  +  +G AC++++P  RPTA E + +L+
Sbjct  250  RVDFSRSSPASVVELGLACVAVNPGDRPTAAEALYRLQ  287

>PHYSO_522417
Length=1838

 Score = 200 bits (509),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 161/290 (56%), Gaps = 39/290 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C ++   +  +    +  KRI F  + F R+++KG SGEVW+ ++  +  A+K LL  K+
Sbjct  428  CRKSPILRGFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVWLGQYEARYVAMKCLLPTKR  487

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  E++++FA EI + + L HP IV F GVAW SL +L  V EY+  G L+  L  P   
Sbjct  488  EDPEALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAVTEYMPRGDLESLLANPIAQ  547

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  548  KELSWSREKLTLSSDIVEALVYLHSLVPIVIHRDLKSKNVLLDRRLRAKLSDFGLSRERS  607

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            V+ +MT G+GT  W+APE+LEG  Y EK+D++SFGVVLSE+DT  +PY         K++
Sbjct  608  VEDTMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRNAKMR  664

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             +QI+  V  G + P+F D+CPP IR +   CLSLDP++RPTA E+  +L
Sbjct  665  SMQIVHLVSEGKLLPNFRDDCPPAIRALAQRCLSLDPAARPTAMEVAFEL  714

>PHYRA_80665
Length=1143

 Score = 200 bits (508),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 166/307 (54%), Gaps = 44/307 (14%)

Query  216   RDSAIQSLYCERAGSN-----KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFN  270
             R SA ++   E   SN       L D E +   RIP + ++  R+I++G  GEV+   +N
Sbjct  831   RSSAKRTTETETLSSNGGTIMSKLWDDEAIIAARIPKEKVLVGRLINRGGFGEVYAGTYN  890

Query  271   RQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLS  330
              Q  AVK LL  +K+    V  F  E++L  +L HP+IVQF+GVAW+SL +L +V E+++
Sbjct  891   GQPVAVKMLLPERKKSLTQVNAFLSEVKLMTTLEHPHIVQFVGVAWDSLTDLCVVTEFMT  950

Query  331   TGSLKEFLEE------------------------------------PREFMSSNVLLTDS  354
             T  LK  L +                                     R+  SSN+LL  +
Sbjct  951   T-DLKALLSQYEEQSLPVGFDHDKVKVALHVAHALTYLHSCAPPVIHRDLKSSNILLNQA  1009

Query  355   IEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQV  414
             ++ K+ DFG+SR  +D +MTAGVGT  W APE++ G  Y +KADM+SFGVVLSELD   +
Sbjct  1010  MDAKVTDFGISRERIDATMTAGVGTSLWMAPEVMLGERYDDKADMFSFGVVLSELDLHAL  1069

Query  415   PYHDAV--TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAH  472
             PY  A   +  G +L    IL+ V +G +R  FS   P  + ++G AC+S DP  RPTA 
Sbjct  1070  PYAHAKHNSASGQRLTDPAILQMVAAGKLRVQFSQAAPESMVQLGIACVSTDPKQRPTAA  1129

Query  473   ELVRQLE  479
             E + +L+
Sbjct  1130  EALYRLQ  1136

 Score = 169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 140/263 (53%), Gaps = 37/263 (14%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D + +   RIP D +V E ++S+GA GEV+   +N Q+ A+K L    ++    V  F  
Sbjct  291  DDDTIVAARIPRDKVVVETLVSRGAFGEVYKGTYNGQRVAIKMLRTDSRRSIPHVSAFMA  350

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-----------EP---  341
            E+++TA + HP+IV+F+GVAW+SL +L  V E++  G LK  L            +P   
Sbjct  351  EVKMTAVMDHPHIVKFVGVAWDSLSDLCSVTEFMDGGDLKALLAMYAEQSHPEGFDPTKV  410

Query  342  ----------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R+  S N+LL+  ++ K+ DFG+SR  +D +MTAGVGT
Sbjct  411  RIALHVAHALTYLHSLDPPVIHRDLKSKNILLSQELDAKLTDFGISRERIDETMTAGVGT  470

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
              W APE++ GN Y E ADM+SFGVVLSEL T   PY  A     +  + V IL+ V +G
Sbjct  471  SLWMAPEVMLGNAYDELADMFSFGVVLSELSTHTAPYSHARLRSSSVPRTV-ILQNVAAG  529

Query  440  TMRPSFSDECPPRIRRIGTACLS  462
             +   FS   P  +  +G A ++
Sbjct  530  KLSVEFSGAGPETMVELGRASVN  552

>PHYCA_117114
Length=546

 Score = 194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 155/283 (55%), Gaps = 38/283 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP + +V E +IS+G  GEV++  FN+Q+ AVK LL   ++    V  F
Sbjct  256  LWDDEVIATARIPREKVVIEEMISRGGGGEVYLGLFNQQQVAVKMLLPEMRKSVRYVNAF  315

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL---------------  338
              E++L A+L HP IVQF+GVAW+SL +L +V E++  G L+  L               
Sbjct  316  LAEVKLMATLDHPRIVQFVGVAWDSLTDLCVVSEFMEGGDLRALLVKYEKENHPTGFDKT  375

Query  339  ------------------EEP---REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              E P   R+  S NVLLT ++E K+ DFG+SR   D +MT+GV
Sbjct  376  KVTIALHVAHALTYLHSLETPVLHRDLKSKNVLLTPALEAKLTDFGISREQADKTMTSGV  435

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA--VTEDGTKLKPVQILKE  435
            GT  W APE++ G  Y  KADM+SFGV+LSELD   +PY  A   +E   K+    +L+ 
Sbjct  436  GTLLWMAPEVMLGERYDAKADMFSFGVLLSELDVHVLPYSHAKEKSESDRKIPESVMLQM  495

Query  436  VMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            V  G +R  FS      +  +G AC+SLDP  RPTA + + +L
Sbjct  496  VALGKIRVEFSSNSLESVLDLGLACVSLDPQERPTAAQALYRL  538

>PHYRA_95777
Length=314

 Score = 187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 154/282 (55%), Gaps = 38/282 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   ++  RIP +++  +++I++G  GEV++  +  +  AVKRLL  +++    V+ F +
Sbjct  10   DDPEIQEARIPMENLRVQQLINRGGFGEVFLGTYRGRAVAVKRLLPDRRKNMREVEAFIV  69

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE----------------  339
            EI++  S+ HP IV  +GVAW S  ++  V EY+  G L+  LE                
Sbjct  70   EIKIMLSMDHPRIVGCLGVAWESWTDISAVTEYMEGGDLRTVLERFEQQEHRAHGFDDDK  129

Query  340  -----------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVG  378
                             +P    R+  S N+LL  +++ K+ DFGVSR   D++MTAGVG
Sbjct  130  LNIALHVAQGLTYLHGMDPIVLHRDLKSKNILLNKNLDAKLTDFGVSRESADITMTAGVG  189

Query  379  TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY-HDAVTEDGTKLKPVQILKEVM  437
            T  W APE++ G+ Y EKADM+SFGVVL ELD  Q+PY H   +  G KL    IL+ V 
Sbjct  190  TSLWMAPEVMIGDRYNEKADMFSFGVVLGELDCQQLPYSHAKESGTGRKLPGTAILQMVA  249

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +G +R   S+  P  I  +  AC SLDPS RPTA E   +L+
Sbjct  250  AGQLRLEMSEASPSGIYDLVMACTSLDPSDRPTAAEAFERLQ  291

>PHYSO_474546
Length=533

 Score = 193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 167/293 (57%), Gaps = 39/293 (13%)

Query  226  ERAGSNKT-LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            +RA S  + L + + +  KRIP D +  E+++S+GA GEV++  +N ++ AVK LL + +
Sbjct  233  QRASSGPSGLWNDDVIIAKRIPKDKVHVEQLVSRGAFGEVYMGLYNHKRVAVKMLLPQMR  292

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-----  339
                 V +F  E +LTA++ HP+IV FIGVAW+SL ++ +VLEY+  G L+  L      
Sbjct  293  GYINKVNEFLTEAKLTATMEHPHIVTFIGVAWDSLSDVCVVLEYMDGGDLRSLLSNYETT  352

Query  340  ----------------------------EP---REFMSSNVLLTDSIEPKIIDFGVSRGL  368
                                        +P   R+  S NVLL  ++E K+ DFGVSR  
Sbjct  353  HHPVGFDRGKVTIALHVCHALAYMHSLAQPVIHRDLKSRNVLLNRAMEAKLTDFGVSRER  412

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY--HDAVTEDGTK  426
            +D +MTAGVGT  W APE++ G  Y +KAD++SFGVV+SELD   +PY    A      +
Sbjct  413  LDRTMTAGVGTSLWMAPEVMMGKKYDDKADIFSFGVVISELDMHALPYAKALAAASANNQ  472

Query  427  LKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            +    +L+ V  GT+R  FS      +  +G+AC+S+DPS RPTA +++ +L+
Sbjct  473  MAAAVLLQRVALGTLRVEFSQVGSRLMAELGSACVSVDPSERPTAAQILYRLQ  525

>PPTG_22589
Length=1009

 Score = 199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/277 (39%), Positives = 158/277 (57%), Gaps = 40/277 (14%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            KRIP D +  E++IS+G+ GEV+   FN Q+ AVK LL   +     V +F  E ++TA+
Sbjct  724  KRIPRDKVQTEKLISRGSFGEVYAGIFNGQQVAVKMLLSASRDNITLVNEFLAEAKMTAT  783

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----------------------  340
            + HP+IV F+GVAW+SL +L +VLEY+  G L+  L                        
Sbjct  784  MDHPHIVSFVGVAWDSLTDLCVVLEYMDGGELRSLLNSYLESKNPVGFDREKATIALQVC  843

Query  341  --------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPE  386
                           R+  S N+LL  +++ K+ DFG+SR  +D +MTAGVGT  W APE
Sbjct  844  HALTYLHSLMPSIIHRDLKSRNILLDKNMQAKLSDFGISRERLDRTMTAGVGTSLWMAPE  903

Query  387  ILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQILKEVMSGTMR  442
            ++ G HY +KADM+SFGVVLSELD   +PY  A  E    +G ++    +L++V  G ++
Sbjct  904  VMLGEHYDDKADMFSFGVVLSELDMHTLPYARAKKENLDSNGREMIDSILLQKVALGKLQ  963

Query  443  PSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              FS+  P  I  +G AC+S+DP+ RP+A E + +L+
Sbjct  964  VEFSNPKPRSIGELGRACISIDPTERPSAAEALYRLQ  1000

 Score = 197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 157/285 (55%), Gaps = 40/285 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP + +  +++IS+GA GEV+   FN Q+ A+K LL   +   + V +F
Sbjct  184  LWDDDVITAKRIPRNKVQTQKLISRGAFGEVYAGIFNGQQVAIKVLLPSTRTNMKQVNEF  243

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++ A++ HP+IV F+GVAW+SL +L +VLEY+  G L+  L++             
Sbjct  244  LAEAKMNATMDHPHIVMFVGVAWDSLSDLCVVLEYMHGGELRSLLDQYLKSKHPVGFNKQ  303

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+L T  +E K+ DFG+SR  +D +MTAGV
Sbjct  304  KATTALQVCHALTYLHSLDPPVIHRDLKSRNILFTSDMEAKLSDFGISRERLDQTMTAGV  363

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KADM+SFGVVLSELD   +PY  A  E     G  +    +L
Sbjct  364  GTSLWMAPEVMMGERYDDKADMFSFGVVLSELDVHTMPYAHAKKETLESSGRAMVDSVLL  423

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++V  GT++  FS+  P  I  +G  CL +DP+ RP A E + +L
Sbjct  424  QKVALGTIQAEFSETTPEEIVELGRVCLDVDPTKRPNAAEALYKL  468

>PHYCA_570506
Length=351

 Score = 188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/275 (37%), Positives = 148/275 (54%), Gaps = 38/275 (14%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
             R+ +D +   R I++G  G +++  +  ++ AVK++   K+ +   +++F  E+ L A 
Sbjct  74   NRLNYDEVKLGRCINRGGFGLIFIGTYRGRQVAVKKIRVNKETEGSQIEQFIREVTLMAI  133

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----------------------  340
            L HP +V+FIG+AW+++ +L  V E +  G L   L+                       
Sbjct  134  LRHPRVVEFIGIAWDAVVDLSAVTELMVRGDLMTVLQNCQENGIQLTWCDHKATIALHIV  193

Query  341  --------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDL--SMTAGVGTPFWTA  384
                           R+  S NVLL D +E K+ DFG+SR   D   SMTAG+GT FW A
Sbjct  194  EALAYLHSLSPKVIHRDLKSKNVLLNDEMEAKLSDFGISRERFDTETSMTAGMGTSFWIA  253

Query  385  PEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPS  444
            PE+L G  Y EKAD++SFGVVLSELDT   PY  A    G+KL+  +IL+ V +G +RP+
Sbjct  254  PEVLRGRDYDEKADVFSFGVVLSELDTDDYPYWSAANSPGSKLQEGEILQLVAAGKLRPA  313

Query  445  FSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            FS  CP  I R+   CL + P  RP A ELV+  +
Sbjct  314  FSRSCPASILRVADRCLQVRPEDRPNAVELVQMFQ  348

>PHYSO_260691
Length=486

 Score = 192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 146/272 (54%), Gaps = 38/272 (14%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
             RI +  +   R IS+G  G V+V  +  ++ AVK++   +  +A  +++F  EI L A 
Sbjct  187  NRIDYGEVKLGRCISRGGFGLVYVGTYRGRRVAVKKIRVNRDAEASQIEQFIREITLMAM  246

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPRE-------------------  343
            L HP IV+FIGVAW +L +L  V E +  G L   L   RE                   
Sbjct  247  LRHPRIVEFIGVAWEALVDLSAVTELMERGDLSTVLRNCREKGYRLTWSDHKATIALHIV  306

Query  344  -----------------FMSSNVLLTDSIEPKIIDFGVSRGLVDLS--MTAGVGTPFWTA  384
                               S NVLL + ++ K+ DFG+SR   D+   MTAG+GT FW A
Sbjct  307  EALAYLHSLSPKVIHRDLKSKNVLLNEEMQAKLSDFGISREHHDVETHMTAGMGTSFWIA  366

Query  385  PEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPS  444
            PE+L G  Y E+AD++SFGVVLSELDT   PY DA  +  +KL+  +IL+ V +G +RPS
Sbjct  367  PEVLNGQDYDERADVFSFGVVLSELDTDDYPYWDAANQPRSKLQEGEILQLVATGQLRPS  426

Query  445  FSDECPPRIRRIGTACLSLDPSSRPTAHELVR  476
            FS  CP  I  + T CL + P  RP+A ELVR
Sbjct  427  FSSSCPAAILEVATRCLQVRPEDRPSATELVR  458

>PHYCA_562574
Length=542

 Score = 193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/292 (37%), Positives = 158/292 (54%), Gaps = 40/292 (14%)

Query  228  AGSNKTLLDSEH-LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQK  286
             GS +T L  +  +   RIP D I    VI +GA GEV+   +  Q+ AVK L+  K++ 
Sbjct  243  GGSERTTLSGDPVILASRIPIDGIELGAVIGRGAFGEVYRGRYRGQEVAVKALVPEKRKD  302

Query  287  AESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE------  340
             + ++ F  E++L A++ HPNIVQFIGVAW SL +L  V+E+++ G L+  L+E      
Sbjct  303  MDHIEAFLSEVKLMATMEHPNIVQFIGVAWESLSDLFCVIEFMTGGDLRTLLKEYHASGV  362

Query  341  ------------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVD  370
                                           R+  S N+LLT+++ PKI DFG SR   D
Sbjct  363  PQGMDASKMQIAYGVAHALTYLHSLEPVVLHRDLKSRNILLTETLMPKITDFGASRIRSD  422

Query  371  LSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV---TEDGTKL  427
             +MT+ VG+  W APE++ G HY EKAD++S GVV+SELDT ++PY  A    +  G  L
Sbjct  423  ATMTSNVGSSLWMAPEVMMGGHYDEKADIFSLGVVISELDTQELPYSHAKEGNSRSGHPL  482

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
                +L+ V  G +R  FS    P + R    C+S++P  RPTA E++  L+
Sbjct  483  SDTALLQMVSMGKLRVHFSSAMHPDMVRFVERCVSMNPHERPTAAEVLYYLQ  534

>PHYRA_79691
Length=588

 Score = 194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 169/312 (54%), Gaps = 43/312 (14%)

Query  206  AISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVW  265
            A S++ P   +D A      E  G+   + + E +   R+P + +V    IS+G  GEV+
Sbjct  263  AHSVTDPTDSQDRA-----SELTGTIVGMWNDETIVAARLPREKVVINERISRGGFGEVY  317

Query  266  VCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMV  325
            +  FN Q  AVK LL   ++    V  F  E+++ A++ HP I +FIGVAW+SL +L +V
Sbjct  318  LGSFNDQVVAVKMLLPETRKSISHVNDFLSEVKMMATMEHPRITKFIGVAWDSLADLCVV  377

Query  326  LEYLSTGSLKEFL---------------------------------EEP---REFMSSNV  349
             EY++ G L+  L                                 E P   R+  S N+
Sbjct  378  SEYMAGGDLRALLSRFEKDQRPKGFDKDKVNVALHIAHALTYMHSLELPVIHRDLKSRNI  437

Query  350  LLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSEL  409
            LL++ ++ K+ DFG+SR  VD +MTAGVGT  W APE++ G  Y +KADM+SFGVVLSEL
Sbjct  438  LLSEEMDAKLTDFGISRERVDQTMTAGVGTSLWMAPEVMLGEKYDDKADMFSFGVVLSEL  497

Query  410  DTGQVPYHDAVTEDGT--KLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSS  467
            D+  +PY +A     +  K+    IL++VM G +   F+      ++ +G AC+S+DP+ 
Sbjct  498  DSHSLPYSNAKDSSNSERKMPDAVILQQVMLGKLTVQFTQTSSQSMKDLGLACVSVDPNG  557

Query  468  RPTAHELVRQLE  479
            RPT+ E + +L+
Sbjct  558  RPTSAEALGKLQ  569

>PHYSO_415772
Length=496

 Score = 192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/280 (38%), Positives = 153/280 (55%), Gaps = 40/280 (14%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            +  KRI    +   +++S+GA GEV+   F+  + AVK L    +    +V  F  E ++
Sbjct  214  ITAKRISRRDVHIGKLLSRGAFGEVYSGTFDGSRVAVKMLPPETRGAIPNVNAFLSEAKM  273

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------------  340
            TA++ HP I+  IGVAWNSL +L +V+E++  G L+  L+                    
Sbjct  274  TATMDHPRIISLIGVAWNSLSDLCVVMEFMEGGDLRALLDRYQTAQHPVGIDHEKATIAL  333

Query  341  -----------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWT  383
                              R+  S N+LLT+++E KI DFG+SR  +D +MTAGVGT  W 
Sbjct  334  HVCHALTYLHSLMPQVIHRDLKSRNILLTETMEAKITDFGISRERLDQTMTAGVGTSLWM  393

Query  384  APEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQILKEVMSG  439
            APE++ G  Y +KADM+SFGVVLSELD   +PY  A  +    DG KL    +L++V  G
Sbjct  394  APEVMMGERYDDKADMFSFGVVLSELDAHALPYAQAKEKNRDSDGRKLPDTILLQQVAMG  453

Query  440  TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +R  FS+  P  I  +G AC+S+DP  RPTA E + +L+
Sbjct  454  RLRVEFSESTPQSIVDLGLACVSVDPKMRPTAAEALYRLQ  493

>PPTG_10370
Length=565

 Score = 193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 158/286 (55%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP D +  ++++S+GA GEV+   FN  + AVK LL   +   + V  F
Sbjct  273  LWDDDVITAKRIPRDKVRVKKLLSRGAFGEVYEGVFNGNRVAVKMLLPHTRGNLKQVNDF  332

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ HP++V F+GVAW SL ++ +VLE++  G L+  L +             
Sbjct  333  LAEAKMTATMDHPHVVTFVGVAWESLCDVCVVLEFMDGGDLRSLLSKYEESRHPTGFDRE  392

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL  ++E K+IDFG+SR  +D +MTAGV
Sbjct  393  KTTIALHVCHALTYLHSLMPPVIHRDLKSRNILLNRAMEAKLIDFGISRERLDQTMTAGV  452

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y  KAD++SFGVVLSELD   +PY  A  +    +G KL    IL
Sbjct  453  GTSLWMAPEVMLGERYDVKADLFSFGVVLSELDLHTLPYAQAKDKVRDANGRKLPDAAIL  512

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V  G ++  FS   P  I  +G AC+SL P+ RPTA E + +L+
Sbjct  513  QQVAMGIVQVEFSQISPTGIVELGRACVSLSPNDRPTAAEALYRLQ  558

>PHYSO_477685
Length=526

 Score = 192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 158/289 (55%), Gaps = 40/289 (14%)

Query  231  NKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESV  290
            N+ L + E +  K++P D +  +++IS+GA GEV+  + +R + AVK LL   +   + V
Sbjct  226  NRGLWNDEIIIAKKLPRDKVKIQKLISRGAFGEVYAGQLHRNQVAVKMLLPATRNSLKHV  285

Query  291  QKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----------  340
              F  E ++TA + HP++V FIGVAW+SL ++ +VLE++  G L+  L +          
Sbjct  286  DDFLAEAKMTAVMDHPHVVSFIGVAWDSLSDVCVVLEFMDGGDLRTLLNKYETSKHPVGF  345

Query  341  --------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMT  374
                                       R+  S N+LL  ++  K+ DFG+SR  +D +MT
Sbjct  346  DKQKATIALHVCHALTYLHSLAPPVIHRDLKSRNILLNKAMHAKLTDFGISRERLDQTMT  405

Query  375  AGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD----AVTEDGTKLKPV  430
            AG+GT  W APE++ G  Y  KADM+SFGVVLSELD   +PY      ++   G  L   
Sbjct  406  AGMGTSLWMAPEVMLGERYDVKADMFSFGVVLSELDVHTLPYAQEKKRSLDSGGRALADA  465

Query  431  QILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +L+ V  GT+R  FS+     I  +G AC+S+DPS RP+A E + +L+
Sbjct  466  TLLQRVAEGTVRVEFSEGNASFITELGCACVSVDPSQRPSAAEALYKLQ  514

>PHYSO_486489
Length=796

 Score = 196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/260 (38%), Positives = 160/260 (62%), Gaps = 34/260 (13%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            +R+PF  +   R+I+ GA GEVW+     +  AVKRL + ++++   ++ FA EI+L AS
Sbjct  528  RRVPFVDVSLVRLITAGAYGEVWLGRLRGEIVAVKRLTRERRRQLHDLEVFAAEIQLMAS  587

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-------EP-----REF------  344
              H N++  +GVAWN+L+N+++++EY+  G L++ L+       EP     +EF      
Sbjct  588  FAHSNVLGLLGVAWNTLENMLLIMEYMERGDLQQVLQYHSDKGLEPEGSDSKEFSWASHK  647

Query  345  ------MSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKAD  398
                  ++  +     +EP ++   ++          GVGT  WTAPE+L G  Y+EKAD
Sbjct  648  AKIARDIACGLKYLHGLEPIVVHRDLN----------GVGTANWTAPEVLAGYKYSEKAD  697

Query  399  MYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGT  458
            +YS GVVL+ELDTG++P++DA T DG K++ + IL  V+SG ++PSF+ +CP  +R++  
Sbjct  698  VYSLGVVLTELDTGELPFYDARTSDGDKMEAIHILSLVVSGKLQPSFTLDCPEDVRKLTL  757

Query  459  ACLSLDPSSRPTAHELVRQL  478
            ACLS  P  RP+A+E++ +L
Sbjct  758  ACLSPQPECRPSANEVMEEL  777

 Score = 40.0 bits (92),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 49/125 (39%), Gaps = 32/125 (26%)

Query  6    MADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSRWDPT-----------  54
            M++L + +       C    CS PNG   + + YC+G+QM NVS    T           
Sbjct  182  MSELQITRTAYRSTGCKEQRCSSPNGEIFYQSLYCSGYQMGNVSLCAATNGITPVHGSMW  241

Query  55   -------MTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPA-WNECPLDEGYAS  106
                   M P   ++ H+W          I + +  +H      DP  + +C +     +
Sbjct  242  ANGGTDDMVPVSEMKRHEWTD------AGINYTIMAIHLTG---DPNRYGKCVM----PA  288

Query  107  LTVPC  111
            +TVPC
Sbjct  289  MTVPC  293

>H310_09505
Length=427

 Score = 189 bits (481),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 152/282 (54%), Gaps = 36/282 (13%)

Query  235  LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFA  294
            +D+  L+ K + +  I + R +SKGA GEVW+ +F     A+K++L+ +K  A+ ++ F 
Sbjct  137  MDATLLKAK-VDYTDIQYTRKLSKGAFGEVWLGQFQGNYVAIKQILEERKTDAKEIECFV  195

Query  295  LEIELTASLIHPNIVQFIGVAWNSLD-NLVMVLEYLSTGSLKEFLEEP------------  341
             EI+L A+  HPNIV F+G +WN  D NL  + EY+  G L  FL++             
Sbjct  196  AEIKLMATFQHPNIVDFLGFSWNPKDANLCAMTEYMKNGDLFVFLQKRKATLTWQHDKLQ  255

Query  342  ---------------------REFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAGVGT  379
                                 R+  S NVLL D    K+ DFG+SR   ++ +MTAGVGT
Sbjct  256  IAIDIAQALVYLHSLSPKVIHRDLKSKNVLLDDRCTAKLSDFGISRLRQLEETMTAGVGT  315

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
              W APE+     Y ++AD+YS GVVLSELDT  +PY D       KL  + ++K V   
Sbjct  316  ALWAAPEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAVGKNGKLDGMAVVKLVTQQ  375

Query  440  TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGR  481
              +P+FS+ CP  +R +   CL  +P +RP+A E+V  L+ R
Sbjct  376  KAKPTFSESCPQAVRALAFQCLDYEPDNRPSAAEVVEILKNR  417

>PHYRA_77670
Length=587

 Score = 193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 157/283 (55%), Gaps = 38/283 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   R+P + ++ ++++S+G  GEV+   FN +  AVK LL   ++    +  F
Sbjct  297  LWDDEIIITARVPREKVLVQQLLSRGGYGEVYAGLFNEEPVAVKMLLPEMRKSISHLNAF  356

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E++L ASL H  IVQF+GVAW+SL++L ++ EY++ G L+  L+              
Sbjct  357  LAEVKLMASLDHERIVQFVGVAWDSLNDLCVLSEYMAGGDLRTLLKNCEEHNTPVGFDRS  416

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LLT  ++ K+ DFGVSR   D +MT GV
Sbjct  417  KTTIALHVAHALTYLHSLSPPVLHRDLKSKNILLTVQLDAKVTDFGVSRERSDHTMTGGV  476

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILKE  435
            G+  W APE++ G  Y +KADM+SFGVVL+ELD   +PY +A   ++ G  +  + IL+ 
Sbjct  477  GSSRWMAPEVMMGERYDDKADMFSFGVVLAELDQHTIPYANAKENSDSGRAMPDLAILQM  536

Query  436  VMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            V +G +R  FS   P  I+ +G AC+S+DP  RPTA + + QL
Sbjct  537  VATGRLRIEFSSAAPKAIKELGMACVSIDPKDRPTASDALYQL  579

>CCA19152
Length=720

 Score = 195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 111/288 (39%), Positives = 161/288 (56%), Gaps = 37/288 (13%)

Query  226  ERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQ  285
            E  GS+    DSE L   R+ +  +   +++S+G  GEVW+  +  ++ AVKRLL  KK 
Sbjct  427  ETHGSSSIWTDSELL-AVRVDYKDVRLVKLLSRGGFGEVWLGSYMNEEVAVKRLLSDKKT  485

Query  286  KAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----  341
             ++++  FA E+++ A L HP IV+FIGVAW++   +  V EY+  G L+  L       
Sbjct  486  MSDAL-AFASEVKVMAKLEHPKIVRFIGVAWSTALTIQAVTEYMDCGDLRSLLNSRKGSS  544

Query  342  ------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-VD  370
                                          R+  S NVL+      K+ DFG+SR   ++
Sbjct  545  LTWANLKCQIAIDIADALVYMHTMNPKIIHRDLKSRNVLVDAQQGAKLSDFGISRNRSLE  604

Query  371  LSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPV  430
             +MTAGVGT  W APE++ G HYTE AD+YS GVVL+ELDT + P+HDAV  +G+K++ V
Sbjct  605  DTMTAGVGTARWIAPEVIFGGHYTELADVYSLGVVLTELDTCKNPFHDAVNTNGSKMQDV  664

Query  431  QILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             IL+ V SG ++PSFS  CP  I ++  ACL+  PS RP A  +  +L
Sbjct  665  TILQLVSSGQLKPSFSASCPASIVKLAEACLAFHPSERPGAIHVSYEL  712

>PITG_17357
Length=555

 Score = 192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/281 (38%), Positives = 154/281 (55%), Gaps = 36/281 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP + ++  + IS+   GEV++  FN+Q+ A+K LL   ++  + V  F
Sbjct  267  LWDDEVIATARIPREKVIVLQPISRRGGGEVYLGLFNQQQVAIKMLLPEMRKSVKHVNAF  326

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSL-------------------  334
              E++L A+L HP IVQF+GVAW+SL +L +V E++  G L                   
Sbjct  327  LTEVKLMATLDHPRIVQFVGVAWDSLTDLCVVSEFMEGGDLWGLLTRYQNENHPTGFDRT  386

Query  335  --------------KEFLEEP---REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                             LE P   R+  S NVLLT S+E K+ DFG+SR   D +MTAGV
Sbjct  387  KVTIALHVAHALTYLHSLETPVLHRDLKSKNVLLTSSLEAKLTDFGISREQADRTMTAGV  446

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
            GT  W APE++ G  Y +KADM+SFGV+LSELD   +PY  A      ++    IL++V 
Sbjct  447  GTSLWMAPEVMLGERYDDKADMFSFGVLLSELDVHVLPYSHAKDNGNFQIADAVILQKVA  506

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             GT+R  FS      +  +G +C+SLDP  RPT+ E + +L
Sbjct  507  LGTLRVEFSSSSLESMVDLGLSCVSLDPKQRPTSAEALYRL  547

>PHYCA_547243
Length=367

 Score = 187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/285 (37%), Positives = 154/285 (54%), Gaps = 38/285 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
             L D + +   RIP D I    +IS+G  GEV+   +N    AVK++L   ++    V  
Sbjct  75   NLWDDDAITTARIPKDKIDVGPLISRGGFGEVYKGTYNGLTVAVKKMLPAHRKNVAHVNN  134

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-------------  339
            F  E++L ASL H  IVQF+GVAW+SL ++  V E++  G L+  L              
Sbjct  135  FLAEVKLMASLDHSCIVQFVGVAWDSLSDVCAVTEFMDAGDLRGLLTTYHDENHPVGFDN  194

Query  340  -------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                               EP    R+  S N+LLT  +  K+ DFGVSR   D +MTAG
Sbjct  195  DKVTIAMHVAHALTYLHSLEPVVIHRDLKSRNILLTSDLSAKLTDFGVSRERADCTMTAG  254

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT--KLKPVQILK  434
            VGT  W APE+L G  Y +KAD++SFGVVLSELD   +PY  A    G+  +++ + +L+
Sbjct  255  VGTSLWMAPEVLMGERYDDKADVFSFGVVLSELDLQVLPYAHATESSGSGRRMRDLAVLQ  314

Query  435  EVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             + +G +R  FS +    +  +G AC+SL+PS RP+A E++ +L+
Sbjct  315  RMATGKLRVQFSPDATASMVELGLACVSLNPSDRPSAAEVLYKLQ  359

>SDRG_00886
Length=494

 Score = 191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 144/271 (53%), Gaps = 32/271 (12%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L+  R+    I   R +++GA GEV +  +     A+KRLL    Q  + V+KF  E +L
Sbjct  217  LDMHRVDIGDITIMRTLAQGAYGEVLLGRYQGAVVAIKRLLP-TTQTRDDVEKFIREAQL  275

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP------------------  341
             A L    I  F+GVAW     L+++ E+L  G L+  LE                    
Sbjct  276  VARLDSTYIAAFVGVAWTKPQELLLMTEFLPRGDLRSLLEADANLPWPAKLRIAHDIAEG  335

Query  342  -------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEIL  388
                         R+  S NVLLTD +  K+ DFG+SR L D +MTAG+GT  W APE+L
Sbjct  336  LVYLHMLEHKVLHRDLKSRNVLLTDDLHAKLTDFGISRELDDATMTAGIGTYRWMAPEVL  395

Query  389  EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDE  448
            +  HY E ADMYSFGV+LSELD+ ++PY D VT  G  L    I+ +VM G +RP+FSD 
Sbjct  396  QDGHYDESADMYSFGVILSELDSHKLPYSDVVTSTGRPLTDTAIMAKVMLGQLRPTFSDV  455

Query  449  CPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             P  +R +G  CLS DP  RP A E   +++
Sbjct  456  SPSWLRELGIRCLSEDPYLRPRAAEAAYKIQ  486

>PPTG_06851
Length=278

 Score = 184 bits (468),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 145/266 (55%), Gaps = 38/266 (14%)

Query  252  FERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQF  311
             + +IS+G  GEV+   FN    AVKR+L   ++    V  F  E++L ASL H  IVQF
Sbjct  1    MDNLISQGGYGEVYKGTFNGLSVAVKRMLPAHRKSVAHVNNFLAEVKLMASLDHSRIVQF  60

Query  312  IGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------------------------  340
            +GVAW++L ++  ++E++  G L+  L                                 
Sbjct  61   VGVAWDALSDVCAIIEFMDGGDLRGLLTSYHNHHHPVGFDCDKVKIALHVAHALTYLHSL  120

Query  341  -----PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTE  395
                  R+  S N+LLT  ++ K+ DFGVSR  VD +MTAGVGT  W APE+L G  Y +
Sbjct  121  SPVVIHRDLKSRNILLTSDLDAKLTDFGVSRERVDHTMTAGVGTSLWMAPEVLMGERYDD  180

Query  396  KADMYSFGVVLSELDTGQVPYHDAVTEDGT--KLKPVQILKEVMSGTMRPSFSDECPPRI  453
            KAD++SFGVVLSELD   +PY  A   DG+  +++ + IL+ +  G +R  FS +    +
Sbjct  181  KADIFSFGVVLSELDLQVLPYSHATDSDGSGHRMRDLAILQRMAMGKLRVQFSCDALASM  240

Query  454  RRIGTACLSLDPSSRPTAHELVRQLE  479
              +G AC+SL P  RPTA E++ +L+
Sbjct  241  VDLGNACVSLAPKDRPTAAEVLYRLQ  266

>PHYSO_472133
Length=588

 Score = 192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 161/298 (54%), Gaps = 43/298 (14%)

Query  221  QSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLL  280
             S Y  ++G    L + E +   R+P + +V + +IS+G  GEV+   FN +  AVK LL
Sbjct  288  HSTYVAQSG----LWEDEVIITARVPREKVVLKELISRGGYGEVYAGLFNDEPVAVKMLL  343

Query  281  QRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE  340
               ++    +  F  E++L A+L H  IVQF+GVAW+SL++L ++ EY+  G L+  L+ 
Sbjct  344  PEMRKSISHLNAFLAEVKLMATLNHERIVQFVGVAWDSLNDLCVLSEYMEGGDLRTLLKN  403

Query  341  ------------------------------------PREFMSSNVLLTDSIEPKIIDFGV  364
                                                 R+  S N+LLT  +E K+ DFGV
Sbjct  404  CENHNTPVGFDKSKATIALHVAHALTYLHSLSPPVLHRDLKSKNILLTAQLEAKLTDFGV  463

Query  365  SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY---HDAVT  421
            SR   D +MT GVG+  W APE++ G  Y +KADM+SFGVVL+ELD   +PY    D+ +
Sbjct  464  SRERADYTMTGGVGSSRWMAPEVMMGERYDDKADMFSFGVVLAELDQHALPYANAKDSNS  523

Query  422  EDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + G  +  + IL+ V +G +R  FS   P  IR +G AC+++DP+ RP+A + + +L 
Sbjct  524  DSGRAMPDLAILQMVATGRLRIEFSSAAPKAIRELGMACVAIDPNDRPSASDALYKLH  581

>PPTG_11455
Length=602

 Score = 192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 162/294 (55%), Gaps = 41/294 (14%)

Query  227  RAGSNKT-LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQ  285
            RA   +T L D + +   R+P + +    +IS GA GEV+   +N ++ AVK LL   ++
Sbjct  301  RADQGQTGLWDDDIITANRLPREKVRILTLISHGAFGEVYAGIYNNEQVAVKMLLPSTRR  360

Query  286  KAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE------  339
              + V  F +E +LTA++ HP IV FIG+AW+SL +L +V+E++  G L+  L       
Sbjct  361  DMKLVNGFLIEAKLTATMDHPRIVTFIGIAWDSLSDLCVVMEFMEGGDLRTLLTNYKQKQ  420

Query  340  --------------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                      EP    R+  S N+LL D  E K+ DFG+SR  +
Sbjct  421  HPVGFDREKVTIALHVCHALTYLHSLEPPLIHRDLKSRNILLNDMHEAKLTDFGISRERL  480

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGT  425
            D +MTAG GT  W APE++ G HY  KAD++SFGVVLSELDT  +PY  A  E     G 
Sbjct  481  DRTMTAGAGTSLWMAPEVMTGEHYDTKADIFSFGVVLSELDTHTLPYAQARQEMQLSHGR  540

Query  426  KLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++    +L++V  G +   FSD  P  +  +G AC+S+DP+ RP+A E++ +L+
Sbjct  541  QMTDATLLQKVAMGNVTVEFSDVGPKSLTDLGCACISVDPTLRPSAAEVLFKLQ  594

>PYVX_22303
Length=549

 Score = 191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 156/284 (55%), Gaps = 38/284 (13%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + E +   RIP + +V E ++S+G  GEV+   +N Q  A+K LL   ++  + V  F
Sbjct  259  LWEDEAIISSRIPREKVVIEMLLSRGGYGEVYKGTYNGQDVAIKMLLPENRRSLKHVNAF  318

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL---------------  338
              E ++ A+L H  IVQFIGVAW+SL++L ++ EY+  G L+ +L               
Sbjct  319  LTETKMIAALDHMRIVQFIGVAWDSLNDLCVLSEYMEGGDLRAWLAYFEETKQLQGFDHD  378

Query  339  ------------------EEP---REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              E+P   R+  S NVLL   ++ K+ DFG+SR   D +MTAGV
Sbjct  379  KVKIALHIAHALTYLHTLEQPIIHRDLKSKNVLLNSVLDAKLTDFGISREREDRTMTAGV  438

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILKE  435
            GT  W APE++ G+ Y  KADM+SFGV+LSELD   +PY  A   +  G K+    IL+ 
Sbjct  439  GTSLWMAPEVMMGDKYDVKADMFSFGVMLSELDLHSLPYAHAKENSNTGRKMPDAAILQM  498

Query  436  VMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            V  GT+R SFS    P +  +G AC+S DP  RPT+ E + +L+
Sbjct  499  VAMGTLRVSFSPGALPAMVELGLACVSTDPKDRPTSAEALYKLQ  542

>HYAP_01725
Length=379

 Score = 186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 151/274 (55%), Gaps = 38/274 (14%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RIP D +  ++++S+G  G V+   +N ++ AVK LL   ++    V     E+++ AS+
Sbjct  88   RIPRDKVTVDQLLSRGGFGVVYSGLYNGRRVAVKMLLPETRRNISHVINLLAEVKMMASM  147

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------------------  340
             HP+IV+FIGVAW+SL N+ +V E+++ G LK  L +                       
Sbjct  148  EHPHIVEFIGVAWDSLTNMCVVSEFMAGGDLKALLSDYDEQKHPMGFSRDKLRIALHIAH  207

Query  341  -------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S NVLL + +E K+ DFG SR  V+ SMT GVGT  W APE+
Sbjct  208  ALMYLHSLDPPIIHRDLKSKNVLLNEKLEAKLTDFGTSRERVNESMTGGVGTCLWMAPEV  267

Query  388  LEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILKEVMSGTMRPSF  445
            + G+ Y +KADM+SFGVVLSELDT   PY  A   T+    +    IL+ V +G +R  F
Sbjct  268  MIGDRYDDKADMFSFGVVLSELDTHAFPYWQARDPTDSSRPMPEPAILQMVATGKLRVQF  327

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            S +    +  +GTAC+SLDP +RPTA E + +L 
Sbjct  328  SKQACKAVVELGTACVSLDPKARPTASEALYKLH  361

>PITG_17252
Length=587

 Score = 191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 189/370 (51%), Gaps = 44/370 (12%)

Query  153  LIPVILGVAIAVAGMALGWLS-CRRKLEASMKQKSGIEHerrsqrssgs-sqerrAISIS  210
            +  +++G    VA +A       RR+ + ++ + SGI     S     +      AI++ 
Sbjct  210  ITAIVVGSVACVAFLAFATFKYVRRRYDDNLSKDSGIAALAASYAGYPTPESALNAITLG  269

Query  211  SPQQRRDSAIQSLYCERAGSNKT----LLDSEHLEGKRIPFDSIVFERVISKGASGEVWV  266
            S       +I+     R+  N +    L + E +   R+P + ++ + +IS+G  GEV+ 
Sbjct  270  SEASYSQGSIEDEAKPRSRRNLSGISGLWEDEIIITARVPREKVIVQDLISRGGYGEVYS  329

Query  267  CEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVL  326
              FN +  A+K LL   ++    +  F  E++L ASL H  IVQF+GVAW+SL +L ++ 
Sbjct  330  GMFNDEPVAIKMLLPEMRKSISHLNAFLAEVKLMASLNHERIVQFVGVAWDSLTDLCVLS  389

Query  327  EYLSTGSLKEFLEE------PREF------------------------------MSSNVL  350
            E++  G L+  L+       PR F                               S N+L
Sbjct  390  EFMEGGDLRTLLKNCEEHKTPRGFDRSKATIALHVAHALTYLHSLSPPVLHRDLKSKNIL  449

Query  351  LTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELD  410
            LT  ++ K+ DFGVSR   D +MT GVG+  W APE++ G  Y +KADM+SFGVVL+ELD
Sbjct  450  LTSQLDAKLTDFGVSRERSDHTMTGGVGSSRWMAPEVMMGERYDDKADMFSFGVVLAELD  509

Query  411  TGQVPYHDAV--TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSR  468
               +PY +A   ++ G  +  + IL+ V +G +R  FS   P  I+ +G AC+S+DP +R
Sbjct  510  QHLLPYANAKENSDSGRAMPDLAILQMVATGKLRIEFSSAAPKAIKELGMACVSIDPKNR  569

Query  469  PTAHELVRQL  478
            PTA E + +L
Sbjct  570  PTASEALYKL  579

>PHYRA_83084
Length=494

 Score = 189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/308 (36%), Positives = 162/308 (53%), Gaps = 39/308 (13%)

Query  210  SSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEF  269
            +SP  R+ +A Q  +  R  S   L   + +   RIP + I    +IS+G  GEV+   F
Sbjct  181  TSPATRQGTAPQGGH-HRPRSKVGLWTDDGITTARIPRERIEVGELISRGGYGEVYKGVF  239

Query  270  NRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYL  329
            N    AVK++L   ++    V  F  E++L ASL HP IVQF+GVAWN+L ++  V EY+
Sbjct  240  NGLVVAVKKMLPANRKSVPHVNNFLAEVKLMASLDHPCIVQFVGVAWNALSDICAVTEYM  299

Query  330  STGSLKEFLEE------------------------------------PREFMSSNVLLTD  353
              G L+  L                                       R+  S N+LLT 
Sbjct  300  EGGDLRGLLASYNDQQYPTGFDNDKVKIALHTAHALTYLHSMKPVVIHRDLKSRNILLTS  359

Query  354  SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
             ++ K+ DFGVSR   D +MTAGVGT  W APE+L G  Y +KAD++SFGVVLSELD   
Sbjct  360  DLDAKLTDFGVSRERADHTMTAGVGTSLWMAPEVLMGERYDDKADIFSFGVVLSELDMHV  419

Query  414  VPYHDAVTEDGT--KLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTA  471
            +PY  A   DG+  +++ + IL+ + +G +R  FS      +  +G  C+S++P  RPTA
Sbjct  420  LPYSHATESDGSGRRMRDLAILQRMATGKLRVQFSPGAMHSMVALGNECVSVNPKDRPTA  479

Query  472  HELVRQLE  479
             +++ +L+
Sbjct  480  AQVLYKLQ  487

>PHYCA_122693
Length=562

 Score = 191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 120/365 (33%), Positives = 184/365 (50%), Gaps = 64/365 (18%)

Query  156  VILGVAIAVAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssgssqerrAISISSPQQR  215
            +ILG  + +  + +G   C+RK    +KQ    E                  S +S Q R
Sbjct  213  LILGGVLTLLFIGVGICCCKRKTH--VKQTEAPES-----------------STTSIQTR  253

Query  216  RDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAA  275
               ++      + G    L + + +  KRIP D +  ++++S+GA GEV+   FN    A
Sbjct  254  GTGSLNVAVHGQVG----LWNDDVITAKRIPRDKVRVKKLLSRGAFGEVYEGVFNGNLVA  309

Query  276  VKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLK  335
            VK L+   +   + V  F  E +LTA++ HPNIV F+GVAW++L ++ +V+E++  G L+
Sbjct  310  VKMLVPHTRGDLKHVNDFLAEAKLTATMDHPNIVSFVGVAWDALSDICVVMEFMENGDLR  369

Query  336  EFLEE------------------------------------PREFMSSNVLLTDSIEPKI  359
            E L +                                     R+  S N+LL +++E K+
Sbjct  370  ELLTKYEENHHPVGFDHQKTSIALQVCHALTYLHSLLPPVIHRDLKSRNILLNNAMEAKL  429

Query  360  IDFGVSRGL-VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHD  418
             DFG+S+    + +MTAGVGT  W APE++ G  Y  KADM+SFGVVLSELD   +PY  
Sbjct  430  TDFGISKETRSEQTMTAGVGTSLWMAPEVMLGERYDVKADMFSFGVVLSELDLHTLPYAQ  489

Query  419  AVTE----DGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHEL  474
            A  +    +G KL    IL++V  G ++  FS   P  I  +G AC+SL+P  RPTA E 
Sbjct  490  AKEQVRDSNGRKLPDAAILQQVAMGILKVEFSQSTPAGIVELGLACVSLNPRDRPTAAEA  549

Query  475  VRQLE  479
            + +L+
Sbjct  550  LYRLQ  554

>PHYRA_77819
Length=557

 Score = 191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 157/286 (55%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +  KRIP D +V +++IS G+ GEV+   FN +K AVK LL       + V  F
Sbjct  263  LWDDDVITAKRIPRDKVVTDKLISTGSFGEVYAGVFNGKKVAVKMLLSTISGNIQHVNDF  322

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++ A++ HP+IV FIGVAW+SL ++ +VLE++  G L+  L               
Sbjct  323  LGEAKMNATMDHPHIVSFIGVAWDSLSDICVVLEFMDGGELRAMLSACEKTNLPVGFDRQ  382

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL      K+ DFG+SR  +D +MTAGV
Sbjct  383  KITIALQVCHALTYLHSLTPPIIHRDLKSRNILLDSEWNAKLSDFGMSRERLDRTMTAGV  442

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY----HDAVTEDGTKLKPVQIL  433
            GT  W APE++ G  Y +KADM+SFGVV+SELD   +PY     D +  +G ++    +L
Sbjct  443  GTSLWMAPEVMLGERYDDKADMFSFGVVMSELDVHTMPYAQAKKDNLDSNGREMSDSSLL  502

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V+ G+++  FS+E P  +  +G AC ++DP+ RP+A E + +L+
Sbjct  503  QRVVLGSVQVEFSEESPRSVVELGRACTAMDPTERPSAAEALYRLQ  548

>H310_07124
Length=646

 Score = 192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 151/493 (31%), Positives = 230/493 (47%), Gaps = 67/493 (14%)

Query  45   MLNVSRWDPT-MTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECPLDEG  103
            ML     DPT   P+ RL  H   QD  +       H +         +  W ECP D  
Sbjct  156  MLAQDATDPTTFIPAPRLYKH---QDPTQGWTHPAIHFFQKTAQGTSGEAGWGECPKDAA  212

Query  104  YASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLL----------  153
            + +L +PC  +  F+    +ANT +P  S+ + +WL QEF ++ +PS             
Sbjct  213  HQALIIPCETKF-FSAK--SANTFIPLMSSVMNSWL-QEF-KDANPSITPDPTPSPPPPE  267

Query  154  -IPVILGVAIAVAGMALGWLSC---------RRKLEASMKQKSGIEHerrsqrssgssqe  203
             + +I+GVA  V G+ +  L C          R L  +   ++G  H   +     +   
Sbjct  268  NVGLIVGVAGGVFGLVVAILICLLWWRRRQRHRNLHTACAVEAGNGHSTGTYDHLSTPHY  327

Query  204  rrAISISSPQQRRDSAIQSLYCERAG--SNKTLLDSEHLEG---KRIPFDSIVFERVISK  258
             R+ S S+   R  +   S    R    ++   LD  +L G    RI  D ++ +R +  
Sbjct  328  PRSGSTSTKTARNATMNTSSEGHRHHHRASSIALDGINLSGISLYRIDEDDVIIQRPLGS  387

Query  259  GASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNS  318
            GA  +V + E+  ++ AVKRLL   +  A  VQ    EI L A    P +V+F+G  WN 
Sbjct  388  GAFADVMLGEYKGREVAVKRLLP-GRATAREVQGLIDEIVLLAGFSSPYVVEFVGAMWNK  446

Query  319  LDNLVMVLEYLSTGSLKEFL--EEPREF-----------------------------MSS  347
              +L  V+E++  G L+++L  + P EF                              S 
Sbjct  447  PIDLACVIEFMDLGDLRDYLTYQSPAEFPWQEKLNCIYNIVEGLVYLHSFPIIHRDLKSR  506

Query  348  NVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLS  407
            NVLL  +   K+ DFGVSR     +MT GVGT  W APEIL+ NHYT  AD++SFG++LS
Sbjct  507  NVLLDSTNGTKLTDFGVSREQSQDTMTNGVGTGRWMAPEILKYNHYTVAADIFSFGMILS  566

Query  408  ELDTGQVPYHDAVTE-DGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPS  466
            E  T Q+PY D V   DG  L    I+  V+S  ++P+F+D+ PP ++ +   C++ +P+
Sbjct  567  EFSTHQLPYSDRVNPYDGKPLIDTAIMAMVISDQIKPTFADDMPPFLKDMAMQCIAHEPT  626

Query  467  SRPTAHELVRQLE  479
            +RP+A  L   L 
Sbjct  627  ARPSAAMLSYSLR  639

>PHYCA_105110
Length=327

 Score = 184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 108/317 (34%), Positives = 162/317 (51%), Gaps = 60/317 (19%)

Query  212  PQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNR  271
            P   RD+ + S           L +   L+   IPF  + F  +IS+G   EVW+C    
Sbjct  8    PDAERDAPVLS----------ALANDARLKHVHIPFGLLQFHHLISRGTRTEVWLCVLRD  57

Query  272  QKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLST  331
            +  AVKRL + + +  E ++ F   I L A L HP+I+ FIGVAWNSL NL +V EYL  
Sbjct  58   RCVAVKRLPKEESRNVEEIRTFVKTIRLVAPLQHPSILTFIGVAWNSLQNLCLVTEYLEL  117

Query  332  GSLKEFL----------EEPREFMS-----------------------------------  346
            G L+E+L          E   +FMS                                   
Sbjct  118  GDLQEYLHQSNPNREQVEAYEDFMSFSMSWKREKMQILLDITRGLAYLHQNRIIHGDLKA  177

Query  347  SNVLLTDSIEPKIIDFG----VSRGLVDLSM-TAGVGTPFWTAPEILEGNHYTEKADMYS  401
             NVLL+  ++ K+  FG     +  ++D S  T  + +PFWTAPE+L G  ++++AD+YS
Sbjct  178  KNVLLSADLDAKLAGFGSMSDFTGNVLDKSQNTLRLNSPFWTAPEVLMGGAHSDEADIYS  237

Query  402  FGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACL  461
             GVV+ ELDT Q PY + +T  G+++ P+QIL+ +MSG ++P+ S  CP  I+ +   CL
Sbjct  238  LGVVIMELDTHQSPYANTMTARGSRMPPLQILQHIMSGHLKPTLSPNCPGEIKELAEWCL  297

Query  462  SLDPSSRPTAHELVRQL  478
              DP+ RP+   +V+ +
Sbjct  298  QRDPNLRPSPSNVVQAI  314

>PHYSO_418557
Length=415

 Score = 187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 147/280 (53%), Gaps = 37/280 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L+  RIP D I  + ++++G  G+V++  +N +  AVK LL    +    +     
Sbjct  122  DDPVLQNARIPLDKIRIQELLARGGFGQVFLGSYNGETVAVKTLLPETAEDMVEINALFA  181

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE----------------  339
            E ++ A L HP IV+FIG+ W +L ++  V EYL  G L+  L                 
Sbjct  182  ETKVMAKLEHPCIVRFIGIGWETLSSICCVTEYLVGGDLRALLNHFLTNHTRPRGYDHDK  241

Query  340  -----------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVG  378
                             +P    R+  S NVLL   +  K+ DFGVSR   +  MT  VG
Sbjct  242  VKIALDVAHGLAYLHSMQPNILHRDLKSRNVLLNSQLNAKLTDFGVSREQSEDQMTNAVG  301

Query  379  TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMS  438
            T  W APE++ G HY  KAD+YSFG++LSELDT  +PY +A  E+G KL    I+++V +
Sbjct  302  TSLWMAPEVMMGGHYDSKADVYSFGIMLSELDTHLMPYANAKKENGRKLTDTMIMRKVAA  361

Query  439  GTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            G ++  FS ECP  I  +  AC+S+DP  RPTA + +R+L
Sbjct  362  GELQVEFSRECPVDILTLAHACISVDPKQRPTAIDAMRKL  401

>PPTG_10354
Length=531

 Score = 189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 154/277 (56%), Gaps = 40/277 (14%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            KR+  D IV +++ISKGA GEV+   FN +K AVK LL   ++K   V +F  E ++TA+
Sbjct  248  KRVSRDEIVPQQLISKGAFGEVYAGVFNGRKVAVKMLLPASREKLHRVNEFLAEAKMTAT  307

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----------------------  340
            + H +IV FIGVAW+SL +L +VLEY+  G L+  L +                      
Sbjct  308  MDHAHIVSFIGVAWDSLSDLCVVLEYMDGGELRTLLNKYEADDHPSGFDRQKLTIALHVC  367

Query  341  --------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPE  386
                           R+  S N+LL   +  K+ DFG+SR  +D +MTAGVGT  W APE
Sbjct  368  HALSYLHSMIPSIIHRDLKSRNILLDREMNAKLSDFGISRERLDRTMTAGVGTSLWMAPE  427

Query  387  ILEGNHYTEKADMYSFGVVLSELDTGQVPY----HDAVTEDGTKLKPVQILKEVMSGTMR  442
            ++ G  Y +K DM+SFGVVLSELD    PY     + +  +G ++    +L++V  G ++
Sbjct  428  VMLGERYGDKVDMFSFGVVLSELDVHTRPYARVKKENLDSNGREMTDSVLLQKVALGQIQ  487

Query  443  PSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              FS   P  +  +G AC+S+DP+ RP+A E + +L+
Sbjct  488  VEFSKTSPKAVVELGQACISIDPTQRPSAAEALYRLQ  524

>HYAP_05661
Length=698

 Score = 192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 152/278 (55%), Gaps = 36/278 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   R+    +   +++S+G  GEVW+  +  +  A+KRLL  KK   +++  FA 
Sbjct  414  DDPDLLAVRVEHRDVEAIKLLSRGGFGEVWLGLYMNENVAIKRLLSDKKTMQDAL-AFAT  472

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-------------  342
            EI++ A L HP IV FIGV+W +   +  V E++  G LK  L+  R             
Sbjct  473  EIKVMARLEHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQI  532

Query  343  ---------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTP  380
                                 +  S NVL+      K+ DFG+SR    D +MTAGVGT 
Sbjct  533  AIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTA  592

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V +G 
Sbjct  593  RWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGK  652

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++PSF++ CP  I R+  ACLS DP+ RP+A  +  +L
Sbjct  653  LQPSFNESCPSSIVRLARACLSFDPAQRPSAIHISYEL  690

>PHYCA_126097
Length=380

 Score = 186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/278 (37%), Positives = 151/278 (54%), Gaps = 40/278 (14%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            KRIP D +  ++++S+GA GEV+   +NRQ+ AVK LL   +   + V  F  E +LTA+
Sbjct  96   KRIPRDKVKVKKLLSRGAYGEVYKGVYNRQEVAVKVLLPSTRGNLQHVNDFLAEAKLTAT  155

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE----------------------  340
            + HP+IV FIGVAW+SL ++ +VLE++  G L+  L                        
Sbjct  156  MDHPHIVTFIGVAWDSLSDMCVVLEFMDGGDLRTLLNSYEATKRPVGFNKQKATIALHVC  215

Query  341  --------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPE  386
                           R+  S NVLL  ++E K+ DFGVS+  +D  MT GVGT  W APE
Sbjct  216  EALTYLHSLMPPVIHRDLKSRNVLLNRNLEAKLTDFGVSKERLDQPMTIGVGTSLWMAPE  275

Query  387  ILEGNHYTEKADMYSFGVVLSELDTGQVPY----HDAVTEDGTKLKPVQILKEVMSGTMR  442
            ++ G  Y  KAD++S GV+LSELD   +PY      ++   G K+    + ++V +G ++
Sbjct  276  VMMGQKYDVKADIFSLGVMLSELDVHTLPYTQVKERSLASTGRKMADATLFQKVTAGEVQ  335

Query  443  PSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
              FSD  P  +  +G AC+S+DP  RPTA E   +L+ 
Sbjct  336  VEFSDSIPRSLLELGLACVSVDPLHRPTAAEAQYRLQA  373

>PHYRA_93564
Length=316

 Score = 184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 153/286 (53%), Gaps = 38/286 (13%)

Query  231  NKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESV  290
            + +L D   +   RIP D I    ++S+G  GEV+   +  Q  AVK LL   ++    +
Sbjct  18   SSSLWDDPVIVAARIPVDRIELGELLSRGGFGEVYRGRYRDQNVAVKTLLPSTRKDMNHI  77

Query  291  QKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL------EEPREF  344
            + F  EI+L A++ HP IVQFIGVAW SL  L  + E++  G L+  L        PR F
Sbjct  78   EAFLAEIKLMATMEHPQIVQFIGVAWESLSELYALSEFMEGGDLRSLLVTYYESGHPRGF  137

Query  345  ------------------------------MSSNVLLTDSIEPKIIDFGVSRGLVDLSMT  374
                                           S N+LLT++++ KI DFG SR   D +MT
Sbjct  138  DPVKVKMALQTAHALTYLHSLDPVVLHRDLKSRNILLTETLDTKITDFGASRERSDKTMT  197

Query  375  AGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQI  432
            AGVGT FW APE++ G  Y EKAD++SFGVVLSELDT ++PY  A   +E G  L    +
Sbjct  198  AGVGTSFWMAPEVVMGERYGEKADVFSFGVVLSELDTHELPYSHAKENSETGRPLPDTAV  257

Query  433  LKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            L+ V+ G ++ SFS      + ++   CL ++P +RPTA E++ +L
Sbjct  258  LQLVLMGRLQVSFSGVGLVEMTQLAQQCLQIEPENRPTAAEVLYRL  303

>PPTG_07736
Length=431

 Score = 187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/284 (38%), Positives = 151/284 (53%), Gaps = 38/284 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            +L D   +   RIPFD +    ++S+G  GEV+   +  Q  AVK LL   ++    ++ 
Sbjct  135  SLWDDPVIVAARIPFDRVELGELLSRGGFGEVYRGRYRDQNVAVKTLLPSTRKDMNHIEA  194

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-----------EP  341
            F  EI+L A++ HP IVQFIGVAW SL  L  + E++  G L+  L            EP
Sbjct  195  FLAEIKLMATMEHPQIVQFIGVAWESLSELYAISEFMEGGDLRTLLVKHYENGHPRGFEP  254

Query  342  -------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                                     R+  S N+LLT+S++ KI DFG SR   D +MTAG
Sbjct  255  AKIKMALQVAHALTYLHSLDPIVLHRDLKSRNILLTESLDAKITDFGASRERSDKTMTAG  314

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPVQILK  434
            VGT FW APE++ G  Y EKAD++SFGVVLSELDT ++PY  A   +E    L    +L+
Sbjct  315  VGTSFWMAPEVVMGERYGEKADVFSFGVVLSELDTHELPYSHAKENSETSRPLPDTAVLQ  374

Query  435  EVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
             V+ G ++  FS   P  +  +   CL ++P  RPTA E++ +L
Sbjct  375  LVLMGRLQVQFSGVGPIEMTELARQCLQIEPQDRPTAAEVLYRL  418

>PHALS_05836
Length=732

 Score = 193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 161/306 (53%), Gaps = 44/306 (14%)

Query  214  QRRD-SAIQSLYC----ERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCE  268
            QR+D  AI+  Y       +  N  L++   +   RIPF  I   + I+KG  G V+   
Sbjct  395  QRKDRDAIEIDYTLSFESNSSPNTNLINDPRIIAHRIPFTDIKIVKCINKGGFGLVYSGL  454

Query  269  FNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEY  328
            +NR + A+KR+        + ++ F  EI L ++L HP+IV FIGVAW++L NL  V EY
Sbjct  455  YNRHRVAIKRIRTDLCLDMKHIEAFIKEISLMSTLNHPHIVTFIGVAWDTLQNLSAVTEY  514

Query  329  LSTGSLKEFLE--------------------------------EP----REFMSSNVLLT  352
            +  G L+  L+                                EP    R+  S N+LL 
Sbjct  515  MELGDLRAVLQNIHRAPSSLTWKKHKLRLVQHIAEALMYLHSLEPKLIHRDLKSKNILLN  574

Query  353  DSIEPKIIDFGV--SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELD  410
              +E K+ DFGV   R L++  MTAG+GT FW APE+L G  Y E+AD+YS G+VLSE+D
Sbjct  575  TKMEAKLSDFGVCRERHLIETHMTAGIGTSFWIAPEVLLGKDYDERADIYSLGIVLSEID  634

Query  411  TGQVPYHDAVT-EDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRP  469
            T   PY +A     G K   + IL+ V +G + P F++ CP  + R+  ACLSL+P  RP
Sbjct  635  TEDYPYWNAKNPPKGGKAMEIAILRMVAAGELIPEFTESCPQEVLRLAKACLSLNPDDRP  694

Query  470  TAHELV  475
            +A E+V
Sbjct  695  SAMEVV  700

>SDRG_07620
Length=492

 Score = 188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/279 (37%), Positives = 151/279 (54%), Gaps = 35/279 (13%)

Query  229  GSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAE  288
            G++ + LD   L+  RI    +  ++ +++GA GEVW+   +    AVK+LL  ++ + E
Sbjct  199  GADASTLDLCDLDLYRISPRDVTLDKSLAQGAYGEVWLGTLDGHTVAVKKLLNHRRTRDE  258

Query  289  SVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE---------  339
             +QKF  EI L A +    +VQFIGVAW    ++++V EY+  G L+  L+         
Sbjct  259  -LQKFIYEIALVAKMESRYVVQFIGVAWTRPSDMMLVTEYMDAGDLRNLLQVTASTKSFT  317

Query  340  ---------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMT  374
                                 EP    R+  S NVLL   ++ K+ DFGVSR   D +MT
Sbjct  318  WTKKVHVAHQIAEGLVYLHMLEPKVIHRDLKSRNVLLNAKMDAKLTDFGVSRETDDATMT  377

Query  375  AGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILK  434
            AG+GT  W APE+L+  HYTE AD++SFGV+L+EL    VPY D    +G       I+ 
Sbjct  378  AGIGTYRWMAPEVLQDGHYTESADVFSFGVILAELSNEIVPYSDLRNANGNPYTDTAIMA  437

Query  435  EVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHE  473
            +VM G ++P+F+ +CPP  R +G  C+S   + RPTA E
Sbjct  438  KVMVGELQPTFAPDCPPWFRDLGLQCMSRHHADRPTAME  476

>PHYKE_9600
Length=333

 Score = 184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 152/283 (54%), Gaps = 43/283 (15%)

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            LE  RIP D +    +IS+GA GEV    +  Q  A+K LL  K++  + +Q F  E+ L
Sbjct  43   LENARIPVDHVEMGAIISRGAFGEVHRGLYRGQDVAIKTLLPEKRKDLQYIQAFLSEVRL  102

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------------  339
             A++ HP IVQFIGVAW SL +L  V E+++ G L+  L+                    
Sbjct  103  MATMEHPYIVQFIGVAWESLSDLYCVSEFMAGGDLRSLLKDYLATGVPQGMDATKMQITY  162

Query  340  ------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWT  383
                        EP    R+  S N+LLT S++ KI DFG SR   D +MTAGVG+  W 
Sbjct  163  HVAYALTYLHSLEPVVLHRDLKSRNILLTPSLDAKITDFGASRIRSDATMTAGVGSSLWM  222

Query  384  APEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA----VTEDGTKLKPV---QILKEV  436
            APE++ GN Y EKAD++S GVV+SELDT ++PY  A    V    +  +P+    +L+ V
Sbjct  223  APEVMMGNRYDEKADVFSLGVVMSELDTHELPYSHAKESNVDSSNSGSRPLPDAAVLQMV  282

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +G +R  FS      + R   +C+ +DP  RPTA E++  L+
Sbjct  283  STGKLRVYFSHYMNSDMARFARSCVEVDPRMRPTAAEVLYYLQ  325

>H257_13799
Length=510

 Score = 188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 157/284 (55%), Gaps = 37/284 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            T LD   ++  R+P   +   + +++GA GEVWV ++   + A+KRLL  K    + VQ+
Sbjct  226  TGLDMCEIDMYRLPTSDVHLVKPLAQGAFGEVWVGDYQGSQIAIKRLLPTKSTLPD-VQR  284

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-------------  339
            F  EI+L + +  P +V FIGVAWN+  +++++ E+++ G L++ LE             
Sbjct  285  FIWEIKLLSKIECPYVVHFIGVAWNTPGDMMLLTEFMNGGDLRQVLELTPTSFQWVHKLR  344

Query  340  ---------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTP  380
                           +P    R+  S NVLL      K+ DFG++R   D +MTAG+GT 
Sbjct  345  CALSVAEGLVYLHLMDPKVIHRDLKSRNVLLDSDFNTKLTDFGIARETDDATMTAGIGTF  404

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE+L   HYTEKAD++SFGV+LSEL T  VPY D   + G       I+ +VM G 
Sbjct  405  RWMAPEVLLDGHYTEKADIFSFGVILSELSTNIVPYSDLRNDKGNAYTDTAIMAKVMMGE  464

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRP----TAHELVRQLEG  480
            + P+F+ +CP     + T CL+LDP  RP    TA+ + RQ+EG
Sbjct  465  LIPTFASDCPRWYLDVATPCLALDPLERPTAMKTAYTIRRQVEG  508

>H257_15918
Length=385

 Score = 185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 155/279 (56%), Gaps = 33/279 (12%)

Query  235  LDSEHLEGKRIPFDSIVFERV--ISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            LD   LE  R+  D  + ER   ++ G  G VW+  FN+Q+ AVK +++ + + + SVQ+
Sbjct  105  LDWHDLEAYRL--DIALVERTTRLATGGFGSVWLGRFNQQQVAVKSMVEGRIRTSGSVQR  162

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----------  341
            F  E+ L A L HPN+V+FIG  W+SLD + +V+EY++ G LK+ L+             
Sbjct  163  FINEVTLMAKLQHPNVVRFIGACWHSLDAVHLVVEYMNLGDLKDHLDIHVAMPWSRKVQC  222

Query  342  ------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWT  383
                              R+  S NVLL      K+ DFG+SR LV  +M+  VGT  W 
Sbjct  223  AHDVAAALVYLHDQNIIHRDLKSRNVLLDTHKPSKLSDFGISRELVSRTMSHEVGTFMWA  282

Query  384  APEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRP  443
            APE+L+G   T  AD+YSFG++LSELDT +VP+    TE G  + P+ ++ ++M G ++ 
Sbjct  283  APEVLKGGQLTVAADIYSFGMLLSELDTHKVPFDGMTTEFGDVMVPMAVVMKIMQGQIKV  342

Query  444  SFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
            + S  CPP I  +   C   DP  RPTA EL+ +L+  D
Sbjct  343  APSSSCPPPIALLLNDCTQFDPMLRPTAVELLHRLQQMD  381

>PYVX_17951
Length=675

 Score = 192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 144/474 (30%), Positives = 223/474 (47%), Gaps = 91/474 (19%)

Query  81   VYVVHTVPHDLDPAWNECPLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLK  140
            + ++   P DL  A N+CP    +    +PC   IE T D    +   P G++F+  W++
Sbjct  211  LIIISQAPMDLLSA-NDCPTTPLF---VMPC---IELTSD--TGDWCQPLGNSFIDLWIE  261

Query  141  QEFAQEDSPSQLLIPVILGVAIAVAGM--------ALGWLS-CRRKLEASMKQKSGIEHe  191
            +E    +  + L    I  + IA            A  +LS CRRK        +  +  
Sbjct  262  KEMPVTEQSTGLSTGTIALITIAAVLTVFFCSMLGAYTYLSQCRRKRWTRRTLYNSADTP  321

Query  192  rrsqrssgssqerrAISISSPQQRRDSAIQSLYCERA--GSNKT------LLDSEHLE--  241
              S+            S+S+ +Q   +  +S+    A  G   T      L D++H+   
Sbjct  322  TASRGVESRD------SLSALEQEFKAPSKSITSRVALLGDAATPAGAVRLSDTDHVSEA  375

Query  242  ------------------GKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRK  283
                               +R+PFDS+ F R+I++GA+GEVW  EF  +  A+K LL  K
Sbjct  376  VLRHSVELQPICTDAQIMARRVPFDSLRFSRLIARGANGEVWQGEFRGRVVAIKSLLPEK  435

Query  284  KQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-  342
            +    +VQ FA EI + ++L+HPNIV+F+G++W  L  L +V E++  G L E L   R 
Sbjct  436  RHDKTAVQTFAHEIRIASALVHPNIVRFLGLSWRQLSELCVVSEFMDGGDLSELLSSERS  495

Query  343  ---------------------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                             +  S NVLL   +  K+ DFG+SR   
Sbjct  496  KQLSWSSDKLSIATDIAEALAYLHSRSPVIIHRDLKSLNVLLNARLRAKLSDFGLSRERS  555

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY--HDAVTEDGTK  426
            ++ +MT+GVGT  WTAPEIL G  Y+EKAD+YS+G+VLSELDT   P+  +D V+    +
Sbjct  556  MEETMTSGVGTLLWTAPEILRGEPYSEKADVYSYGIVLSELDTCLPPFSLNDEVSRQ--R  613

Query  427  LKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            L  +Q++  V    + P F  +CP  I ++  +C + D S RP+A ++V  L  
Sbjct  614  LTTMQLIHLVTCSKLAPEFRSDCPSAITKLALSCAAPDASDRPSALQIVFTLRN  667

>HYAP_01732
Length=372

 Score = 185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/281 (36%), Positives = 146/281 (52%), Gaps = 37/281 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   RIP + I  + +I++G  G+V+   +  Q  AVK LL    +  + +     
Sbjct  79   DDPVLVASRIPLEEIQIKELIARGGFGQVFTATYKGQTVAVKTLLPETAKDMDEINALYA  138

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE---------------  340
            E ++ A L HP IV FIG+AW SL  +  V EYL  G L+  L                 
Sbjct  139  ESKILAKLDHPCIVSFIGIAWGSLSTVCCVTEYLVGGDLRALLNHFLANQTRPQGFDHDK  198

Query  341  ----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVG  378
                                   R+  S NVLLT  ++ K+ DFGVSR   +L MT  VG
Sbjct  199  VKIALNIAQGLAYLHSLTPNMLHRDLKSRNVLLTSQLDAKLTDFGVSRERSELMMTNAVG  258

Query  379  TPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMS  438
            T  W APE++ G+HY  KAD++SFGV+LSELDT  +PY +    +G KL    IL++  +
Sbjct  259  TSLWMAPEVMLGSHYDGKADVFSFGVLLSELDTHLMPYANVRNANGQKLTENGILQKTST  318

Query  439  GTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            G ++  FS +CPP + R+  ACL+++P+ RPTA E + +L+
Sbjct  319  GQLQVEFSRDCPPELLRLAHACLAVNPNDRPTAAEALYKLQ  359

>PHYRA_82847
Length=696

 Score = 192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 150/278 (54%), Gaps = 36/278 (13%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   L   RI    +   +++S+G  GEVW+  F  +  A+KRLL  KK   +++  FA 
Sbjct  412  DDPDLLAARIEHRDVEAIKLLSRGGFGEVWLGLFMNENVAIKRLLNDKKSMQDAL-AFAT  470

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR-------------  342
            EI+  A + HP IV FIGV+W +   +  V E++  G LK  L+  R             
Sbjct  471  EIKTMARMDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQI  530

Query  343  ---------------------EFMSSNVLLTDSIEPKIIDFGVSRGL-VDLSMTAGVGTP  380
                                 +  S NVL+      K+ DFG+SR    D +MTAGVGT 
Sbjct  531  AIDIADALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTA  590

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE++ G HYTE AD+YSFGVVLSELDT + P++DA   +G K++ V IL+ V +G 
Sbjct  591  RWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGK  650

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            ++PSF +  PP I ++  ACLS DP+ RP+A  +  +L
Sbjct  651  LQPSFDESSPPSIVKLARACLSFDPAQRPSAIHISYEL  688

>PPTG_01911
Length=246

 Score = 181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 140/227 (62%), Gaps = 10/227 (4%)

Query  127  TVPAGSAFVTTWLKQEFAQEDSPSQ--LLIPVILGVAIAVAGMALGWLSCRRKLEASMKQ  184
            T P GSA++TTWLK EF  ED   +  LLIPVIL   + VA M +GW   +       +Q
Sbjct  2    TRPTGSAWLTTWLKDEFEVEDLGFEEVLLIPVIL---VVVASMGIGWFCWKWSSLLKREQ  58

Query  185  KSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSL--YCERAGSNKTL---LDSEH  239
             S  + +  S          +A+  +        +I S     E AGSN+TL   L S+H
Sbjct  59   ASSCDFDVVSPNYLDVVTHEQALRRTVTTTSYGPSISSHPDDYESAGSNQTLKILLHSQH  118

Query  240  LEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIEL  299
            L G RIP+DS+VF+  +SKGA GEVW+C +  Q+ AVK+LL  + QKAE VQ FA EIEL
Sbjct  119  LHGNRIPYDSLVFQTELSKGAPGEVWICRYGGQEVAVKKLLHIRDQKAEDVQIFAEEIEL  178

Query  300  TASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMS  346
            TASLIHP+IV+FIGVAWNSL NL MVLEY+  G+L+++L    + +S
Sbjct  179  TASLIHPHIVKFIGVAWNSLSNLSMVLEYVPRGNLRDYLHTNSDILS  225

>SPRG_07855
Length=420

 Score = 186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 153/281 (54%), Gaps = 35/281 (12%)

Query  235  LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFA  294
            +D + L+ K + +  I + R +SKGA GEVW+ ++  +  A+K++L+ +K  A+ ++ F 
Sbjct  131  MDQDLLDAK-VDYSMIQYTRKLSKGAFGEVWLGQYQGRYVAIKQILEERKTDAKEIECFV  189

Query  295  LEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-------------  341
             EI+L A+  HPNIV F+G++WN   NL  + EY+  G L  +L++              
Sbjct  190  AEIKLMANFKHPNIVDFLGLSWNQDANLCALTEYMKNGDLFVYLQKRKATLTWKKDKLAI  249

Query  342  --------------------REFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAGVGTP  380
                                R+  S NVLL ++   K+ DFG+SR   ++ +MTAGVGT 
Sbjct  250  ALDIAQALVYLHALTPKVIHRDLKSKNVLLDENCTAKLSDFGISRLRQLEETMTAGVGTA  309

Query  381  FWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGT  440
             W APE+     Y ++AD+YS GVVLSELDT  +PY D       KL  + ++K V    
Sbjct  310  LWAAPEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAVIKLVTQQK  369

Query  441  MRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGR  481
             +P+FS  CP  +R +   CL  +P +RP+A E+V  L+ R
Sbjct  370  AKPTFSPSCPDVVRDLAFRCLDYEPENRPSAAEVVVLLKDR  410

>PPTG_21832
Length=554

 Score = 189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/291 (36%), Positives = 157/291 (54%), Gaps = 45/291 (15%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +   RIP + +  +++I++G  GEV++  ++ +  AVK LL   K+    V  F
Sbjct  257  LWDDDVIVAARIPREKVKVKQLINRGGFGEVYIGSYHGKDVAVKMLLPETKKTMSQVNAF  316

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E++L ASL HP IV FIGVAW+ L ++ +V EY++ G LK  L +             
Sbjct  317  LSEVKLMASLDHPRIVSFIGVAWDQLIDICVVSEYMAGGDLKALLSDYEKNGHPVGFDHT  376

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL ++++ K+ DFG+SR  +D +MT G+
Sbjct  377  KVKIALHVSIALTYLHSCAPPVIHRDLKSKNILLDEAMDAKVTDFGISRERIDATMTGGI  436

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPY---------HDAVTEDGTKLK  428
            GT FW APE++ G  Y +KADM+SFGVVLSELD+  +PY           + +    KL 
Sbjct  437  GTSFWMAPEVMMGERYDDKADMFSFGVVLSELDSHVMPYALSKSESSTESSSSVKPNKLP  496

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               IL+ V +G +R  FS+  P  +  +G AC+SLDP  RPTA E + +L+
Sbjct  497  NAAILQMVAAGRLRVHFSEAGPQSMVDLGLACVSLDPKERPTAAEALYKLQ  547

>PHYRA_81021
Length=609

 Score = 190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 140/441 (32%), Positives = 199/441 (45%), Gaps = 111/441 (25%)

Query  96   NECPLDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQ----  151
            + CP     A   VPC +     DD +A    VP   ++V  W+  E  Q   PS     
Sbjct  211  DSCP---NRAQFIVPCRK---VGDDEIADTWCVPPIESWVLDWVDNE-TQSIDPSAVTTI  263

Query  152  ---------LLIPVILGVAIA---VAGMALGWLSCRRKLEASMKQKSGIEHerrsqrssg  199
                     L  P I+G+ +A   V  + LG++  R                        
Sbjct  264  QDSSEGNGGLSTPAIVGIIVACIVVILILLGFIVVR------------------------  299

Query  200  ssqerrAISISSPQQRRDSAIQSLYCERAGSNKT-LLDSEHLEGKRIPFDSIVFERVISK  258
                          QRR          RA   +T L D + +   R+P + +  +++IS+
Sbjct  300  --------------QRR---------SRANHGQTGLWDDDIITANRVPREKVRIDQLISR  336

Query  259  GASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNS  318
            GA GEV+   +N Q  A+K LL   ++  + V  F  E  LTA + HP IV  IG+AW+S
Sbjct  337  GAFGEVYNGIYNEQHVAIKMLLPSTRRDIKLVNGFLAEARLTALMDHPRIVSCIGIAWDS  396

Query  319  LDNLVMVLEYLSTGSLKEFLE--------------------------------EP----R  342
            L +L +VLE++  G L+  L                                 EP    R
Sbjct  397  LSDLCVVLEFMEGGDLRTLLNNYERSRYPVGFNREKATIALHVAHALTYMHSLEPPVIHR  456

Query  343  EFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSF  402
            +  S N+LL   +E K+ DFG+SR  +D +MTAGVGT  W APE++ G  Y EKADM+SF
Sbjct  457  DLKSRNILLNHMLEAKLTDFGISRERLDETMTAGVGTSLWMAPEVMRGEKYDEKADMFSF  516

Query  403  GVVLSELDTGQVPYHDAVTE----DGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGT  458
            GVVLSELD   +PY  A  E     G ++    +L+ V  GT+   FSD  P  +  +G 
Sbjct  517  GVVLSELDVHTLPYAQAKQEMQNAHGRQMTDATLLQRVAMGTVGLEFSDAGPLSMIELGR  576

Query  459  ACLSLDPSSRPTAHELVRQLE  479
            AC+S DPS RP+A E + +L+
Sbjct  577  ACVSADPSVRPSAAEALFKLQ  597

>PITG_17831
Length=497

 Score = 187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 151/262 (58%), Gaps = 13/262 (5%)

Query  231  NKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESV  290
            ++ LL+   +   RI +  +   + ISKG  G V+  E+  ++ A+K++   +  +   +
Sbjct  203  DRVLLNDPVIVTNRIEYKHLRLGKCISKGGFGLVFTGEYRGRRVAIKKIRPDRSGEVSEI  262

Query  291  QKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL-----EEP----  341
            + F  EI L A L HP IV+FIGVAW+ + +L  V EY++ G L+E L     + P    
Sbjct  263  ETFLKEIILMAVLYHPRIVEFIGVAWDDIRHLSAVTEYMNKGDLREALAYLHCQRPKVIH  322

Query  342  REFMSSNVLLTDSIEPKIIDFGVS--RGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADM  399
            R+  S NVLL   +E K+ DFG+S  R  ++  MTAGVGT FW APE+L G  Y E+AD+
Sbjct  323  RDLKSKNVLLNLYLEAKLSDFGISRVRYAIETHMTAGVGTSFWIAPEVLCGQDYDERADI  382

Query  400  YSFGVVLSELDTGQVPY--HDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIG  457
            +SFGVVLSE+DT   PY   +   E   K++  +I+  V +G +RP FS  CP  I  I 
Sbjct  383  FSFGVVLSEIDTDDYPYWNDNYPNEPRGKIQEAEIVARVAAGHIRPEFSANCPEEILAIA  442

Query  458  TACLSLDPSSRPTAHELVRQLE  479
             ACL  DP  RPTA ++   ++
Sbjct  443  DACLQRDPRDRPTAADIAAAMQ  464

>PHYSO_534637
Length=570

 Score = 189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/285 (38%), Positives = 156/285 (55%), Gaps = 40/285 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   R+P + ++ + +IS+G  GEV+   FN+++ AVK LL   ++  + V  F
Sbjct  278  LWDDEVIATARVPREKVIVQHIISRGGGGEVYFGLFNQRRVAVKMLLPEVRKSVKHVNAF  337

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL---------------  338
              E++L A+L H  IV+F+GVAW+SL +L +V E++  G L+  L               
Sbjct  338  LAEVKLMATLEHARIVEFVGVAWDSLTDLCVVSEFMEGGDLRALLSVYEQEQHATGFDRS  397

Query  339  ------------------EEP---REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              E P   R+  S NVLLT S+E K+ DFG+SR   D +MTAGV
Sbjct  398  KVTIALHVAHALTYLHSLETPVLHRDLKSKNVLLTSSLEAKLTDFGISRERGDKTMTAGV  457

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV----TEDGTKLKPVQIL  433
            GT  W APE++ G+ Y +KADM+SFGVVLSELD   +PY  A      +   K+    I+
Sbjct  458  GTSRWIAPEVMLGHKYDDKADMFSFGVVLSELDVHVLPYSHAKDCGDIDSDHKVSEAVIM  517

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            + V  G +R  FS      +  +G AC+SLDP+ RPTA E + +L
Sbjct  518  QMVALGKLRIEFSTGSLQSMADLGMACVSLDPTERPTAAEALYRL  562

>PHYCA_503450
Length=452

 Score = 186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 153/287 (53%), Gaps = 40/287 (14%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TL +   +   RIP D I    VIS+G  GEV+   +     AVK LL  K++    +Q 
Sbjct  158  TLWEDPVILASRIPIDRIQLGTVISRGGFGEVYRGRYRDADVAVKTLLPEKRKDLAHIQA  217

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE------------  340
            F LE+ L A++ HP+IVQFIGVAW SL +L  V E+++ G L+  L++            
Sbjct  218  FLLEVRLMATMEHPHIVQFIGVAWESLSDLFCVSEFVAGGDLRSLLKDYLATGVPQGMDA  277

Query  341  ------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                                     R+  S N+LLT+S++ K+ DFG SR   D +MTAG
Sbjct  278  SKMQIAYQVAYALTYLHSLDPVVLHRDLKSRNILLTESLDAKLTDFGASRIRSDTTMTAG  337

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED----GTKLKPVQI  432
            VG+  W APE++ G  Y EKAD++S GVV+SELDT ++PY  A   +    G +L    +
Sbjct  338  VGSSLWMAPEVMMGQRYGEKADVFSLGVVISELDTHELPYSHAKEGNSGSSGHQLPDTAV  397

Query  433  LKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            L+ V  G +R  FS    P + R    C+++DP SRPTA E++  L+
Sbjct  398  LQMVSMGKLRVRFSPFMAPDMARFVGNCVNVDPQSRPTAAEVLYYLQ  444

>PPTG_11276
Length=552

 Score = 189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 153/285 (54%), Gaps = 39/285 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP D ++ +++I++G  GEV+   +N Q+ A+K LL   ++  + V + 
Sbjct  262  LWDDELIATSRIPRDKVLVQQLINRGGYGEVYYGLYNGQRVALKTLLPELRKSIKHVNQL  321

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E+ L A L HP +V F+G+AW+SL +L +VLEY+  G L+  L               
Sbjct  322  LDEVRLLAMLDHPRVVHFVGIAWDSLSDLCIVLEYMEGGDLRALLASYEAQGHDVGFDHT  381

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              +P    R+  S NVLLT  ++ KI DFG+SR   D +MTAGV
Sbjct  382  KVTIALHVAHALTYLHSLDPPVLHRDLKSKNVLLTSDLQAKITDFGISRERADKTMTAGV  441

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA---VTEDGTKLKPVQILK  434
            GT  W APE++ G  Y +KADM+SFGV+LSELD   +PY  A   ++  G K+    IL+
Sbjct  442  GTSLWMAPEVMMGERYDDKADMFSFGVMLSELDLHTLPYSHAKHNLSSSGHKMPDTTILQ  501

Query  435  EVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             V  G +R  FS      +  +  +C++LDP  RPTA E +  L+
Sbjct  502  RVALGKIRVEFSPGALDSMVALANSCVALDPKYRPTAAEALYHLQ  546

>PITG_10780
Length=457

 Score = 186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/275 (38%), Positives = 149/275 (54%), Gaps = 47/275 (17%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RIP + +V    IS+GA G+V+   +N Q  AVK +          V  F  E++L +++
Sbjct  184  RIPREKVVLLEFISRGAFGKVYKGTYNGQFVAVKTM--------SDVDSFVKEVKLASTM  235

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------------------  340
             HPNIVQFIGVAWN  ++   V+EY+  G L+  +++                       
Sbjct  236  SHPNIVQFIGVAWNYREDFCCVMEYMDGGDLRGLMDKYEDENRRTGFDAAKITIALHVAH  295

Query  341  -------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LL +++  K+ DFGVSR  VD +MTA VGT  W APE+
Sbjct  296  ALAYLHSRDVPVIHRDLKSKNILLNEALGAKLTDFGVSRERVDRAMTADVGTSLWMAPEV  355

Query  388  LEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTK--LKPVQILKEVMSGTMRPSF  445
            + GN Y EKADM+SFGVVLSEL    +PY  A    G+K  L P+ IL  V++G +   F
Sbjct  356  MIGNAYDEKADMFSFGVVLSELSMHSLPYSHA-KRPGSKDQLSPLVILHRVVTGALSVEF  414

Query  446  SDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
            ++  P  + R+G AC+S+DP+ RPTA E +R L  
Sbjct  415  AETGPRNMVRLGLACVSMDPTKRPTASEAMRVLHA  449

>PPTG_11454
Length=612

 Score = 190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 159/286 (56%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +   RIP + +   ++IS+GA GEV+   +N  + A+K LL   ++    V +F
Sbjct  319  LWEDDIITANRIPREKVRVLKLISRGAFGEVYAGIYNNDQVAIKMLLPSTRRDIHLVNEF  378

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E +LTAS+ HP IV  IG+AW+SL +L +VLE++  G L+  LE              
Sbjct  379  LAEAKLTASMEHPRIVTCIGIAWDSLSDLCVVLEFMEGGDLRTLLESYKRSSHLVGFDCE  438

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              EP    R+  S N+LL +  E K+ DFG+SR  +D +MTAGV
Sbjct  439  KTTIALHVCHALTYLHSLEPPIIHRDLKSRNILLDEMHEAKLTDFGISRERLDRTMTAGV  498

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELDT  +PY  A  E     G ++    +L
Sbjct  499  GTSLWMAPEVMTGEKYDDKADIFSFGVVLSELDTHSLPYAQARQEMQLSHGRQMTDATLL  558

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V  GT+   FSD  P  +  +G AC+S+DP+ RP+A E + +L+
Sbjct  559  QKVAMGTVTVEFSDVGPKSMTDLGCACISIDPTLRPSAAEALFKLQ  604

>PPTG_06717
Length=1237

 Score = 194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 151/271 (56%), Gaps = 41/271 (15%)

Query  244   RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
             RIP D +     +S+GA G V +  +N ++ A+K LL   ++    + +F +E++L A++
Sbjct  964   RIPRDEVTILETLSRGAYGSVHLGTWNDKQVAIKTLLPESRKNLFDINQFLMEVKLIAAM  1023

Query  304   IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------------------  340
              HP IV   GVAW+SL ++ M+LEY+  G L+  L++                       
Sbjct  1024  EHPCIVNLFGVAWSSLADMCMILEYMDGGDLRSLLDKYKEDQHPLGFDANKLSIALNVVS  1083

Query  341   -------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                           R+  S N+LL  ++E K+ DFGVSR   D +MTAGVGT  W APE+
Sbjct  1084  ALTYLHSLSPRVIHRDLKSLNILLNSALEAKVTDFGVSRSYEDRTMTAGVGTGLWMAPEV  1143

Query  388   LEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSD  447
             + G  Y EKADM+SFG+VLSELDT  VP+      + + + PV++++ ++ G +R  FS 
Sbjct  1144  MSGEAYNEKADMFSFGIVLSELDTHNVPH-----AENSNVPPVRLMQSILMGEIRAQFSQ  1198

Query  448   ECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
               P  +  +G ACLSLDP+ RPTA E + +L
Sbjct  1199  AGPQAVVELGNACLSLDPADRPTAAEAMYKL  1229

 Score = 42.4 bits (98),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 86/222 (39%), Gaps = 46/222 (21%)

Query  291  QKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR--------  342
            + F  E ++     HP+I+ F G   +S      V E    G+L E+L++ +        
Sbjct  454  RAFLREAKIWHKARHPHIINFFGACCSS-HPCFFVCEEAVNGNLAEYLDKKKSRGRELVW  512

Query  343  ----------EFMSSN-----------VLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPF  381
                      E++  N           +L+      K+ DFG S  L +       G   
Sbjct  513  SKLHEAALGLEYLHQNGIVHGDLKCNQILINGEGTAKLTDFGFSFVLSESKPKGAGGATR  572

Query  382  WTAPEIL--EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
            W APE L  +    T ++D+YSFG+ + E  T  VP+       G  L  V ++  +   
Sbjct  573  WRAPECLGYKEQMPTFESDVYSFGMCVVEAMTYDVPW-------GVYLPDVAVVDHLRHR  625

Query  440  TM--RPS-FSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
                RPS FSD     +     A  + +PS R    + + QL
Sbjct  626  QFIPRPSVFSDAEWDFV----LALCAFEPSKRIKLRDAIEQL  663

>H257_13791
Length=506

 Score = 187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 159/310 (51%), Gaps = 45/310 (15%)

Query  206  AISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVW  265
            A S S+     DSA QSL        ++LLD   L+  R+P D I + + +++GA GEVW
Sbjct  193  ANSSSNAASLMDSAQQSLM------QRSLLD---LDMVRVPIDEISYIKPLAEGAYGEVW  243

Query  266  VCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMV  325
            +        A+KRLL  ++  A  +QKF  EI L + +  P +V  IG AW    ++VMV
Sbjct  244  LGNLYDGPVAIKRLLPTRRTTAVDLQKFISEIVLLSRIECPYVVHLIGAAWTRPSDIVMV  303

Query  326  LEYLSTGSLKEFLEEP------------------------------------REFMSSNV  349
             E+++ G L+  L+                                      R+  S NV
Sbjct  304  TEFMAGGDLRHVLDTNQLDDVAFFPWVKKLQCAHHIGEALVYLDFMTPKVIHRDLKSRNV  363

Query  350  LLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSEL  409
            LL +    K+ DFG++R   D +MTAG+GT  W APE+L   HYTEKAD++SFGV+LSEL
Sbjct  364  LLDEDFNTKLTDFGIARETDDATMTAGIGTFRWMAPEVLLDGHYTEKADIFSFGVILSEL  423

Query  410  DTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRP  469
             T  VPY D     G       I+ +VM+G + P+F+ +CP     +G  CL+LDP +RP
Sbjct  424  STNIVPYSDLRNAKGNVYTDTAIMAKVMTGELIPTFASDCPEWFAELGKLCLALDPHARP  483

Query  470  TAHELVRQLE  479
            +A  L  + +
Sbjct  484  SATMLAFRFQ  493

>PHYCA_112396
Length=370

 Score = 184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 150/286 (52%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +   RIP   I    ++S+GA GEV+   FN Q+ AVK LL   ++    V  F
Sbjct  76   LWDDDVITASRIPRKRIHIGELLSRGAFGEVYAGIFNGQQVAVKMLLPGTRRDIRLVNDF  135

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E  LTA + HP IV  IGVAW+SL +L +VLE++  G L+  L               
Sbjct  136  LSEARLTACMEHPRIVTLIGVAWDSLSDLCVVLEFMEGGDLRTLLNNYEKARRPVGFNRE  195

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              EP    R+  S N+LL +  E K+ DFG+SR  +D +MTAGV
Sbjct  196  KTTIALHVCHALTYLHSLEPSIIHRDLKSRNILLNEMHEAKLTDFGISRERLDRTMTAGV  255

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KADM+SFGVVLSELD   +PY  A  E     G +L    +L
Sbjct  256  GTSLWMAPEVMMGEKYDDKADMFSFGVVLSELDLHTLPYAQAKREMQHSHGRQLSDATLL  315

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            + V +G +   FSD  P  +  +G AC+S+D  +RPTA E +  L+
Sbjct  316  QGVANGAITVEFSDVGPQSMVDLGNACVSVDSRNRPTAAEALFTLQ  361

>H310_07796
Length=489

 Score = 187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 149/282 (53%), Gaps = 39/282 (14%)

Query  235  LDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFA  294
            LD   LE  RIP   +  E+ ++ GA G+VW+ E+N Q  AVK LL  +  K++ +QKF 
Sbjct  202  LDLGELELYRIPVHEVRMEKTLASGAFGQVWLAEYNGQSVAVKTLLANRATKSD-LQKFI  260

Query  295  LEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL----EEP---------  341
            LEI L A +    +V FIGVAW+   +++++ E++  G L+  L    + P         
Sbjct  261  LEITLVAKIECQYVVTFIGVAWSRPTDMMLITEFMDGGDLRSALLCTHDAPPEHRSITWK  320

Query  342  -------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                                     R+  S NVLL      K+ DFG+SR   D +MTAG
Sbjct  321  VKVKIAHRIAEGLVYLHSMDPTVIHRDLKSRNVLLDSVQGAKLTDFGISRETNDATMTAG  380

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEV  436
            +GT  W APE+L+  HYTE  D++SFGV+LSELDT  +PY D   + G  L    I+ +V
Sbjct  381  IGTYRWMAPEVLQDGHYTELTDLFSFGVILSELDTEILPYSDLRNDKGNPLTDTAIMAKV  440

Query  437  MSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            MSG +RP F+ +CP     +G  C +L P  RPTA E+   L
Sbjct  441  MSGELRPQFTSQCPEWFVTLGRNCTALHPMDRPTAMEVAYVL  482

>PHYCA_570505
Length=472

 Score = 187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 156/289 (54%), Gaps = 39/289 (13%)

Query  230  SNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAES  289
            +N  +++   +   RIPF  +     I+KG  G V+   +NR++ A+KR+     Q  + 
Sbjct  155  ANTNIINDPLIIAHRIPFKDVKVANCINKGGFGLVYSGVYNRRRVAIKRIRTDLCQDMKH  214

Query  290  VQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE----------  339
            V+ F  EI L ++L HP IV+FIGVAW++L NL  V EY+  G L+E L           
Sbjct  215  VEAFMKEICLISTLEHPRIVEFIGVAWDTLRNLSAVTEYMERGDLREVLHSFQLRNTPVT  274

Query  340  ----------------------EP----REFMSSNVLLTDSIEPKIIDFGVS--RGLVDL  371
                                  +P    R+  S NVLL   +E K+ DFGVS  R  ++ 
Sbjct  275  WDAHKLRITQHIAEALTYLHSLDPKLIHRDLKSKNVLLNTEMEAKLSDFGVSRERHAMET  334

Query  372  SMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVT-EDGTKLKPV  430
             MTAG+GT FW APE+L G  Y E+AD++S G+V+SE+DT   PY +A     G K++  
Sbjct  335  HMTAGIGTSFWIAPEVLLGKDYDERADIFSLGIVISEIDTEDYPYWNAKNPPQGGKVEET  394

Query  431  QILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             IL+ V +G + P F++ CP  +  +  ACLSL+P  RP+A E+V  ++
Sbjct  395  AILRMVAAGELIPDFTEGCPKAVLELAKACLSLNPDDRPSATEVVYAIQ  443

>PPTG_14140
Length=477

 Score = 187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 162/294 (55%), Gaps = 50/294 (17%)

Query  232  KTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQ  291
             TL +  HL+  +IPFD + F  +I++G + EVW+C    +  AVKRL + +++  + V+
Sbjct  170  NTLTNDPHLKHAQIPFDRLQFHHLIARG-THEVWLCVLRDRCVAVKRLSKEERKNLDEVR  228

Query  292  KFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPR---------  342
             F   I L+A L HP+I+ F+GVAW+S+ NL +V+EYL  G L+E+L +           
Sbjct  229  AFIKTIRLSALLQHPSILSFVGVAWSSMRNLCLVMEYLELGDLQEYLRQSNPNRDQNEIY  288

Query  343  -EFMS-----------------------------------SNVLLTDSIEPKIIDFGV--  364
             +FMS                                    NVLL+  ++ K+  FGV  
Sbjct  289  EDFMSFSLTWKNEKMQILLDITRGLVYLHRKRIIHGDLRAKNVLLSADLDAKLTGFGVVG  348

Query  365  --SRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE  422
              S   ++ + +    TPFWTAPE+L G   + KAD+YS GVV++ELDT + P+  A+T 
Sbjct  349  YRSDNQLEKAQSTRPNTPFWTAPEVLAGGAPSRKADIYSLGVVIAELDTHRSPFSSALTA  408

Query  423  DGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVR  476
             G+++ P+Q+L+ ++SG ++P+ S  CP  I  +   CL  DP +RP+A ++V+
Sbjct  409  RGSRMPPLQVLQHIVSGHLKPNLSPTCPSEIADLAEWCLQRDPDARPSASDVVQ  462

>PHALS_09634
Length=353

 Score = 183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/273 (38%), Positives = 147/273 (54%), Gaps = 37/273 (14%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RIP D I    VI  G  GEV+   +  Q  A+K LL  K++  + +Q F  E+ L A++
Sbjct  73   RIPIDRINLGAVIGHGGFGEVYRGRYRDQDVAIKTLLPDKRKDLKHIQAFLSEVLLMATM  132

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------------------  340
             HP+IVQFIGVAW SL +L  V E ++ G L+  L++                       
Sbjct  133  DHPHIVQFIGVAWESLSDLFCVTELMTGGDLRSLLKDYHDNRFPQGMNSDKMRIAYQVAF  192

Query  341  -------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LLT++++ KI DFG SR   D++MTAGVG+  W APE+
Sbjct  193  ALTYLHSMDPVVLHRDLKSRNILLTNNLDAKITDFGASRVRSDVTMTAGVGSSLWMAPEV  252

Query  388  LEGNHYTEKADMYSFGVVLSELDTGQVPY-HDAVTEDGTKLKPVQILKEVMSGTMRPSFS  446
            + G  Y EKAD++S GVV+SELDT ++PY H   +  G  L    +L+ V  G +R  FS
Sbjct  253  MMGMRYGEKADVFSLGVVISELDTHELPYSHAKESSSGHPLPDTAVLQMVSLGKLRVQFS  312

Query  447  DECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
                P + R   +CL++DP  RPTA E++  L+
Sbjct  313  PFMAPDLARFVDSCLNIDPRLRPTAAEVLYFLQ  345

>PHYRA_77816
Length=542

 Score = 188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 163/295 (55%), Gaps = 41/295 (14%)

Query  226  ERAG-SNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            E AG S   L + E +  KR+    I  +++IS+GA GEV+   FN +  AVK L+   +
Sbjct  241  EAAGHSQNGLWNDEVIIAKRVRRSEIKVKKLISRGAYGEVYHGVFNGKPVAVKMLIPATR  300

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
               + V +F  E ++TAS+ HP++V F+ VAW+SL +L +VLE++  G L+  L++    
Sbjct  301  MSLQHVNEFFAEAKMTASMDHPHVVSFVAVAWDSLSDLCVVLEFMDGGDLRSLLDKHIAS  360

Query  342  ---------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL  368
                                             R+  S N+LL+ ++E K+ DFG+SR  
Sbjct  361  KRQVGFDRQKATVALHVCHALAYLHSLAPPVIHRDLKSRNILLSRTMEAKVTDFGISRER  420

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED----G  424
             D +MTAGVGT  W APE++ G  Y  KADM+SFGVVLSELD   +PY  A        G
Sbjct  421  PDQTMTAGVGTSLWMAPEVMMGEKYDVKADMFSFGVVLSELDVHTLPYAQAKQRSLDTVG  480

Query  425  TKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +L    +L+++M+GT R  FS+     I  +G AC++++PS+RP+A E + +L+
Sbjct  481  RQLTDAALLQKIMTGTARVEFSEMSLRSIVELGYACVAVEPSARPSAAEALYRLQ  535

>PHYSO_476596
Length=535

 Score = 188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 156/286 (55%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L + + +  KRI    I  + +IS+GA GEV+   FN ++ AVK L    + +   V  F
Sbjct  235  LWNDDVITAKRIARREIQVKNLISRGAFGEVYEGVFNDKRVAVKMLSPEIRGRIRYVNNF  294

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E +LTAS+ HP++V FIGVAW++L +L +V+E++  G L+  L E             
Sbjct  295  LAEAKLTASMEHPHVVHFIGVAWDTLSDLCVVMEFMEGGDLRSLLSEYEQSGHPVGIDRE  354

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LLT  ++ K+ DFG+SR  +D +MTAGV
Sbjct  355  KATIALHVCHALTYLHSLAPPIIHRDLKSRNILLTHDLKAKVTDFGISREKLDQTMTAGV  414

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y +KAD++SFGVVLSELD   +PY  A  +    +G +     +L
Sbjct  415  GTSLWMAPEVMLGERYDDKADIFSFGVVLSELDLHTLPYAQAKDKNRDSNGHRFPDALLL  474

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V  G +R  FS+  P  +  +G AC+S+DP  RPTA E + +L+
Sbjct  475  QQVAMGKLRVEFSEGSPRSLVEVGVACVSVDPRLRPTAAEALYKLQ  520

>PITG_01002
Length=555

 Score = 188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 156/286 (55%), Gaps = 40/286 (14%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D + +   RIP D +  ++++S+GA GEV+   FN  + AVK LL   +   + V  F
Sbjct  262  LWDDDVITANRIPRDKVRVKKLLSRGAFGEVYDGVFNGNRVAVKMLLPHTRGNLKQVNDF  321

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-------------  340
              E ++TA++ H +IV F+GVAW++L ++ +VLEY+  G L+  L +             
Sbjct  322  LAEAKMTATMDHAHIVAFVGVAWDALSDVCVVLEYMDGGDLRSLLSKYEESHHPTGFDSQ  381

Query  341  -----------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                                    R+  S N+LL  ++E K+ DFG+SR  +D +MTAGV
Sbjct  382  KTTIALHICHALTYLHSLMPPVIHRDLKSRNILLNQAMEAKLTDFGISRERLDQTMTAGV  441

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTE----DGTKLKPVQIL  433
            GT  W APE++ G  Y  KAD++SFGVVLSELD   +PY  A  +    +G KL    IL
Sbjct  442  GTSLWMAPEVMLGERYDVKADLFSFGVVLSELDLHTLPYARAKDQTRDANGRKLPDAAIL  501

Query  434  KEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            ++V  G ++  FS      I  +G AC+SL+P+ RPTA E + +L+
Sbjct  502  QQVTMGIVQVEFSRTSSASIVDLGRACVSLNPNDRPTAAEALYRLQ  547

>PHYRA_95588
Length=1577

 Score = 194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 154/282 (55%), Gaps = 45/282 (16%)

Query  234   LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
             L D E +   RIP + +V +R I +G  GEV++  FN+++ AVK LL   +++ + V  F
Sbjct  768   LWDDEVIATARIPREKVVIQRSICRGGGGEVFLGLFNQRQVAVKMLLPEMRKRVKHVNDF  827

Query  294   ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFL---------------  338
               E++  A+L HP IV+F+GVAW+SL +L +V E++  G L+  L               
Sbjct  828   LAEVKFMATLDHPRIVEFVGVAWDSLTDLCVVSEFMEGGDLRALLTSYEKKEHAKGFDRT  887

Query  339   ------------------EEP---REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                               E P   R+  S NVLLT   E K+ DFG+SR  VD  MTAGV
Sbjct  888   KVTIALHVAHALTYLHSLESPVLHRDLKSKNVLLTSDFEAKLTDFGISRECVDKQMTAGV  947

Query  378   GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVM  437
             GT  W APE++ G  Y +KADM+SFGVVLSELD         V E+G  L    +L++V 
Sbjct  948   GTSLWMAPEVMLGQRYDDKADMFSFGVVLSELD---------VHENGRTLSETVVLQKVA  998

Query  438   SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              G +R  FS      +  +G AC++LDP+ RP+A E + +L+
Sbjct  999   LGKLRVEFSSSSLEPVVDLGLACVALDPADRPSAAEALYRLQ  1040

 Score = 159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 146/284 (51%), Gaps = 52/284 (18%)

Query  234  LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKF  293
            L D E +   RIP + ++ +++IS+G  GEV+   FN    AVK LL   ++  + V  F
Sbjct  278  LWDDEIIATARIPREKVLVQQLISRGGYGEVYYGLFNGLHIAVKMLLPETRKSVKHVNDF  337

Query  294  ALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE--------------  339
              E+++ A+L HP IV+F+GVAW+SL +L +V EY+  G L+  L               
Sbjct  338  LAEVKMMATLDHPRIVKFVGVAWDSLTDLCVVSEYMEGGDLRALLSSYEAQNHPVGFDRS  397

Query  340  ------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGV  377
                              +P    R+  S N+LL+  +E K+ DFG+SR  +D +MTA  
Sbjct  398  KVTIALHVAHALTYLHSLDPPVLHRDLKSKNILLSSELEAKVTDFGISRERIDKTMTA--  455

Query  378  GTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDA--VTEDGTKLKPVQILKE  435
                        G  Y +KAD++SFGVVLSELD   +PY  A   +  G K+    IL+ 
Sbjct  456  ------------GERYDDKADIFSFGVVLSELDQHALPYSHAKDASNSGRKMPDTAILQM  503

Query  436  VMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            V  G +R  FS +    +  + ++C+++DP  RPTA E + +L+
Sbjct  504  VALGKLRVKFSPKALESMVALASSCVAVDPKERPTAAEALYKLQ  547

 Score = 114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 150/349 (43%), Gaps = 89/349 (26%)

Query  170   GWLSCRRKLEASM-KQKSGIEHerrsqrssgssqerrAISISSPQQRRDSAIQSLYCERA  228
             G+L  RR+++A+    K G ++ R +      S +      S+       ++ SL+    
Sbjct  1272  GFLWYRRRIKATGDSDKLGDDYTRATSPVGQQSIDTVTTDFSNSIGLGPQSLASLW----  1327

Query  229   GSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAE  288
                    D E +   RIP + ++ +++I++G  GE         + A+K LL   ++   
Sbjct  1328  -------DDEIIATSRIPREKVLVQQLINRGGYGE---------RVALKMLLPEFRKSIR  1371

Query  289   SVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE---------  339
              V +F  E+ L A L HP IV F+G+AW+SL +L  VLEY+  G L+  L          
Sbjct  1372  HVNEFLDEVRLMALLDHPRIVHFVGIAWDSLSDLCAVLEYMEGGDLRALLASYEAQGHEL  1431

Query  340   -----------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLS  372
                                    +P    R+  S N+LLT  ++ K+ DFG+SR   D +
Sbjct  1432  GFDRSKVTIALHVAHALTYLHSLDPPVLHRDLKSKNILLTSDLQAKVTDFGISREGSDKT  1491

Query  373   MTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAV--TEDGTKLKPV  430
             MTAGV                              ELD   +PY  A   +  G K+   
Sbjct  1492  MTAGV------------------------------ELDLHTLPYSYAKENSNSGRKMPDT  1521

Query  431   QILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              IL+ V  G +R  FS E    +  +G AC+++DP+ RPTA E +  L+
Sbjct  1522  AILQMVALGKLRVKFSSEALESMVALGNACVAVDPTERPTAAEALYHLQ  1570

>PHYRA_82925
Length=611

 Score = 189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/292 (35%), Positives = 160/292 (55%), Gaps = 38/292 (13%)

Query  226  ERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQ  285
            E  G    L   E + G R+P + +  +++IS+G  GEV+V  +N Q+ AVK LL   ++
Sbjct  311  ESDGDGSPLWRDEAILGARVPREKVAVQQLISRGGYGEVYVGTYNGQQVAVKMLLPETRK  370

Query  286  KAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----  340
                   F  E++L A+L HP IV  +GVAW+S ++L  ++E++S G L+  L +     
Sbjct  371  SKVHRISFLAEVKLMATLEHPRIVHLVGVAWDSPNDLCALIEFMSGGDLRTLLNKYEAEN  430

Query  341  -------------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLV  369
                                            R+  S N+LL+  ++ K+ DFG+SR  V
Sbjct  431  RPSGFTYEKVKIALHVAHALTYLHSLDPPVIHRDLKSKNILLSKELDAKLTDFGISRERV  490

Query  370  DLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT--KL  427
            D +MTA VGT  W +PE++ G  Y +KAD++SFGVVLSEL+T  +PY  A + DG+  +L
Sbjct  491  DRTMTAAVGTSLWMSPEVMMGERYNDKADIFSFGVVLSELNTHSMPYAHAKSRDGSGGRL  550

Query  428  KPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
                IL+ V +G +R  FS      + ++G AC+S+DP +RP+A E++  L+
Sbjct  551  PDTAILQLVAAGRLRADFSQGGQDALMQLGLACVSVDPKARPSAPEVLYHLQ  602

>PHYCA_503455
Length=469

 Score = 186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 153/287 (53%), Gaps = 40/287 (14%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            TL +   +   RIP D I    VIS+G  GEV+   +     AVK LL  K++    +Q 
Sbjct  175  TLWEDPVILASRIPIDRIQLGTVISRGGFGEVYRGRYRDADVAVKTLLPEKRKDLAHIQA  234

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE------------  340
            F LE+ L A++ HP+IVQFIGVAW SL +L  V E+++ G L+  L++            
Sbjct  235  FLLEVRLMATMEHPHIVQFIGVAWESLSDLFCVSEFVAGGDLRSLLKDYLATGVPQGMDA  294

Query  341  ------------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                                     R+  S N+LLT+S++ K+ DFG SR   D +MTAG
Sbjct  295  SKMQIAYQVAYALTYLHSLDPVVLHRDLKSRNILLTESLDAKLTDFGASRIRSDTTMTAG  354

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED----GTKLKPVQI  432
            VG+  W APE++ G  Y EKAD++S GVV+SELDT ++PY  A   +    G +L    +
Sbjct  355  VGSSLWMAPEVMMGQRYGEKADVFSLGVVISELDTHELPYSHAKEGNSGSSGHQLPDTAV  414

Query  433  LKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            L+ V  G +R  FS    P + R    C+++DP SRPTA E++  L+
Sbjct  415  LQMVSMGKLRVRFSPFMAPDMARFVGNCVNVDPQSRPTAAEVLYYLQ  461

>PHYCA_547239
Length=391

 Score = 184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 152/285 (53%), Gaps = 38/285 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
             L D + +   RIP D I    +IS+G  GEV+   +N    AVK++L   ++    V  
Sbjct  99   NLWDDDAITTARIPKDKIDVGPLISRGGFGEVYKGTYNGLTVAVKKMLPAHRKNVAHVNN  158

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-------------  339
            F  E++L ASL H  IVQF+GVAW+SL ++  V E++  G L+  L              
Sbjct  159  FLAEVKLMASLDHSCIVQFVGVAWDSLSDVCAVTEFMDAGDLRGLLTTYHDENHPVGFDN  218

Query  340  -------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAG  376
                               EP    R+  S N+LLT  +  K+ DFGVSR   D +MTAG
Sbjct  219  DKVTIAMHVAHALTYLHSLEPVVIHRDLKSRNILLTSDLSAKLTDFGVSRERADCTMTAG  278

Query  377  VGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT--KLKPVQILK  434
            VGT  W APE+L G  Y +KAD++SFGVVLSELD   +PY  A    G+  +++ + +L+
Sbjct  279  VGTSLWMAPEVLMGERYDDKADVFSFGVVLSELDLQVLPYAHATESSGSGRRMRDLAVLQ  338

Query  435  EVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             +  G +R  FS +    +  +G  C+SL+PS RP+A E++ +L+
Sbjct  339  RMAMGKLRVQFSPDATASMVELGLTCVSLNPSDRPSAAEVLYKLQ  383

>PHYCA_106045
Length=563

 Score = 188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 160/291 (55%), Gaps = 38/291 (13%)

Query  227  RAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQK  286
            R+    T+ + + +   RIP DS+  E +I +G  GEV+   ++ +  AVK L    ++ 
Sbjct  259  RSNQRSTVCEDDAILSSRIPRDSVFVEDLIGRGGYGEVYKGMYDGRAVAVKMLFPETRKS  318

Query  287  AESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP-----  341
               V +F  E+++   + HP +V+F+GV+WN+L +L +V E+++ G L+ +L +      
Sbjct  319  TRHVTEFLTEVKMMTVMDHPRVVEFVGVSWNNLMDLCVVTEFMAGGDLRAWLNDRADNAA  378

Query  342  -------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGLVD  370
                                           R+  S N+LL+++ + K+ DFG SR  VD
Sbjct  379  PVGFDFTKVKIATHVVHALAYLHSLTPSVIHRDLKSRNILLSENEDAKLADFGASRERVD  438

Query  371  LSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED--GTKLK  428
             +MTAGVGT  W APE++ G  Y +KADM+SFGVVLSELD+ Q PY +A  ++  G K+ 
Sbjct  439  RTMTAGVGTSLWIAPEVMMGERYDDKADMFSFGVVLSELDSQQNPYANAKDKNPAGRKMP  498

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
               IL+ V  G +R  FS      + ++GTAC ++DP+ RP+A E  R+L+
Sbjct  499  ETAILQLVAMGKLRVEFSPGALKGMVQLGTACTAIDPTERPSAAEAFRKLQ  549

>PITG_17495
Length=529

 Score = 187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 148/273 (54%), Gaps = 38/273 (14%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RI +DS+   + I++GA GEVWV ++   + AVKRL+Q +   A S + F  EI+L A L
Sbjct  250  RIDYDSVTLVKKIAQGAFGEVWVGQYRNTRVAVKRLIQDQVSLATS-EAFLREIKLMAWL  308

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------------  341
             HP IVQF+GVAW  L +++ V+EY+  G L+  L++                       
Sbjct  309  EHPKIVQFVGVAWTKLVDMLAVIEYMDGGDLRTLLDKKSPKKLPWQEGGLKLQYACDTID  368

Query  342  --------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LL      K+ DFGVS       MT GVGT  W APEI
Sbjct  369  AVVYLHSLSVVIIHRDLKSRNILLDSKNGAKLGDFGVSATKRQHDMTVGVGTARWLAPEI  428

Query  388  LEG-NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFS  446
              G + YTE  D+YSFG++LSELDT  +P+ DA T  G  L  + IL+ V SG ++ + S
Sbjct  429  ARGEDKYTEAVDVYSFGIILSELDTHHLPFADARTSSGAPLNDMAILQGVSSGALQVALS  488

Query  447  DECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              CPP++  +  +C+ LDP+ RPTA ++  +L 
Sbjct  489  PTCPPKLEALARSCMHLDPAQRPTAAQVAYELR  521

>PHYCA_568998
Length=458

 Score = 185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 145/274 (53%), Gaps = 45/274 (16%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RIP + +     IS+GA G+V+   +  Q  AVK +          V+ F  EI++  S+
Sbjct  185  RIPREKVEIHEFISRGAFGKVYKGTYKSQLVAVKTM--------GDVETFVQEIKMARSM  236

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------------------  340
             HPNIVQF+GVAWN  ++   V+EY+  G L+  L++                       
Sbjct  237  SHPNIVQFVGVAWNYREDFCCVMEYMDGGDLRGLLDKYEDENRRTGFNSEKLTIALHVAH  296

Query  341  -------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LL +++  K+ DFGVSR  VD +MTA VGT  W APE+
Sbjct  297  ALAYLHSRDVPVLHRDLKSKNILLNEALGAKLTDFGVSRERVDRAMTADVGTSLWMAPEV  356

Query  388  LEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGT-KLKPVQILKEVMSGTMRPSFS  446
            + GN Y EKAD++SFGVVLSEL T  +PY  A     T +L P+ IL  V +GT+   FS
Sbjct  357  MIGNAYDEKADLFSFGVVLSELSTHTLPYAHAKRPGSTEQLSPLVILHRVATGTLSVEFS  416

Query  447  DECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
               P  I R+G AC+S+DP  RPTA E +R L  
Sbjct  417  KSDPQAIVRLGLACVSMDPDKRPTAAEAMRVLHA  450

>PPTG_09207
Length=655

 Score = 189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 107/276 (39%), Positives = 150/276 (54%), Gaps = 38/276 (14%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RI +DS+   + I++GA GEVWV  +   + AVKRL+Q +   A S + F  EI+L A L
Sbjct  378  RIDYDSVTLVKKIAQGAFGEVWVGHYRNDRVAVKRLIQDQVSLATS-EAFLREIKLMAWL  436

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP----------------------  341
             HP IVQF+GVAW  L +++ V+EY+  G L+  L++                       
Sbjct  437  EHPKIVQFVGVAWTKLVDMLAVIEYMDGGDLRTLLDKKSPKKLPWQEGGLKLQYARDTID  496

Query  342  --------------REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LL      K+ DFGVS       MTAGVGT  W APEI
Sbjct  497  AVVYLHSLSVVIIHRDLKSRNILLDSKKGAKLGDFGVSATKRQHDMTAGVGTARWLAPEI  556

Query  388  LEG-NHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFS  446
              G + YTE  D+YSFG++LSELDT Q+P+ DA T  G  L  + IL+ V SGT++ + S
Sbjct  557  ARGEDKYTEAVDVYSFGIILSELDTHQLPFGDAKTSAGAPLNDMAILQGVSSGTLQVTLS  616

Query  447  DECPPRIRRIGTACLSLDPSSRPTAHELVRQLEGRD  482
              CP  +  +  +C++LDP+ RPTA ++  +L   D
Sbjct  617  PTCPSNLEALARSCMNLDPAQRPTAAQVAYELRKSD  652

>PHYRA_76294
Length=478

 Score = 186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 149/281 (53%), Gaps = 46/281 (16%)

Query  236  DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
            D   +   RIP + +V +  IS+GA G+V+   +N Q  AVK +          V+ F  
Sbjct  192  DDAEINKARIPREHVVVDEFISRGAFGKVYKGTYNGQLVAVKTVAD--------VETFVN  243

Query  296  EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE---------------  340
            EI++ A++ HPNIV+FIGVAWNS ++   V+EY+  G L+  ++                
Sbjct  244  EIKMAAAMSHPNIVRFIGVAWNSREDFCSVMEYMDGGDLRGLMDSYEELKHSTGFDADKI  303

Query  341  ---------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                  R+  S N+LL +++  K+ DFGVSR   D +MTA VGT
Sbjct  304  RIALHVAHALAYLHSFDVPIIHRDLKSKNILLNEALGAKLTDFGVSRKRADRAMTADVGT  363

Query  380  PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTK--LKPVQILKEVM  437
              W APE++ GN Y EKADM+SFGVVLSEL    +PY  A    G+K  L P+ IL  V 
Sbjct  364  SLWMAPEVMVGNAYDEKADMFSFGVVLSELSLHALPYAHAKLRPGSKQQLSPLVILHRVA  423

Query  438  SGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQL  478
            +GT+   FS   P  +  +G AC+S+DP+ RP+A E +  L
Sbjct  424  TGTLSVEFSKAGPQPMVELGRACVSMDPAERPSAAEAMHVL  464

>H257_17422
Length=426

 Score = 184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/271 (37%), Positives = 145/271 (54%), Gaps = 35/271 (13%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            ++ +  I + R +SKGA GEVW+ +F     A+K++L+ +K  A+ ++ F  EI+L A+ 
Sbjct  146  KVDYSDIQYTRKLSKGAFGEVWLGQFQGSYVAIKQILEERKTDAKEIECFVAEIKLMATF  205

Query  304  IHPNIVQFIGVAWNSLD-NLVMVLEYLSTGSLKEFLEE----------------------  340
             HPNIV F+G +WN  D NL  + EY+  G L  FL++                      
Sbjct  206  QHPNIVDFLGFSWNPKDANLCAMTEYMKNGDLFVFLQKRKATLTWRHDKIQIAIDIAQAL  265

Query  341  -----------PREFMSSNVLLTDSIEPKIIDFGVSR-GLVDLSMTAGVGTPFWTAPEIL  388
                        R+  S NVLL D    K+ DFG+SR   ++ +MTAGVGT  W APE+ 
Sbjct  266  VYLHSLSPKVIHRDLKSKNVLLDDRCTAKLSDFGISRLRQLEETMTAGVGTALWAAPEVF  325

Query  389  EGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDE  448
                Y ++AD+YS GVVLSELDT  +PY D       KL  + ++K V     +P+FS  
Sbjct  326  LAMKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAVIKLVTQQKAKPTFSPS  385

Query  449  CPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            CP  +R +   CL  +P +RP+A E+V  L+
Sbjct  386  CPEEVRALAFRCLDYEPDNRPSAAEVVEILK  416

>PHYSO_539944
Length=463

 Score = 185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/281 (38%), Positives = 149/281 (53%), Gaps = 45/281 (16%)

Query  244  RIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASL  303
            RIP D I    VIS+GA GEV+   +  Q  A+K LL  K++    +Q F  E+ L A++
Sbjct  175  RIPIDRIELGAVISRGAYGEVYRGRYREQDVAIKTLLPEKRKDLAHIQAFLSEVRLMATM  234

Query  304  IHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE-----------------------  340
             HP+IVQF+GVAW SL +L  V E+++ G L+  L E                       
Sbjct  235  EHPHIVQFVGVAWESLSDLFCVTEFMAGGDLRSLLREYLAAGVRQGMDASKVRIAYQVAY  294

Query  341  -------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEI  387
                          R+  S N+LLT++++ KI DFG SR   D +MTAGVG+  W APE+
Sbjct  295  ALTYLHSLEPVVLHRDLKSRNILLTEALDAKITDFGASRIRSDATMTAGVGSSLWMAPEV  354

Query  388  LEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTK---------LKPVQILKEVMS  438
            + G  Y EKAD++S GVV+SELDT ++PY  A  E G+          L    +L+ V  
Sbjct  355  MLGKRYGEKADVFSLGVVISELDTHELPYSHAKEEGGSGTGGGGGGRPLPDTAVLQMVSL  414

Query  439  GTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
            G +R  FS    P + R   +C+S++PS RPTA E +  L+
Sbjct  415  GKLRVRFSAFMDPDMARFVGSCVSMEPSERPTAAEALYYLQ  455

>PITG_11236
Length=727

 Score = 190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 155/262 (59%), Gaps = 28/262 (11%)

Query  243  KRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTAS  302
            +R+PF  I   R IS GA GEVW+        AVKRL + ++++   ++ FA EI+L AS
Sbjct  470  RRVPFVDISLVRQISSGAYGEVWLGHLCGDIVAVKRLTRDRRRQVHDLELFAAEIQLMAS  529

Query  303  LIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEPREFMSSNVLLTDSIEPKIIDF  362
            L H N++   GVAWN+ +N+++++EY+  G L+  L+    + + + +   S    I +F
Sbjct  530  LEHINVLGLTGVAWNTPENMLLIMEYMERGDLQGVLQ----YQNGDKIPESSGNNSIDEF  585

Query  363  G-----------VSRGLVDLSMTA---------GVGTPFWTAPEILEGNHYTEKADMYSF  402
                        +S GL  L             GVGT +WTAPE+L G+ Y+EKAD+YS 
Sbjct  586  SWASHKAQIARDISCGLQYLHSLKPIIVHRDLNGVGTAYWTAPEVLAGHRYSEKADIYSL  645

Query  403  GVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLS  462
            GVVL+ELDTG++P++DA T DG K++ + IL  V+SG + PSF+ +CP  +R++  ACL+
Sbjct  646  GVVLAELDTGELPFYDARTSDGHKMETIHILSLVVSGELHPSFTLDCPEDVRKLALACLN  705

Query  463  LDPSSRPTAH----ELVRQLEG  480
              P  RP+A     EL R L+G
Sbjct  706  PKPECRPSAQMVLDELHRLLQG  727

 Score = 35.8 bits (81),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 0/44 (0%)

Query  6    MADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVS  49
            M++L + +       CT   CS PNG   + + +C G+QM NVS
Sbjct  135  MSELQLSRNAYRSAGCTEQRCSSPNGDLFYQSLFCKGYQMGNVS  178

>PHYRA_84549
Length=1048

 Score = 192 bits (487),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/280 (37%), Positives = 151/280 (54%), Gaps = 36/280 (13%)

Query  236   DSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQKFAL  295
             + E +   RIPF+ +   ++IS G  G+V++  +  +  A+KRLL  K++K   V  F  
Sbjct  758   EDEAITTMRIPFEKLTTTKLISYGGHGQVYLGTYRGEHVAIKRLLPEKRKKLHEVNDFLA  817

Query  296   EIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEE---------------  340
             EI++ A + HP IV+FIGVAW+SL +L  V E++  G L   L+                
Sbjct  818   EIKMMAKVDHPRIVRFIGVAWDSLTDLCAVSEFMDGGDLHSVLKHFEDVKRPHGFDFDKA  877

Query  341   ---------------------PREFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTAGVGT  379
                                   R+  S N+LLT  +E KI DFGVSR     +MTAGVGT
Sbjct  878   RIALQVAHALSYLHSLDPIVLHRDLKSMNILLTSELEAKITDFGVSRQWSVDTMTAGVGT  937

Query  380   PFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQILKEVMSG  439
               W APE++ G HY   AD++S G+VLSELD+   PY +  + +G K+    IL  V SG
Sbjct  938   ALWMAPEVMMGEHYDASADIFSLGIVLSELDSHLPPYRETWSLNGQKISDTAILDMVASG  997

Query  440   TMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
              +R  FS   P  +  +G AC+ LDP++RP+A E++ +L+
Sbjct  998   QLRVEFSANAPRELVELGHACVDLDPTARPSASEVLYRLQ  1037

 Score = 160 bits (404),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 150/285 (53%), Gaps = 38/285 (13%)

Query  233  TLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKKQKAESVQK  292
            ++ + + +   RIP + +   ++++KG  G V+   +  +  A+K LL   ++    +  
Sbjct  276  SMWEDDTITAMRIPLEKLTKGKLLNKGGYGLVYRGSYRGEPVAIKTLLPESRKTLRHINA  335

Query  293  FALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLE-------------  339
            F  EI++ A+L HP IV+ +GVAW+SL +L  V EY+  G L+  L              
Sbjct  336  FLSEIKMMAALEHPRIVRLVGVAWDSLMDLCCVSEYMEGGDLRSLLNYVEYQECRPHGFD  395

Query  340  --------------------EP----REFMSSNVLLTDSIEPKIIDFGVSRGLVDLSMTA  375
                                +P    R+  S N+LLT++ E K+ DFGVSR   D +MTA
Sbjct  396  LEKARIALHVAHALTYLHSLDPLVLHRDLKSKNILLTENREAKVTDFGVSRESSDRTMTA  455

Query  376  GVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKP-VQILK  434
            GVGT  W APE++ G  Y   AD++SFGVVLSELD+  +PY  A   D  ++ P   +L+
Sbjct  456  GVGTSLWMAPEVMMGERYGSSADIFSFGVVLSELDSHVLPYAAAKETDSGRVIPDTALLQ  515

Query  435  EVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLE  479
             V  G +R  FS   P  +  +  AC+++DP +RP A E++ +L+
Sbjct  516  LVSLGLLRVEFSPHAPQALVDLAHACVNIDPEARPHAGEVLYRLQ  560

>PHALS_13547
Length=546

 Score = 186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/367 (31%), Positives = 183/367 (50%), Gaps = 41/367 (11%)

Query  153  LIPVILGVAIAVAGMALGWLS-CRRKLEASMKQKSGIEHerrsqrssgs-sqerrAISIS  210
            +I +++G    VA +        RR+ + ++ +  GI     S     +      AI++ 
Sbjct  172  IIFIVIGSVACVAFVVFAAFKFVRRRHKKALSKDIGIAALATSYAGYPTPESALNAITLG  231

Query  211  SPQQRRDSAIQSLYCERAGSNKT-LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEF  269
            S          +++  R  S  + L + E +   R+P + ++ + +IS+G  GEV+   F
Sbjct  232  SDATYSQKGTHNVWSRRKTSGTSELWEDEIIVTARVPREKVILQDLISRGGYGEVYSAMF  291

Query  270  NRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYL  329
            N ++ AVK LL   ++    +  F  E++L A+L H  IV+FIGVAW+SL+++ ++ EY+
Sbjct  292  NEERVAVKMLLPEMRKSITHLNAFLAEVKLMATLNHERIVRFIGVAWDSLNDICVLSEYM  351

Query  330  STGSLKEFLEE------------------------------------PREFMSSNVLLTD  353
              G L+  L+                                      R+  S N+LLT 
Sbjct  352  QGGDLRTMLKTCEDNKTPQGIDRSKATIALHVAHALTYLHSLSPPVLHRDLKSKNILLTS  411

Query  354  SIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQ  413
             +  K+ DFGVSR   D +MT GVG+  W APE++ G  Y +KADM+SFGVVL+ELD   
Sbjct  412  QLHAKLTDFGVSRERSDHTMTGGVGSSRWMAPEVMMGERYDDKADMFSFGVVLAELDQHL  471

Query  414  VPYHDAV--TEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTA  471
            +PY +    ++ G  +  + IL+ V +G +R  FS   P  I+ +G  C+S+DP  RPTA
Sbjct  472  IPYANVKENSDSGRVMPDLAILQMVATGKLRIQFSSAAPQDIKELGLKCVSIDPKDRPTA  531

Query  472  HELVRQL  478
             E +  L
Sbjct  532  SEALYTL  538

>PITG_08968
Length=555

 Score = 186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/318 (35%), Positives = 163/318 (51%), Gaps = 58/318 (18%)

Query  207  ISISSPQQRRDSAIQSLYCERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWV  266
            I+ SS   RR SA              L D + +   RI  + +  +++I++G  GEV++
Sbjct  244  ITTSSDFDRRHSA-------------KLWDDDVIVAARISREKVQVKQLINRGGYGEVYI  290

Query  267  CEFNRQKAAVKRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVL  326
              ++ +  AVK LL   K+    V  F  E++L ASL HP IV FIGVAW+ L ++ +V 
Sbjct  291  GSYHGKDVAVKMLLPETKKTMSQVNAFLSEVKLMASLDHPRIVSFIGVAWDQLIDICVVS  350

Query  327  EYLSTGSLKEFLEE------------------------------------PREFMSSNVL  350
            EY++ G LK  L +                                     R+  S N+L
Sbjct  351  EYMAGGDLKALLSDYEKNGHPVGFDHTKVKIALHVSIALTYLHSCASPVIHRDLKSKNIL  410

Query  351  LTDSIEPKIIDFGVSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELD  410
            L ++I  K+ DFG+SR  +D +MT G+GT FW APE++ G  Y +KADM+SFGVVLSELD
Sbjct  411  LDEAINAKVTDFGISRERIDATMTGGIGTSFWMAPEVMMGERYDDKADMFSFGVVLSELD  470

Query  411  TGQVPY---------HDAVTEDGTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACL  461
            +  +PY           + +    KL    IL+ V +G +R  FS+  P  +  +G AC+
Sbjct  471  SHVMPYALSKSASSTESSSSSKPNKLPNAAILQMVAAGRLRVHFSEAGPQSMVDLGLACV  530

Query  462  SLDPSSRPTAHELVRQLE  479
            S+DP  RPTA E + +L+
Sbjct  531  SVDPRKRPTAAEALYKLQ  548

>PHALS_12946
Length=676

 Score = 189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 160/292 (55%), Gaps = 39/292 (13%)

Query  225  CERAGSNKTLLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAVKRLLQRKK  284
            C+++    T +    +  KRI F  +   R+++KG SGEVW+ ++  Q  A+K LL  K+
Sbjct  378  CQQSVILSTFVSDPTIITKRIAFSHLHRLRLLAKGGSGEVWLGQYETQYVAMKCLLSLKR  437

Query  285  QKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKEFLEEP---  341
            +  +++++FA EI + + L HP IV F GVAW+SL +L  + EY++ G L+  L      
Sbjct  438  KDFQALEQFAEEIRMASLLEHPRIVTFFGVAWHSLWHLCAITEYMAYGDLETVLTHSNSR  497

Query  342  --------------------------------REFMSSNVLLTDSIEPKIIDFGVSRGL-  368
                                            R+  S NVLL   +  K+ DFG+SR   
Sbjct  498  NEFSWKREKFQIACDIIEALVYLHSLLPIVIHRDLKSKNVLLDRYLHAKLSDFGLSRERS  557

Query  369  VDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLK  428
            ++ +MT G+GT  WTAPEILEG  Y E +D++SFGVVLSE+DT  +PY    T   TK++
Sbjct  558  IEDTMTNGIGTILWTAPEILEGKRYDETSDLWSFGVVLSEIDTCALPY--GFTRH-TKMQ  614

Query  429  PVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480
             +QI+  V  G + P+F D+CP  IR +   CL+LDP +RPTA  +  +L  
Sbjct  615  SIQIVHFVSKGQLLPTFQDDCPKEIRELAFRCLNLDPKARPTALTVAYELRS  666

Lambda      K        H        a         alpha
   0.318    0.133    0.404    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 36264537453

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40