Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_00004461461430780.0
PITG_175851407965565529810.0
PPTG_161881407965765425580.0
PHYSO_5200171407966163919430.0
PHYRA_8455959412265061618810.0
PHYSO_5184415941266361418750.0
PPTG_161841408065662318170.0
PHYCA_1072241408065064917970.0
PITG_175861408068666417900.0
PHYSO_2531951408067762617560.0
HYAP_144401625964761317430.0
PITG_207671625966164317300.0
PHYRA_845511625963864017240.0
PITG_175761407066164317140.0
PPTG_162011625965664317070.0
PPTG_161875232964060916980.0
PHYCA_5639341625964564016850.0
PHYSO_5200721625966164316830.0
PPTG_161995233666664416690.0
PHYRA_845535233666461916680.0
PPTG_161855941263261216640.0
PHYKE_31625959856216580.0
PPTG_161861407060859516560.0
PHYSO_3379665233666864216470.0
PHYSO_3379525232961959415860.0
PPTG_161901407764163314120.0
PHYRA_845555951166363613542e-179
PPTG_161986090465663113445e-178
PHYSO_3379571407165661613323e-176
PHYSO_3252525046765661613313e-176
PPTG_161925951163761313095e-173
PHYCA_1074844115234333212752e-172
PPTG_161937210468063513065e-172
PHYCA_1072391407664963112114e-158
PHYSO_5208851407762361411991e-156
PITG_00005549353711392e-149
HYAP_144396830241440610843e-142
PHYSO_2532014618954054210581e-136
PHYSO_3379507210457560810541e-135
PITG_175831407755060510461e-134
PHYCA_5333905941248330210356e-134
PHYSO_3379591407264254510489e-134
PHYRA_84557140776432949792e-123
PHYCA_543946140773142939422e-122
PHYSO_519978683026446319601e-120
PHYSO_337956140705633299503e-120
PHYSO_324311503676235959511e-119
PHYRA_84554721046862969333e-116
PHYSO_563952609046672969272e-115
PHYSO_483581571766672969262e-115
PHYSO_520064595116693079184e-114
PHYSO_51962474576693079184e-114
PHYSO_485044572556693079184e-114
PPTG_09878212636125979126e-114
PITG_17577140715103138951e-112
PITG_17578140724812968902e-112
CCI41501162586806359021e-111
PHYSO_337967162586772889002e-111
PHYRA_84552162587042869005e-111
PITG_20766162587043138943e-110
PPTG_16200162587453128956e-110
PPTG_01981184913673428341e-105
PHYRA_84558140784152807572e-93
PHYSO_520398140766792907633e-91
PPTG_16191140768773177711e-90
PITG_17582140767072907593e-90
PHYRA_84556140768172907611e-89
PPTG_01911184732462477143e-89
HYAP_14441140768322757472e-87
PHYCA_543949140701951906859e-86
PPTG_16189140784373277052e-85
PITG_17584140784042916928e-84
PITG_17579609044724516925e-83
PHYCA_107365683022692766684e-82
PHYCA_543955140711901896571e-81
PHYSO_337953140783772796705e-81
PHYKE_181366514693186602e-78
PITG_0796766514742746603e-78
PPTG_0847366514732706551e-77
PHYCA_107158595111881876292e-77
PHYSO_56543366514722716524e-77
PHYSO_52335954426625976647e-77
PHYCA_51128266514652706497e-77
PHALS_0362666514952806482e-76
SDRG_051041358986326236541e-75
PYVX_1795154426756376552e-75
PHYRA_8127366514452716382e-75
PPTG_0847466525312696442e-75
PHYCA_51128766525152696407e-75
HYAP_0365866525222686399e-75
PHYKE_942866525032706362e-74
SDRG_050991298466206166442e-74
PITG_0796866525262696354e-74
H310_076201298526286076401e-73
PHYSO_52902266525172686321e-73
PHYRA_8127466525182696302e-73
PYVX_1794454417046336371e-72
SPRG_083021262946476206312e-72
SDRG_051051298526105926241e-71
CCA2193666514352856102e-71
CCA247861565534352856102e-71
CCA19358162586822746202e-70
PPTG_17293101614173075986e-70
SDRG_0545443557043166091e-68
CCI4104166514132635882e-68
PHYRA_72889467923652725842e-68
SPRG_0598143557103166063e-68
PYAR_13094995074784645904e-68
PHYRA_7487339573633215814e-68
PPTG_06851201512782255734e-68
PHYCA_122066114833442865795e-68
HYAP_0943839573572725805e-68
PPTG_0206643553052665756e-68
PHYCA_570506467923513115797e-68
PPTG_1118139573592715781e-67
PITG_0461139573592715771e-67
PHYSO_29276239573582705762e-67
PHYCA_50436639573592715752e-67
PPTG_09853114837613086023e-67
PITG_14156114837473075996e-67
PHYCA_119381101612912795668e-67
PHYKE_224743555263325831e-66
PHYKE_505739573572715702e-66
PHYRA_76010142626473545902e-66
PPTG_0213292546652875902e-66
PHYSO_28907443555323075822e-66
PHYSO_515605142627732915953e-66
PHYCA_541730450833182705644e-66
PPTG_18534243535162745794e-66
PHYRA_83716114839603036014e-66
SPRG_0785566514202765707e-66
PITG_0511243556993255888e-66
PHYCA_54332474482962785591e-65
SDRG_173421262946302845831e-65
PHYSO_260691467924862985741e-65
H257_074771298526263025822e-65
PHYSO_341117114839002865952e-65
PHYCA_50427643556962665862e-65
PHYCA_10859142627313475846e-65
SDRG_0532939573752655606e-65
PPTG_06854201544862705696e-65
H310_1043739573842715608e-65
PHYCA_50505054413823065609e-65
PHALS_00921114836312865761e-64
PHYRA_84546140694062905611e-64
SPRG_142531298526102715742e-64
SPRG_0350639573792655572e-64
PITG_17832142627672935813e-64
PHYRA_7886892549052855854e-64
PHYSO_516459142695162865654e-64
PPTG_18615716756052995706e-64
PHYCA_547243451743672745536e-64
PYU1_G014939845866632675737e-64
SDRG_036551260163642745519e-64
PHYSO_421999146732942805451e-63
PYU1_G013198166073512805501e-63
HYAP_0566143556982665731e-63
PHYCA_125089142615232885631e-63
HYAP_0173273963722775511e-63
PPTG_16203140694032895531e-63
H257_1742266514262755551e-63
HYAP_14838114833232665462e-63
SPRG_078511260163932745512e-63
PITG_17840142695132865602e-63
PHYCA_569895454833192835443e-63
PHYKE_6708140763111735443e-63
PHALS_058365817322935723e-63
PPTG_00068142617413105723e-63
H310_0950566514272765533e-63
PYVX_23713806643752295483e-63
PHALS_0540943556982665703e-63
HYAP_0592154425653125606e-63
H257_0541839573702715466e-63
PPTG_00076142697442865707e-63
H310_095021260194202975507e-63
PHYCA_547239451733912745479e-63
CCA1915243557202675671e-62
PPTG_10361705215642975581e-62
PHYCA_553853142695132865542e-62
PPTG_07736439684312775482e-62
PPTG_00069142627652875672e-62
PHYSO_413418550203182775382e-62
PHYRA_8284743556962665615e-62
H257_174201260194232975437e-62
HYAP_0592254417833115647e-62
PHYRA_77814705175653045538e-62
PHYRA_77820705212512275288e-62
PPTG_1416954426872675599e-62
PHYRA_76005142697032905609e-62
PPTG_14170995077683065631e-61
SPRG_118321282966386155561e-61
PHYRA_7737954417733065621e-61
PHYCA_55944218092942805301e-61
PHYRA_7738054426902715572e-61
PHYSO_520489595356082765522e-61
PHALS_0963418623532775342e-61
PPTG_10350384385932825512e-61
PHYRA_82925716756112845523e-61
PHYCA_509624444585672975493e-61
PHYCA_10526954426522725534e-61
HYAP_0172574483793295344e-61
PHALS_02415142627313145565e-61
SDRG_158651282966276195515e-61
PHYRA_83084717104942255425e-61
PHYCA_50516874045645175475e-61
PHYRA_95777199203142745285e-61
H257_174211464264062765356e-61
PHYCA_503450439684522835396e-61
PITG_0648154426582665518e-61
PHYCA_5705055814723205399e-61
PHYCA_129660431582892765249e-61
PHYCA_5724158893582745301e-60
PHYSO_5463455756723445511e-60
PHYCA_503455439704692835391e-60
SPRG_021801231514922295401e-60
PHYSO_354036534964372775361e-60
PHYSO_415772705214962285401e-60
SPRG_078561260194163015332e-60
PHYCA_118320421745272805412e-60
PHYCA_75205716752872785222e-60
PHYCA_563236454052892795222e-60
PHYSO_522417544118382725623e-60
PHYSO_53994418624632855353e-60
PHYRA_778178855522805403e-60
PHYRA_93564534963162775234e-60
PITG_0754963375452785404e-60
HYAP_0172274575462835394e-60
PHYSO_4765968895352275385e-60
PHYCA_503452534964352775315e-60
PHYCA_56899888744582715335e-60
PHYRA_80666711665552845396e-60
PPTG_0625873965282775377e-60
PHYCA_9190140143252675217e-60
PITG_06480544118563065597e-60
CCA23126114837992705507e-60
PITG_0889073965212775359e-60
PHYRA_728905817343155479e-60
PITG_18347146735472805371e-59
PHYRA_7357842388062255491e-59
PHYRA_81021503676095915401e-59
PPTG_2183374565792785381e-59
PHYSO_320857230616642315422e-59
H310_095031464264022775252e-59
PHYSO_47768563375262865342e-59
SPRG_056801249233392215202e-59
PHYRA_9577673964942765303e-59
PHALS_1432174575532865343e-59
SDRG_109351231517492295433e-59
HYAP_031275753992375224e-59
PHYCA_4583563374422275254e-59
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00004

Length=614
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00004                                                            1190       0.0   
PITG_17585                                                            1152       0.0   
PPTG_16188                                                            989        0.0   
PHYSO_520017                                                          753        0.0   
PHYRA_84559                                                           729        0.0   
PHYSO_518441                                                          726        0.0   
PPTG_16184                                                            704        0.0   
PHYCA_107224                                                          696        0.0   
PITG_17586                                                            694        0.0   
PHYSO_253195                                                          681        0.0   
HYAP_14440                                                            676        0.0   
PITG_20767                                                            671        0.0   
PHYRA_84551                                                           668        0.0   
PITG_17576                                                            664        0.0   
PPTG_16201                                                            662        0.0   
PPTG_16187                                                            658        0.0   
PHYCA_563934                                                          653        0.0   
PHYSO_520072                                                          652        0.0   
PPTG_16199                                                            647        0.0   
PHYRA_84553                                                           647        0.0   
PPTG_16185                                                            645        0.0   
PHYKE_3                                                               643        0.0   
PPTG_16186                                                            642        0.0   
PHYSO_337966                                                          639        0.0   
PHYSO_337952                                                          615        0.0   
PPTG_16190                                                            548        0.0   
PHYRA_84555                                                           526        2e-179
PPTG_16198                                                            522        5e-178
PHYSO_337957                                                          517        3e-176
PHYSO_325252                                                          517        3e-176
PPTG_16192                                                            508        5e-173
PHYCA_107484                                                          495        2e-172
PPTG_16193                                                            507        5e-172
PHYCA_107239                                                          471        4e-158
PHYSO_520885                                                          466        1e-156
PITG_00005                                                            443        2e-149
HYAP_14439                                                            422        3e-142
PHYSO_253201                                                          412        1e-136
PHYSO_337950                                                          410        1e-135
PITG_17583                                                            407        1e-134
PHYCA_533390                                                          403        6e-134
PHYSO_337959                                                          408        9e-134
PHYRA_84557                                                           381        2e-123
PHYCA_543946                                                          367        2e-122
PHYSO_519978                                                          374        1e-120
PHYSO_337956                                                          370        3e-120
PHYSO_324311                                                          370        1e-119
PHYRA_84554                                                           363        3e-116
PHYSO_563952                                                          361        2e-115
PHYSO_483581                                                          361        2e-115
PHYSO_520064                                                          358        4e-114
PHYSO_519624                                                          358        4e-114
PHYSO_485044                                                          358        4e-114
PPTG_09878                                                            355        6e-114
PITG_17577                                                            349        1e-112
PITG_17578                                                            347        2e-112
CCI41501                                                              352        1e-111
PHYSO_337967                                                          351        2e-111
PHYRA_84552                                                           351        5e-111
PITG_20766                                                            348        3e-110
PPTG_16200                                                            349        6e-110
PPTG_01981                                                            325        1e-105
PHYRA_84558                                                           296        2e-93 
PHYSO_520398                                                          298        3e-91 
PPTG_16191                                                            301        1e-90 
PITG_17582                                                            296        3e-90 
PHYRA_84556                                                           297        1e-89 
PPTG_01911                                                            279        3e-89 
HYAP_14441                                                            292        2e-87 
PHYCA_543949                                                          268        9e-86 
PPTG_16189                                                            276        2e-85 
PITG_17584                                                            271        8e-84 
PITG_17579                                                            271        5e-83 
PHYCA_107365                                                          261        4e-82 
PHYCA_543955                                                          257        1e-81 
PHYSO_337953                                                          262        5e-81 
PHYKE_1813                                                            258        2e-78 
PITG_07967                                                            258        3e-78 
PPTG_08473                                                            256        1e-77 
PHYCA_107158                                                          246        2e-77 
PHYSO_565433                                                          255        4e-77 
PHYSO_523359                                                          260        7e-77 
PHYCA_511282                                                          254        7e-77 
PHALS_03626                                                           254        2e-76 
SDRG_05104                                                            256        1e-75 
PYVX_17951                                                            256        2e-75 
PHYRA_81273                                                           250        2e-75 
PPTG_08474                                                            252        2e-75 
PHYCA_511287                                                          251        7e-75 
HYAP_03658                                                            250        9e-75 
PHYKE_9428                                                            249        2e-74 
SDRG_05099                                                            252        2e-74 
PITG_07968                                                            249        4e-74 
H310_07620                                                            251        1e-73 
PHYSO_529022                                                          248        1e-73 
PHYRA_81274                                                           247        2e-73 
PYVX_17944                                                            249        1e-72 
SPRG_08302                                                            247        2e-72 
SDRG_05105                                                            244        1e-71 
CCA21936                                                              239        2e-71 
CCA24786                                                              239        2e-71 
CCA19358                                                              243        2e-70 
PPTG_17293                                                            234        6e-70 
SDRG_05454                                                            239        1e-68 
CCI41041                                                              231        2e-68 
PHYRA_72889                                                           229        2e-68 
SPRG_05981                                                            238        3e-68 
PYAR_13094                                                            231        4e-68 
PHYRA_74873                                                           228        4e-68 
PPTG_06851                                                            225        4e-68 
PHYCA_122066                                                          227        5e-68 
HYAP_09438                                                            228        5e-68 
PPTG_02066                                                            226        6e-68 
PHYCA_570506                                                          227        7e-68 
PPTG_11181                                                            227        1e-67 
PITG_04611                                                            226        1e-67 
PHYSO_292762                                                          226        2e-67 
PHYCA_504366                                                          226        2e-67 
PPTG_09853                                                            236        3e-67 
PITG_14156                                                            235        6e-67 
PHYCA_119381                                                          222        8e-67 
PHYKE_2247                                                            229        1e-66 
PHYKE_5057                                                            224        2e-66 
PHYRA_76010                                                           231        2e-66 
PPTG_02132                                                            231        2e-66 
PHYSO_289074                                                          228        2e-66 
PHYSO_515605                                                          233        3e-66 
PHYCA_541730                                                          221        4e-66 
PPTG_18534                                                            227        4e-66 
PHYRA_83716                                                           236        4e-66 
SPRG_07855                                                            224        7e-66 
PITG_05112                                                            231        8e-66 
PHYCA_543324                                                          219        1e-65 
SDRG_17342                                                            229        1e-65 
PHYSO_260691                                                          225        1e-65 
H257_07477                                                            228        2e-65 
PHYSO_341117                                                          233        2e-65 
PHYCA_504276                                                          230        2e-65 
PHYCA_10859                                                           229        6e-65 
SDRG_05329                                                            220        6e-65 
PPTG_06854                                                            223        6e-65 
H310_10437                                                            220        8e-65 
PHYCA_505050                                                          220        9e-65 
PHALS_00921                                                           226        1e-64 
PHYRA_84546                                                           220        1e-64 
SPRG_14253                                                            225        2e-64 
SPRG_03506                                                            219        2e-64 
PITG_17832                                                            228        3e-64 
PHYRA_78868                                                           229        4e-64 
PHYSO_516459                                                          222        4e-64 
PPTG_18615                                                            224        6e-64 
PHYCA_547243                                                          217        6e-64 
PYU1_G014939                                                          225        7e-64 
SDRG_03655                                                            216        9e-64 
PHYSO_421999                                                          214        1e-63 
PYU1_G013198                                                          216        1e-63 
HYAP_05661                                                            225        1e-63 
PHYCA_125089                                                          221        1e-63 
HYAP_01732                                                            216        1e-63 
PPTG_16203                                                            217        1e-63 
H257_17422                                                            218        1e-63 
HYAP_14838                                                            214        2e-63 
SPRG_07851                                                            216        2e-63 
PITG_17840                                                            220        2e-63 
PHYCA_569895                                                          214        3e-63 
PHYKE_6708                                                            214        3e-63 
PHALS_05836                                                           224        3e-63 
PPTG_00068                                                            224        3e-63 
H310_09505                                                            217        3e-63 
PYVX_23713                                                            215        3e-63 
PHALS_05409                                                           224        3e-63 
HYAP_05921                                                            220        6e-63 
H257_05418                                                            214        6e-63 
PPTG_00076                                                            224        7e-63 
H310_09502                                                            216        7e-63 
PHYCA_547239                                                          215        9e-63 
CCA19152                                                              223        1e-62 
PPTG_10361                                                            219        1e-62 
PHYCA_553853                                                          218        2e-62 
PPTG_07736                                                            215        2e-62 
PPTG_00069                                                            223        2e-62 
PHYSO_413418                                                          211        2e-62 
PHYRA_82847                                                           220        5e-62 
H257_17420                                                            213        7e-62 
HYAP_05922                                                            221        7e-62 
PHYRA_77814                                                           217        8e-62 
PHYRA_77820                                                           207        8e-62 
PPTG_14169                                                            219        9e-62 
PHYRA_76005                                                           220        9e-62 
PPTG_14170                                                            221        1e-61 
SPRG_11832                                                            218        1e-61 
PHYRA_77379                                                           221        1e-61 
PHYCA_55944                                                           208        1e-61 
PHYRA_77380                                                           219        2e-61 
PHYSO_520489                                                          217        2e-61 
PHALS_09634                                                           210        2e-61 
PPTG_10350                                                            216        2e-61 
PHYRA_82925                                                           217        3e-61 
PHYCA_509624                                                          216        3e-61 
PHYCA_105269                                                          217        4e-61 
HYAP_01725                                                            210        4e-61 
PHALS_02415                                                           218        5e-61 
SDRG_15865                                                            216        5e-61 
PHYRA_83084                                                           213        5e-61 
PHYCA_505168                                                          215        5e-61 
PHYRA_95777                                                           207        5e-61 
H257_17421                                                            210        6e-61 
PHYCA_503450                                                          212        6e-61 
PITG_06481                                                            216        8e-61 
PHYCA_570505                                                          212        9e-61 
PHYCA_129660                                                          206        9e-61 
PHYCA_572415                                                          208        1e-60 
PHYSO_546345                                                          216        1e-60 
PHYCA_503455                                                          212        1e-60 
SPRG_02180                                                            212        1e-60 
PHYSO_354036                                                          211        1e-60 
PHYSO_415772                                                          212        1e-60 
SPRG_07856                                                            209        2e-60 
PHYCA_118320                                                          213        2e-60 
PHYCA_75205                                                           205        2e-60 
PHYCA_563236                                                          205        2e-60 
PHYSO_522417                                                          221        3e-60 
PHYSO_539944                                                          210        3e-60 
PHYRA_77817                                                           212        3e-60 
PHYRA_93564                                                           206        4e-60 
PITG_07549                                                            212        4e-60 
HYAP_01722                                                            212        4e-60 
PHYSO_476596                                                          211        5e-60 
PHYCA_503452                                                          209        5e-60 
PHYCA_568998                                                          209        5e-60 
PHYRA_80666                                                           212        6e-60 
PPTG_06258                                                            211        7e-60 
PHYCA_9190                                                            205        7e-60 
PITG_06480                                                            219        7e-60 
CCA23126                                                              216        7e-60 
PITG_08890                                                            210        9e-60 
PHYRA_72890                                                           215        9e-60 
PITG_18347                                                            211        1e-59 
PHYRA_73578                                                           216        1e-59 
PHYRA_81021                                                           212        1e-59 
PPTG_21833                                                            211        1e-59 
PHYSO_320857                                                          213        2e-59 
H310_09503                                                            206        2e-59 
PHYSO_477685                                                          210        2e-59 
SPRG_05680                                                            204        2e-59 
PHYRA_95776                                                           208        3e-59 
PHALS_14321                                                           210        3e-59 
SDRG_10935                                                            213        3e-59 
HYAP_03127                                                            205        4e-59 
PHYCA_45835                                                           206        4e-59 
PITG_08967                                                            209        5e-59 
PPTG_01910                                                            195        5e-59 
PHYCA_106047                                                          205        6e-59 
PHALS_13547                                                           209        7e-59 
PHYRA_77670                                                           209        8e-59 
HYAP_02510                                                            209        8e-59 
PPTG_10370                                                            209        8e-59 
PHYCA_106001                                                          201        9e-59 
PHYKE_8150                                                            200        1e-58 
PPTG_21832                                                            208        1e-58 
CCI48517                                                              213        1e-58 
PHYCA_128924                                                          208        1e-58 
PHYCA_106045                                                          208        1e-58 
PPTG_08125                                                            212        1e-58 
HYAP_01680                                                            211        1e-58 
PPTG_11363                                                            209        2e-58 
PPTG_06246                                                            210        2e-58 
PITG_01017                                                            205        2e-58 
PHYRA_82498                                                           207        2e-58 
H257_04258                                                            211        3e-58 
PITG_19256                                                            200        3e-58 
PHYSO_470718                                                          206        3e-58 
PHYSO_515035                                                          206        3e-58 
PHYSO_518438                                                          197        4e-58 
PHYRA_79691                                                           207        4e-58 
PHYSO_543580                                                          199        4e-58 
PITG_17252                                                            207        4e-58 
PHYRA_80665                                                           214        5e-58 
H310_07804                                                            206        5e-58 
PHYSO_418557                                                          203        5e-58 
PITG_00646                                                            210        5e-58 
PHYKE_2403                                                            206        5e-58 
PHYSO_472133                                                          207        5e-58 
PHYCA_126097                                                          202        6e-58 
PYVX_22802                                                            208        6e-58 
PITG_01002                                                            206        6e-58 
PPTG_10355                                                            206        7e-58 
PHYSO_513011                                                          206        7e-58 
PITG_08888                                                            210        7e-58 
PITG_08957                                                            207        7e-58 
SPRG_09612                                                            202        8e-58 
PHYRA_76294                                                           204        8e-58 
PHYRA_80633                                                           208        8e-58 
PHALS_12946                                                           208        1e-57 
PITG_10780                                                            203        1e-57 
SPRG_03075                                                            206        1e-57 
PPTG_07734                                                            207        1e-57 
PHYSO_563622                                                          208        1e-57 
HYAP_01679                                                            204        1e-57 
PPTG_01723                                                            209        1e-57 
PPTG_15084                                                            207        1e-57 
PYVX_22303                                                            205        2e-57 
PHYRA_87701                                                           195        2e-57 
PHYCA_562574                                                          204        2e-57 
PITG_08898                                                            207        2e-57 
PHYCA_6225                                                            196        2e-57 
PPTG_10018                                                            205        2e-57 
PPTG_06848                                                            202        3e-57 
PPTG_06260                                                            208        3e-57 
PHYCA_10461                                                           202        3e-57 
PITG_17357                                                            204        3e-57 
PHYRA_77819                                                           204        4e-57 
PHALS_05686                                                           207        4e-57 
PHYSO_540589                                                          195        4e-57 
PHYRA_77816                                                           204        4e-57 
PPTG_10354                                                            203        5e-57 
PHYRA_75794                                                           201        5e-57 
PHYRA_73247                                                           205        5e-57 
PHYCA_550540                                                          196        5e-57 
PHYSO_335179                                                          204        5e-57 
PPTG_11454                                                            204        7e-57 
PITG_00643                                                            209        7e-57 
PHYCA_101485                                                          201        7e-57 
H310_04787                                                            204        9e-57 
PHYRA_77669                                                           203        1e-56 
PHYRA_72888                                                           210        1e-56 
PPTG_08129                                                            204        1e-56 
PHYSO_474546                                                          202        1e-56 
PITG_00640                                                            205        1e-56 
SPRG_14246                                                            204        1e-56 
PHYKE_9028                                                            206        1e-56 
PPTG_10353                                                            202        1e-56 
CCA15806                                                              207        1e-56 
PPTG_10369                                                            202        1e-56 
PPTG_08127                                                            209        2e-56 
PITG_17831                                                            201        2e-56 
PPTG_06194                                                            204        2e-56 
PHYSO_337522                                                          206        2e-56 
PHYRA_72884                                                           206        2e-56 
CCI43480                                                              205        2e-56 
PHALS_00561                                                           203        2e-56 
SDRG_12259                                                            198        3e-56 
PHYCA_105110                                                          195        3e-56 
PPTG_06257                                                            200        3e-56 
H257_13799                                                            201        3e-56 
PHYCA_8440                                                            202        4e-56 
PPTG_11277                                                            202        4e-56 
PPTG_22589                                                            207        4e-56 
PHYRA_87904                                                           194        4e-56 
PHYCA_56389                                                           199        5e-56 
SPRG_11076                                                            194        5e-56 
PHYCA_122693                                                          201        5e-56 
SPRG_03077                                                            200        5e-56 
HYAP_13907                                                            196        6e-56 
PHYRA_80659                                                           207        6e-56 
SDRG_07165                                                            204        7e-56 
HYAP_03125                                                            207        8e-56 
PHYSO_506773                                                          206        9e-56 
PYIR_21456                                                            196        1e-55 
PHYCA_542625                                                          201        1e-55 
PPTG_10360                                                            200        1e-55 
H310_05900                                                            203        1e-55 
PITG_09664                                                            204        1e-55 
H310_08715                                                            202        1e-55 
PITG_08968                                                            199        2e-55 
SDRG_02945                                                            197        2e-55 
PITG_17495                                                            199        2e-55 
PHYRA_85819                                                           203        3e-55 
PHYRA_80624                                                           203        3e-55 
PHYKE_9600                                                            193        3e-55 
PHALS_07056                                                           206        3e-55 
PHALS_13127                                                           189        3e-55 
H310_07843                                                            195        3e-55 
SDRG_00883                                                            199        3e-55 
SPRG_03241                                                            196        3e-55 
H257_08281                                                            201        4e-55 
H257_13792                                                            198        4e-55 
PHALS_04459                                                           197        5e-55 
PHYCA_118938                                                          204        6e-55 
HYAP_08539                                                            199        6e-55 
PYIW_25432                                                            192        6e-55 
PITG_17571                                                            198        7e-55 
PHYCA_106077                                                          188        7e-55 
CCA15593                                                              196        7e-55 
CCA16348                                                              196        7e-55 
PHYSO_519560                                                          199        8e-55 
PHYSO_343499                                                          202        9e-55 
PYAP_19427                                                            191        9e-55 
PPTG_14643                                                            201        1e-54 
PHYCA_112396                                                          192        1e-54 
PPTG_11276                                                            197        1e-54 
PPTG_06717                                                            204        1e-54 
PHALS_14336                                                           198        2e-54 
PHYSO_347055                                                          202        2e-54 
PITG_06925                                                            197        2e-54 
CCI47779                                                              203        2e-54 
PITG_02124                                                            200        2e-54 
PHYKE_1427                                                            199        2e-54 
SDRG_07620                                                            195        2e-54 
PYVX_15888                                                            192        3e-54 
PHYCA_100849                                                          187        3e-54 
PPTG_01724                                                            199        3e-54 
SPRG_00235                                                            194        3e-54 
PHYCA_563952                                                          188        3e-54 
H257_09962                                                            196        4e-54 
PHYRA_84549                                                           202        4e-54 
PPTG_10363                                                            196        4e-54 
PPTG_14140                                                            194        4e-54 
PHYCA_35810                                                           188        4e-54 
PHYRA_84550                                                           202        4e-54 
SPRG_04655                                                            192        4e-54 
PHALS_05692                                                           197        5e-54 
PHYSO_534637                                                          196        5e-54 
PHYSO_532919                                                          196        6e-54 
PHYRA_73424                                                           186        6e-54 
H310_08166                                                            190        7e-54 
H257_03172                                                            196        7e-54 
PPTG_02401                                                            191        8e-54 
PHYCA_117114                                                          195        8e-54 
PHYRA_75692                                                           198        1e-53 
PHYSO_337442                                                          195        1e-53 
PITG_06286                                                            191        1e-53 
SDRG_16928                                                            193        1e-53 
H310_12939                                                            194        1e-53 
H310_07796                                                            193        1e-53 
SDRG_00885                                                            194        1e-53 
SDRG_01024                                                            197        1e-53 
HYAP_14295                                                            191        1e-53 
PHYRA_74479                                                           191        1e-53 
H310_07803                                                            193        1e-53 
SDRG_07159                                                            200        2e-53 
H257_18714                                                            191        2e-53 
PPTG_01145                                                            196        2e-53 
PITG_14972                                                            198        2e-53 
PITG_02119                                                            193        2e-53 
PPTG_09207                                                            196        2e-53 
PPTG_11455                                                            195        2e-53 
SPRG_12231                                                            187        2e-53 
SPRG_05673                                                            199        2e-53 
SPRG_09620                                                            199        2e-53 
PHYSO_512254                                                          197        2e-53 
PITG_10971                                                            190        3e-53 
SDRG_12348                                                            194        3e-53 
PPTG_14638                                                            193        3e-53 
PITG_17575                                                            197        3e-53 
PHYRA_83112                                                           197        3e-53 
SPRG_11580                                                            191        3e-53 
PHALS_04784                                                           197        3e-53 
PHYRA_79668                                                           194        3e-53 
HYAP_06258                                                            190        3e-53 
H257_13791                                                            192        3e-53 
PHYCA_100619                                                          192        3e-53 
PITG_23090                                                            196        4e-53 
SPRG_06057                                                            196        4e-53 
SPRG_08298                                                            185        4e-53 
PHYRA_95588                                                           199        4e-53 
H257_09180                                                            189        4e-53 
H310_07802                                                            193        4e-53 
PHYSO_499386                                                          191        5e-53 
H310_12630                                                            192        5e-53 
PHYCA_106917                                                          193        5e-53 
PHYCA_6116                                                            185        6e-53 
PHYRA_81631                                                           194        7e-53 
H310_03248                                                            196        7e-53 
PPTG_16207                                                            192        8e-53 
SPRG_02311                                                            196        8e-53 
SPRG_09124                                                            192        8e-53 
PHYSO_467397                                                          183        9e-53 
PHYSO_335699                                                          196        9e-53 
PHYRA_73421                                                           196        9e-53 
PITG_08901                                                            191        1e-52 
H310_05564                                                            194        1e-52 
PITG_23109                                                            192        1e-52 
SPRG_14770                                                            190        1e-52 
PPTG_16599                                                            193        1e-52 
SDRG_11061                                                            195        1e-52 
PHYRA_80636                                                           191        2e-52 
PPTG_14637                                                            193        2e-52 
H310_00232                                                            194        2e-52 
CCI46758                                                              195        2e-52 
H257_10805                                                            194        2e-52 
H257_03993                                                            190        2e-52 
HYAP_13262                                                            184        2e-52 
SDRG_10000                                                            189        3e-52 
CCI39781                                                              197        3e-52 
PPTG_06243                                                            190        3e-52 
PPTG_01986                                                            194        3e-52 
PHYSO_563616                                                          190        3e-52 
H310_07797                                                            190        4e-52 
H310_07805                                                            189        4e-52 
PHALS_01863                                                           187        4e-52 
H310_12631                                                            193        4e-52 
PHYCA_17500                                                           188        4e-52 
SDRG_12761                                                            193        4e-52 
PHYSO_556648                                                          187        4e-52 
SPRG_12234                                                            188        4e-52 
H257_00995                                                            195        4e-52 
H310_09542                                                            190        5e-52 
SDRG_00886                                                            188        6e-52 
PHYRA_75691                                                           196        6e-52 

>PITG_00004
Length=614

 Score = 1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/614 (100%), Positives = 614/614 (100%), Gaps = 0/614 (0%)

Query  1    MRVSGllsilaatlttaQDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRH  60
            MRVSGLLSILAATLTTAQDYTITFRSLEEQDPESSSLPSDFSFDFDGTNSDIARQLYTRH
Sbjct  1    MRVSGLLSILAATLTTAQDYTITFRSLEEQDPESSSLPSDFSFDFDGTNSDIARQLYTRH  60

Query  61   RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120
            RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT
Sbjct  61   RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
            GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA
Sbjct  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180

Query  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG  240
            KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG
Sbjct  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG  240

Query  241  YSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDElllipillsss  300
            YSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDELLLIPILLSSS
Sbjct  241  YSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDELLLIPILLSSS  300

Query  301  CCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL  360
            CCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL
Sbjct  301  CCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL  360

Query  361  GNRIPYESLSFQMELSKAASGEAWICQYGRPTAFAEEIELTASLIHPHIVKFIGVAWNSL  420
            GNRIPYESLSFQMELSKAASGEAWICQYGRPTAFAEEIELTASLIHPHIVKFIGVAWNSL
Sbjct  361  GNRIPYESLSFQMELSKAASGEAWICQYGRPTAFAEEIELTASLIHPHIVKFIGVAWNSL  420

Query  421  SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKS  480
            SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKS
Sbjct  421  SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKS  480

Query  481  NNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL  540
            NNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL
Sbjct  481  NNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL  540

Query  541  SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS  600
            SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS
Sbjct  541  SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS  600

Query  601  DRPTAQELIQWLEG  614
            DRPTAQELIQWLEG
Sbjct  601  DRPTAQELIQWLEG  614

>PITG_17585
Length=655

 Score = 1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/655 (92%), Positives = 605/655 (92%), Gaps = 41/655 (6%)

Query  1    MRVSGllsilaatlttaQDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRH  60
            MRVSGLLSILAATLTTAQDYTITFRSLEEQDP SSSLPSD SFDFDGTNSDIARQLYTRH
Sbjct  1    MRVSGLLSILAATLTTAQDYTITFRSLEEQDPGSSSLPSDSSFDFDGTNSDIARQLYTRH  60

Query  61   RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120
            RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT
Sbjct  61   RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
            GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA
Sbjct  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180

Query  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG  240
            KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG
Sbjct  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG  240

Query  241  YSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDEl----------  290
            YSSLIVPCHKRSEFSDAEMAAVNKP+GSEWVTMWLKDEFAVGDSSGFDEL          
Sbjct  241  YSSLIVPCHKRSEFSDAEMAAVNKPKGSEWVTMWLKDEFAVGDSSGFDELLLIPILLVVA  300

Query  291  -------------llipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSH  337
                          ++    SSSCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSH
Sbjct  301  AAMGMGWFCWKRHAMLKREQSSSCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSH  360

Query  338  QGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG-RPTA---  393
            QGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSK ASGEAWICQYG +P A   
Sbjct  361  QGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKGASGEAWICQYGGQPVAVKK  420

Query  394  --------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL  439
                          FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL
Sbjct  421  LLHTKDQKADDVQAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL  480

Query  440  HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVS  499
            HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVS
Sbjct  481  HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVS  540

Query  500  RGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA  559
            RGVMDLTMTAGVGTPYWTAPEVLEGARYSE+ADIYSFGVVLSELDTGRIPYFDTVDHDGA
Sbjct  541  RGVMDLTMTAGVGTPYWTAPEVLEGARYSEEADIYSFGVVLSELDTGRIPYFDTVDHDGA  600

Query  560  KLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            KLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG
Sbjct  601  KLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  655

>PPTG_16188
Length=657

 Score = 989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/654 (78%), Positives = 545/654 (83%), Gaps = 43/654 (7%)

Query  1    MRVSGllsilaatlttaQDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRH  60
            MR+ GLL I+AATLTTAQDYTITFRSLEE+DP   SLPSD SF FDGTNSDIA+QLY RH
Sbjct  1    MRLPGLLPIIAATLTTAQDYTITFRSLEEEDP--LSLPSDSSFVFDGTNSDIAQQLYIRH  58

Query  61   RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120
            ++GDTSAAVSI S+PTAVTDRLD LKI FT LPGLVQ AVLWDTGFG SP GD VQIWT 
Sbjct  59   QAGDTSAAVSINSIPTAVTDRLDPLKITFTDLPGLVQRAVLWDTGFGFSPTGDAVQIWTI  118

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
            GD+TMADIAV  DDIT VNCTMLECPQPND PAYSSQYCSGTQILNVSRC+VDTFEDSGA
Sbjct  119  GDYTMADIAVPQDDITKVNCTMLECPQPNDIPAYSSQYCSGTQILNVSRCVVDTFEDSGA  178

Query  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG  240
             DFLG+MWSTGGD+TMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS DDPTWNQCP N+G
Sbjct  179  SDFLGVMWSTGGDSTMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSVDDPTWNQCPANDG  238

Query  241  YSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDE-----------  289
            YSSLIVPCHKRSEF+DAEMAA+ +P GS WVT WLKDEFAV DS GF+E           
Sbjct  239  YSSLIVPCHKRSEFTDAEMAALTRPTGSAWVTTWLKDEFAVEDS-GFEELLLIPVILVVI  297

Query  290  -----------lllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQ  338
                          +     +S CDFDVVSPNYL VV HEQA R TV TTSYGPSISSH 
Sbjct  298  ATMGIGWFCWKRSSMLKREQASSCDFDVVSPNYLDVVTHEQALRRTVTTTSYGPSISSHP  357

Query  339  GDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRP-------  391
             DYESAGSNQT KILLHSQHL GNRIPY+SL FQ ELSK ASGE WIC+YG         
Sbjct  358  DDYESAGSNQTLKILLHSQHLHGNRIPYDSLVFQTELSKGASGEVWICRYGGQEVAVKKL  417

Query  392  -----------TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH  440
                         FAEEIELTASLIHPHIVKFIGVAWNSLSNLS+VLE+V  G+L+ +LH
Sbjct  418  LHTRDQKAEDVQVFAEEIELTASLIHPHIVKFIGVAWNSLSNLSLVLEYVPRGNLRDYLH  477

Query  441  KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR  500
             NSD+LSWA DRI+MA+AVAEALEYLHSR+PAIIHRDLKSNNILLTE LDPKLIDFGVSR
Sbjct  478  TNSDILSWARDRIFMAIAVAEALEYLHSRTPAIIHRDLKSNNILLTESLDPKLIDFGVSR  537

Query  501  GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAK  560
            G+MDLTMTAGVGTPYWTAPE+LEG RY+EKADIYSFGVVLSELDTGRIPYFD V+ DG +
Sbjct  538  GMMDLTMTAGVGTPYWTAPEILEGDRYTEKADIYSFGVVLSELDTGRIPYFDAVEDDGTR  597

Query  561  LMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            LMPFQILQEVM GTLRPSFS DCPPRIQRI AACLSF+PSDRPTAQELIQWLEG
Sbjct  598  LMPFQILQEVMTGTLRPSFSADCPPRIQRIGAACLSFEPSDRPTAQELIQWLEG  651

>PHYSO_520017
Length=661

 Score = 753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/639 (59%), Positives = 459/639 (72%), Gaps = 43/639 (7%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            QDYTITFRS+EE  P  S           GTNSDIA+QLY RH++GD  AA+ +  +P  
Sbjct  22   QDYTITFRSVEEAFPSPSPTNDSSFVFD-GTNSDIAQQLYIRHQAGDVEAALELNFIPAF  80

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            V  RLD L I+F  LPGLVQ A+LWD+GF ISP+ DPVQIWT  ++TMA+I+V   DI  
Sbjct  81   VAKRLDPLFISFKDLPGLVQRALLWDSGFAISPDNDPVQIWTMENYTMANISVPQQDIAE  140

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
            VNCTMLECPQPN  PAYSSQYC+G+QILNVSRC+ DTFEDSGA  +LG+MWSTGG A MT
Sbjct  141  VNCTMLECPQPNSEPAYSSQYCTGSQILNVSRCVADTFEDSGASGYLGVMWSTGGSANMT  200

Query  198  PHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDA  257
            P IRLRDH+W EPTTG +Y +YA+HT SSADDPTWNQCP N GYSSL+VPCHKRSEF+D 
Sbjct  201  PLIRLRDHSWVEPTTGDAYELYAIHTESSADDPTWNQCPANGGYSSLVVPCHKRSEFTDK  260

Query  258  EMAAVNKPRGSEWVTMWLKDEFAV-----------------------GDSSGFDElllip  294
            ++AA+ KP GS WVT WL++EFAV                       G   G        
Sbjct  261  DIAAMTKPAGSNWVTNWLREEFAVKKPRFNKLLLIPIILGSLVTVAAGAFVGVYLKRRAK  320

Query  295  illsssCCDFDVVSPNYLGVVAHEQARRGTVAT-TSYGPSISSHQGDYESAGSNQTFKIL  353
                    D++    +Y+   +++      ++T  SY  S SS   +YES GSNQTF+IL
Sbjct  321  RRNGEVPDDYEAFQHHYVAGESYDAVTSPVMSTDPSYAFSSSSRAENYESVGSNQTFRIL  380

Query  354  LHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFA  395
            LHS HL GNRIPY++L F+ +LS+  SG  W+C+YG                     +FA
Sbjct  381  LHSPHLHGNRIPYDNLVFESKLSRGGSGVVWLCKYGGQQVAAKKLLLTRGVKADDVQSFA  440

Query  396  EEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYM  455
            EEIELTASL+HP+IVKFIGVAWN+L+NLSMV+E+V  G+L+ +L KN  +LSWA D+I++
Sbjct  441  EEIELTASLVHPYIVKFIGVAWNNLTNLSMVIEYVPNGNLRDYLEKNIRILSWARDKIHI  500

Query  456  AVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPY  515
            A+A+AEALEYLHSR+P +IHRDLK NNILLT+ L+PKL DFGVSR ++D TMT+GVGTPY
Sbjct  501  AIAIAEALEYLHSRTPGVIHRDLKFNNILLTKHLEPKLTDFGVSRNMIDSTMTSGVGTPY  560

Query  516  WTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTL  575
            WTAPE+LEG RY+EK+DIYSFGVVLSELDTGRIPY D V  DG+K+ PF ILQEVMAG +
Sbjct  561  WTAPEILEGDRYTEKSDIYSFGVVLSELDTGRIPYSDAVMEDGSKVRPFHILQEVMAGAM  620

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            RP+FS DCPPRIQRI AACLS DP  RPTA+EL+  L G
Sbjct  621  RPNFSRDCPPRIQRIGAACLSLDPRKRPTARELVLELLG  659

>PHYRA_84559
Length=2650

 Score = 729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/616 (59%), Positives = 434/616 (70%), Gaps = 50/616 (8%)

Query  47    GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
             GTNSDIARQLY RH +GDT   V + S+P AV  RLD   I F  LPGLVQ AVLWDTGF
Sbjct  1329  GTNSDIARQLYVRHSAGDTDDQVKLNSIPRAVAGRLDPFNIVFNDLPGLVQRAVLWDTGF  1388

Query  107   GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             GISP  D VQIWT GD TMA+IAV  DD+ +  CT   C QP+D  AY +  CSG Q+L+
Sbjct  1389  GISPGNDAVQIWTKGDHTMAEIAVPKDDVADAKCTFKNCSQPDDETAYYTLICSGDQMLS  1448

Query  167   VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             VSRC+VDTF+D+GA +F+G MWS GGD  M P IRLRDHTWT+P +  +++VYAVHTVS 
Sbjct  1449  VSRCVVDTFQDTGALNFMGAMWSRGGDPDMAPMIRLRDHTWTDPVSNDTFTVYAVHTVSG  1508

Query  227   ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG  286
             A+D  WN+CP +NGY SL +PCH+RSE++D E+AA+  P GS WVT WL+DEFAV   +G
Sbjct  1509  AEDVAWNECPASNGYGSLSIPCHRRSEYTDNEIAALTTPAGSAWVTAWLEDEFAV--DTG  1566

Query  287   FD---------------------------ElllipillsssCCDFDVVSPNYLGVVAHEQ  319
              D                             +      + + CD  V SP Y G    + 
Sbjct  1567  VDTLMLILLIAGTLVLIGAIGLGWYCWRHRSMRKEEYTAPTICDLSVPSPGYHGGGTPDL  1626

Query  320   --ARRGTVATT--SYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMEL  375
               A RGT A+T  +   SI S+ GD+ESAGSN T KILL S HL G RIPYESL+FQ  +
Sbjct  1627  GLALRGTTASTRPTGQSSIFSYSGDFESAGSNNTLKILLDSYHLYGKRIPYESLTFQKTI  1686

Query  376   SKAASGEAWICQYGRPT-----------------AFAEEIELTASLIHPHIVKFIGVAWN  418
             SK ASGE W+C Y                     AFAEEIEL+ASL+HP+IV+FIGVAWN
Sbjct  1687  SKGASGEVWLCLYNEQQVAVKRLLQSNQKADNVQAFAEEIELSASLVHPNIVEFIGVAWN  1746

Query  419   SLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
             SL+NL+MV+EF   G+LQ +L KN D+LSWA D+I+MA+ VA+AL+YLH+R PAIIHRDL
Sbjct  1747  SLNNLAMVIEFSPAGNLQTYLQKNIDLLSWARDKIHMAIGVAQALQYLHTRVPAIIHRDL  1806

Query  479   KSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGV  538
             KSNNILLT+ L+PKLIDFGVSRG+ DLTMTAGVGTPYWTAPE+LEG RY+ +ADIYSFGV
Sbjct  1807  KSNNILLTDRLEPKLIDFGVSRGLGDLTMTAGVGTPYWTAPEILEGKRYTVQADIYSFGV  1866

Query  539   VLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFD  598
             VLSELDTGRIPY+D     G K   FQILQ+VMAG LRPSFS DCPPRIQR+  ACL+FD
Sbjct  1867  VLSELDTGRIPYYDAATEGGGKAKSFQILQDVMAGMLRPSFSRDCPPRIQRVGLACLAFD  1926

Query  599   PSDRPTAQELIQWLEG  614
             PS RPTA +L++ LEG
Sbjct  1927  PSSRPTACQLVEELEG  1942

 Score = 723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/651 (57%), Positives = 452/651 (69%), Gaps = 67/651 (10%)

Query  20    YTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVT  79
             +TI+ RSLE   P         SF FDGTNSDIA+QLY RH++GD+  AV++ SVPTAV+
Sbjct  2000  HTISLRSLEATSP-------TSSFVFDGTNSDIAQQLYIRHKAGDSEDAVALNSVPTAVS  2052

Query  80    DRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVN  139
              RL+   +A + LPGLVQ AVLWD+GF ISP+ DPVQIWT GD+TMADIAV  +++++V 
Sbjct  2053  TRLNRFNVALSELPGLVQRAVLWDSGFAISPSNDPVQIWTKGDYTMADIAVPKEEVSDVG  2112

Query  140   CTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPH  199
             CT   C QPND  A+ +  CSG Q+LNVSRC+ DTF DS A  ++G MWS GGD+ MTPH
Sbjct  2113  CTFKNCSQPNDEMAFYTLICSGEQMLNVSRCVADTFVDSAASSYMGSMWSRGGDSGMTPH  2172

Query  200   IRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEM  259
             IRLRDH+W +P T  +YSVYAVHT SSA+DP WN CPV++ Y+++ VPCH+R EFSD EM
Sbjct  2173  IRLRDHSWEDPVTKAAYSVYAVHTASSAEDPAWNVCPVDDKYTAMTVPCHRRDEFSDEEM  2232

Query  260   AAVNKPRGSEWVTMWLKDEFAVGDSSGFD-------------------------Elllip  294
             AA+  P GS WVT WL++EFA    SGFD                               
Sbjct  2233  AAMTTPTGSAWVTAWLQEEFAA--DSGFDTLLLLPIIVGAVALVAAIGLGWVCWRRRAKG  2290

Query  295   illsssCCDFDVVS-------------PNYLGVVAHEQARRGTVATTSYGPSISSHQGDY  341
              +  +     D+ S             PNY   +A E A R T+ TT     +SSH   Y
Sbjct  2291  KIEETMSTTGDLCSSSPLYLSGSTIPVPNYAAEMA-EPALRPTIMTTQ-STFLSSHLEGY  2348

Query  342   ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-------------  388
             ESAGS +T KILL S HL G R+PYESL  Q  LSK +SGE W+  Y             
Sbjct  2349  ESAGSCRTLKILLGSHHLQGKRLPYESLMLQTTLSKGSSGEIWLSAYNGRKVAAKRLLQS  2408

Query  389   -----GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
                  G   AFAEEIELTASL HPHIV+FIGVAWN+L+NL MVLEFV  G LQ +LH+N+
Sbjct  2409  KDQKAGNVQAFAEEIELTASLTHPHIVEFIGVAWNNLNNLVMVLEFVPNGSLQSYLHQNA  2468

Query  444   DVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVM  503
             D+LSWA D+I+MAV +A+AL+YLH  SP +IHRDLKSNNILLT+ L+PKLIDFGVSRG +
Sbjct  2469  DLLSWARDKIHMAVGIAQALDYLHGHSPPLIHRDLKSNNILLTDMLEPKLIDFGVSRGRI  2528

Query  504   DLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP  563
             DLTMTAG+GTPYWTAPEVLEG+RY+E+ADIYSFGVVLSELDTGRIPYFD V   G+KL P
Sbjct  2529  DLTMTAGIGTPYWTAPEVLEGSRYTEQADIYSFGVVLSELDTGRIPYFDAVTEGGSKLKP  2588

Query  564   FQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
              QILQ+V++GTL+PSFS DC PRI+R+ +ACL+ DP+ RPTAQ+L++ L G
Sbjct  2589  VQILQDVVSGTLQPSFSADCAPRIRRVGSACLALDPASRPTAQQLVEELRG  2639

 Score = 657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/632 (56%), Positives = 427/632 (68%), Gaps = 96/632 (15%)

Query  1    MRVSGllsilaatlttaQDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRH  60
            MRV  L    A   +  +  TITFRSL E    SSSL SD SF FDGTNSDIA+QL+ RH
Sbjct  1    MRVDLLAVASAIVSSVVEAQTITFRSLVET--SSSSLASDASFVFDGTNSDIAQQLFLRH  58

Query  61   RSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120
            ++G T  AV++ S+PTAVTDRL  L+I F  LPGLVQ AVLWDTGF +SP  D VQIWT 
Sbjct  59   QAGCTGDAVTLSSIPTAVTDRLKPLEIDFGDLPGLVQRAVLWDTGFAVSPGNDAVQIWTM  118

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
             D+                                                  T  +SGA
Sbjct  119  KDY--------------------------------------------------TMANSGA  128

Query  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNG  240
             DFLG+MWSTGGD+ MTPH+RLRDH+WTEPTTG+SYSVYAVHT SSADDPTW+QCP ++G
Sbjct  129  TDFLGVMWSTGGDSAMTPHVRLRDHSWTEPTTGISYSVYAVHTSSSADDPTWSQCPASDG  188

Query  241  YSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDElllipillsss  300
            YSSLIVPCH+R EF+D EMAA+  P GS WVT WL+DEFA  +SSGF+EL          
Sbjct  189  YSSLIVPCHRRDEFTDGEMAAMTTPAGSAWVTTWLEDEFA-AESSGFNEL----------  237

Query  301  CCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL  360
                 ++ P  LG +A        +    +   + S   D    G      ILL+SQHL 
Sbjct  238  -----LLVPIILGSLA-------VIVVIRWLVLLESESND---EGGAVLVLILLYSQHLQ  282

Query  361  GNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIELTA  402
            GNR+PY+ L+F+ E+SK  SGE W+C+YG                     AFA+EIELTA
Sbjct  283  GNRLPYDRLTFKSEISKGGSGEVWLCEYGGGQVAVKKLLHTKEQKAEDVQAFAQEIELTA  342

Query  403  SLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEA  462
            SL+HP+IV+FIGVAWNSL+NL MVLE+V  G+L+ +LHK++ +LSWA D+I+MA  +AEA
Sbjct  343  SLVHPNIVRFIGVAWNSLNNLVMVLEYVPMGNLKNYLHKSAVLLSWARDKIHMATGIAEA  402

Query  463  LEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVL  522
            LEYLHSR+PAIIHRDLKSNNILL+ +L+PKLIDFGVSRG++DLTMTAGVGTPYW APEVL
Sbjct  403  LEYLHSRTPAIIHRDLKSNNILLSRNLEPKLIDFGVSRGLIDLTMTAGVGTPYWVAPEVL  462

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
            EG RY+EK DIYSFGVVLSELDTG+IPYFD V  DG K+ PFQ+L EVM+G+LRPS S +
Sbjct  463  EGNRYTEKGDIYSFGVVLSELDTGKIPYFDAVTADGTKMKPFQVLNEVMSGSLRPSLSDE  522

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            CPPRI+RI  ACLS DP+ RPTAQEL+  L G
Sbjct  523  CPPRIRRIGTACLSLDPASRPTAQELVDELGG  554

 Score = 611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/645 (52%), Positives = 417/645 (65%), Gaps = 68/645 (11%)

Query  18    QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
             Q  TIT  SL+E    SS   ++ SF F+GTNSDIARQLY RH +GD+   + + SVP A
Sbjct  591   QGGTITLESLDET--SSSVDRTNSSFVFNGTNSDIARQLYIRHNAGDSGDQIELTSVPPA  648

Query  78    VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
             V  RLD L I F  LPGLVQ AVLWDTGF I+    PVQI+   D TMA I V   ++ N
Sbjct  649   VIKRLDPLNIDFASLPGLVQRAVLWDTGFAIAAGNLPVQIYPKKDRTMASINVQMYEVFN  708

Query  138   VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
             V C    C QPN    Y S  C+G Q+LN S C++D F D+G+ ++LG MW+ GGD  + 
Sbjct  709   VQCKTTNCTQPNGEQTYYSFTCTGYQMLNTSHCVIDVFNDTGSTNYLGNMWAAGGDPDLV  768

Query  198   PHIRLRDHTWTEPTTGVS----YSVYAVHTVSSADDPTWNQCPVNNGYSS-LIVPCHKRS  252
             P I LRDHTWTE          +SVY VHTV+S D+  W +C +  GY S L VPCH+R 
Sbjct  769   PEIELRDHTWTENIAVFGGDTFFSVYVVHTVASRDEAPWGEC-LPKGYGSPLSVPCHRRD  827

Query  253   EFSDAEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFDElllipillsssCCDFDVVSPNY  311
             +FSD  MAA    P GS WVT WL+DEFA  + SGF++L+L+PILL              
Sbjct  828   QFSDEYMAANTTVPEGSAWVTTWLEDEFA--EDSGFNKLMLLPILLGVFVA---------  876

Query  312   LGVVAHEQARR-----------------GTVATTSYGPS-------------ISSHQGDY  341
             +GV    + RR                   +  T++G +             +S    DY
Sbjct  877   IGVAWFYRGRRTKLQEKLLPSTSTNLTGSRLGDTTHGSALTPIDMDSLILHGVSISSLDY  936

Query  342   ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT---------  392
             ESAGS++  +ILL S HL G RIPYE L F+  LSK ASGE WIC+Y             
Sbjct  937   ESAGSSKALQILLGSDHLHGKRIPYELLVFENALSKGASGEVWICEYNGQHVAAKRLLSA  996

Query  393   ---------AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
                      AFAEEIEL+A+LIHPHIV F+GVAWN+L NL +VLE++  G+LQ +L KN+
Sbjct  997   KKEQAETVHAFAEEIELSATLIHPHIVGFVGVAWNTLDNLVLVLEYLPMGNLQNYLEKNA  1056

Query  444   DVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVM  503
             D LSWA D+I++A+ +A AL+YLH R+P +IHRD+KS+NILLT+ L+PK+IDFGVSRG +
Sbjct  1057  DQLSWARDKIHIAIGIANALKYLHDRTPPLIHRDVKSSNILLTDALEPKIIDFGVSRGRV  1116

Query  504   DLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP  563
             + TMT G+GTPYW APEVLEG  Y+E+ADIYSFGVVLSELDTG+IPY D V  DG KL P
Sbjct  1117  EQTMTGGIGTPYWIAPEVLEGEHYTEQADIYSFGVVLSELDTGKIPYHDAVTEDGTKLKP  1176

Query  564   FQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
             F+IL EVM+GTLRPSF+ DCP RIQRI+ ACLS DPS RPTAQEL
Sbjct  1177  FRILNEVMSGTLRPSFAGDCPARIQRISTACLSLDPSSRPTAQEL  1221

>PHYSO_518441
Length=663

 Score = 726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/614 (59%), Positives = 428/614 (70%), Gaps = 46/614 (7%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQLYTRH++GDTS AVS+ SVP A++DRLD L I F  LPGLVQ AVLWDTGF
Sbjct  41   GTNSDIARQLYTRHKAGDTSDAVSLTSVPRALSDRLDPLGIKFDDLPGLVQRAVLWDTGF  100

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GISP  + VQIWT  +FTMADIA+   ++    CT   C QPND  AY +  CSG Q+L+
Sbjct  101  GISPTNNAVQIWTMDNFTMADIAIPKSEVGEAGCTFKNCSQPNDVTAYFTLICSGDQMLS  160

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            V+RC+ DTFED GA  +LG MWS G    + P IR+RDH WT+P +  SYSVYAVHTV S
Sbjct  161  VARCVADTFEDDGAAGYLGAMWSNGAAPDVAPLIRMRDHAWTDPVSNHSYSVYAVHTVPS  220

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG  286
            A D  WNQCP NNGY+S+ VPCH+R  +SD EMA +  P GSEWVT WL +EF   D++G
Sbjct  221  ALDVAWNQCPANNGYASVAVPCHRRDSYSDEEMATMTVPTGSEWVTTWLSEEFGTKDAAG  280

Query  287  FD--------------------------ElllipillsssCCDFDVVSPNYLGVVAHEQA  320
             +                            +  P L +S  CD    S  YL     E  
Sbjct  281  LNLLMLVLIILGVALIGAIVLGWCCWRRRAIHKPDLTASPACDLGADSTCYLDGGTPELP  340

Query  321  RRGTVATTSYGPSIS--SHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
             R T  +T     +S  SH  DYE+AGSN T  ILLHS HL G R+PYESLSF   LSK 
Sbjct  341  SRPTTYSTRATAQLSCFSHSEDYETAGSNATLAILLHSVHLQGRRVPYESLSFDKSLSKG  400

Query  379  ASGEAWICQYG------------------RPTAFAEEIELTASLIHPHIVKFIGVAWNSL  420
            ASGE WI  Y                      AFAEEIEL++SL+HPHIV+F+GVAWNSL
Sbjct  401  ASGEVWIGSYAGQQVAIKKLLQSTGQKAESVQAFAEEIELSSSLVHPHIVEFVGVAWNSL  460

Query  421  SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKS  480
            SNL+MV+EF   G+LQ +LHKN D+LSWA DR+ MAVA+A+AL+YLHSR P+IIHRDLKS
Sbjct  461  SNLAMVMEFFPRGNLQDYLHKNIDLLSWARDRVQMAVAIAQALQYLHSRPPSIIHRDLKS  520

Query  481  NNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL  540
            NNILLT+ L+PKLIDFGVSRG++DLTMTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVL
Sbjct  521  NNILLTDRLEPKLIDFGVSRGLVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVL  580

Query  541  SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS  600
            SELDTGRIPY D V   G K  PFQ+LQ+VMAG LRPSFS DCPPRIQRI  ACL+F+PS
Sbjct  581  SELDTGRIPYHDAVTEGGGKAKPFQVLQDVMAGKLRPSFSRDCPPRIQRIGLACLAFEPS  640

Query  601  DRPTAQELIQWLEG  614
             RPTA +LI+ LEG
Sbjct  641  SRPTASQLIEQLEG  654

>PPTG_16184
Length=656

 Score = 704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/623 (56%), Positives = 427/623 (69%), Gaps = 59/623 (9%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQLY RH++GDT A V++ +VPTAV +RL  L   F+ LPGLVQ AVLWDTGF
Sbjct  26   GTNSDIARQLYIRHKAGDTDAKVTLNAVPTAVANRLSDLNTQFSDLPGLVQRAVLWDTGF  85

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             +SP  DPVQIWT  D+TMADIAV  D+++   CT   C QPND  AY +  CSG Q++N
Sbjct  86   ALSPANDPVQIWTMNDYTMADIAVPKDEVSGEGCTFKNCTQPNDELAYYTLICSGAQMVN  145

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            VSRC+ DTF DS A  +LG MWS GGD  M P+IRLRDH+W +P T VSYSVYAVHT S 
Sbjct  146  VSRCVADTFVDSAATSYLGSMWSVGGDPNMVPYIRLRDHSWVDPVTEVSYSVYAVHTTSV  205

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG  286
            ADDP WN CP ++GY +L VPCH+R EF+D EM A++ P GS WVT WL++EFA  + SG
Sbjct  206  ADDPAWNVCPADDGYGALTVPCHRRDEFTDKEMEAMHTPTGSAWVTTWLEEEFA--EDSG  263

Query  287  FD---------------------------ElllipillsssCCDFDVVSPNY--------  311
            FD                           +         S+ CD   VSP Y        
Sbjct  264  FDTMLLIPIILGAVVLIIAVGCGRYYWKRKQKSDIDETVSTTCDLTAVSPQYTSESTVPL  323

Query  312  --LGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESL  369
                    +   R TV TT    S  S +G YESAGS +T KILL+SQHL+  R+PYES+
Sbjct  324  PKYAATTPDHTLRPTVMTTQ--GSFLSTRGGYESAGSCRTLKILLNSQHLMDKRMPYESI  381

Query  370  SFQMELSKAASGEAWICQYG------------------RPTAFAEEIELTASLIHPHIVK  411
             +Q  LSK +SGE W+C++                      AFAEEIELTASL HPHIV 
Sbjct  382  MYQRLLSKGSSGEVWLCKHNGQQIAIKRLLQIKQQKAESVQAFAEEIELTASLDHPHIVT  441

Query  412  FIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSP  471
            F+ VAWN+L+NL MV+E+V  G LQ +LH+N+D+LSWA D+I+MAV +A+AL+YLHSR+P
Sbjct  442  FVSVAWNTLNNLVMVMEYVPMGSLQSYLHQNADLLSWARDKIHMAVGIAQALDYLHSRTP  501

Query  472  AIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKA  531
            + IHRD+KS NILLT  L+PKLIDFGVSR  ++ TMTAGVGTPYWTAPE+LEG RY+E+A
Sbjct  502  SCIHRDVKSTNILLTHMLEPKLIDFGVSRKSVEATMTAGVGTPYWTAPEILEGKRYTEQA  561

Query  532  DIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIA  591
            DIYSFGVVLSELDTG+IPY D +   G K+ P QILQ+V++G LRP+FS DCPPRIQR+ 
Sbjct  562  DIYSFGVVLSELDTGKIPYHDALTESGGKVKPVQILQDVVSGMLRPTFSKDCPPRIQRVG  621

Query  592  AACLSFDPSDRPTAQELIQWLEG  614
            +ACL  DPS RPTAQ+L++ LEG
Sbjct  622  SACLVQDPSTRPTAQQLVKELEG  644

>PHYCA_107224
Length=650

 Score = 696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/649 (54%), Positives = 441/649 (68%), Gaps = 64/649 (10%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            + YTI  RSLE             +F FDGTNSDIARQLY RH++GDT A VSI S+PTA
Sbjct  3    EAYTINLRSLES----------TSAFVFDGTNSDIARQLYIRHKAGDTDAKVSISSIPTA  52

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            V+ RL ++ + F++LPGLVQ AVLWDTGF +SP+ DPVQIWT   +TMADIAV    ++ 
Sbjct  53   VSTRLSAIGVTFSNLPGLVQRAVLWDTGFALSPSDDPVQIWTKDSYTMADIAVPKAQVSA  112

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
              CT   C QPN+  AY +  CSG Q++NVSRC+VD F DS A  +LG MWS GGD  MT
Sbjct  113  EGCTFKNCTQPNEELAYYTLICSGAQMVNVSRCVVDMFVDSAATSYLGSMWSVGGDPDMT  172

Query  198  PHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDA  257
            P+IRLRDH+W +P T  +YSVYAVHT S ADDP WN CP  + Y +L VPCH+R EF+D 
Sbjct  173  PYIRLRDHSWVDPVTEKAYSVYAVHTTSVADDPAWNVCPTGDSYGALTVPCHRRDEFTDD  232

Query  258  EMAAVNKPRGSEWVTMWLKDEFAVGDSSGFD------------------------Ellli  293
            E+A +N P GS WVT WL++EF+  D SGF+                        +    
Sbjct  233  EIATMNTPTGSTWVTTWLEEEFSESDGSGFNMLLLIPIILGVVILALGLGWLYRRKANTK  292

Query  294  pillsssCCDFDVVSPNYLG----------VVAHEQARRGTVATTSYGPSISSHQGDYES  343
                +S+ CDF   SP YL               +QA R T+ T S G  +S+  G YES
Sbjct  293  IDETASTTCDFVETSPRYLSGSTVPLPKYVSSTPDQALRPTIMT-SQGTFLSARGGIYES  351

Query  344  AGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG--------------  389
            AGS +T KILL  QHL+  R+PY+++++Q  L+K +SGE W C++               
Sbjct  352  AGSCRTLKILLEGQHLMDKRMPYDNITYQKILAKGSSGEVWACEHNGQQVAVKRLLQTKE  411

Query  390  ----RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV  445
                   AFAEEI LTASL HPHIV FIGVAWN+L+NL MVLE+V  G LQ +L +N+D+
Sbjct  412  QKAENVQAFAEEISLTASLDHPHIVGFIGVAWNTLNNLIMVLEYVPMGSLQSYLDQNADL  471

Query  446  LSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDL  505
            LSWA D+I+MAV +A+ALEYLH  +P++IHRDLKSNNILL+  L+PKLIDFGVSRG ++ 
Sbjct  472  LSWARDKIHMAVGIAQALEYLHG-TPSLIHRDLKSNNILLSHMLEPKLIDFGVSRGTVEN  530

Query  506  TMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQ  565
            TMTAGVGTPYWTAPE+LEG RY+++ADIYSFG+VLSELDTG+IPY D +  +G K  P Q
Sbjct  531  TMTAGVGTPYWTAPEILEGKRYTQQADIYSFGIVLSELDTGKIPYHDALTENGGKTKPVQ  590

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            ILQ+V++GTLRP FS DCPPRI RI +ACL+ DPS RPTAQ+L+Q LEG
Sbjct  591  ILQDVVSGTLRPKFSTDCPPRILRIGSACLAQDPSSRPTAQQLLQELEG  639

>PITG_17586
Length=686

 Score = 694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/664 (54%), Positives = 450/664 (68%), Gaps = 58/664 (9%)

Query  2    RVSGllsilaatlttaQDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHR  61
            RV+ L S+LA + +  + +TI  RSLE   P    LPS  SF FDGTNSDIA+QLY RH+
Sbjct  18   RVTALASVLAISSSMVRGHTIRLRSLESTSP----LPSGLSFAFDGTNSDIAQQLYVRHK  73

Query  62   SGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTG  121
            +GDT   VS+ SVPT V +RL  L I F+ LPGLVQ AVLWDTGF +SP+ + VQIWT  
Sbjct  74   AGDTDIKVSLSSVPTGVANRLADLNIRFSDLPGLVQRAVLWDTGFALSPSNEAVQIWTMD  133

Query  122  DFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAK  181
            D+TMA+IAV  ++++   CT   C QPN+  AY +  CSG Q++NVSRC+ DTF DS A 
Sbjct  134  DYTMANIAVPKEEVSGEGCTFKNCTQPNNALAYYTLICSGAQMVNVSRCVADTFVDSAAT  193

Query  182  DFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGY  241
             +LG MWS GGD  M P+IRLRDH+W +P T VSYSVYAVHT S ADDP WN CP +NGY
Sbjct  194  SYLGSMWSVGGDLDMIPYIRLRDHSWVDPVTEVSYSVYAVHTTSVADDPAWNVCPADNGY  253

Query  242  SSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFD-------------  288
             ++ VPCH+R EF+D EM A+N P GS WV  WL++EFA G  SGFD             
Sbjct  254  GAVTVPCHRRDEFTDQEMEAMNTPTGSAWVAKWLEEEFAQG--SGFDTLLLIPIISGAVV  311

Query  289  --------------ElllipillsssCCDFDVVSPNYLG--VVAHEQARRGTVATTSYGP  332
                          +         S+ CD   VSP Y+    V   +   GT    +  P
Sbjct  312  FVAVIGVGRFYWKRKEEHKIDETVSTTCDLATVSPQYMSGSTVPLPKYTSGT-PDPALRP  370

Query  333  SISSHQGD----YESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY  388
            ++ + QG     YESAGS +T KILL SQHL   R+PYES+++Q  LSK +SGE W+C++
Sbjct  371  TVMTTQGSFLSTYESAGSCRTLKILLRSQHLTEKRMPYESIAYQQALSKGSSGEVWLCEH  430

Query  389  G------------------RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFV  430
                                  AFAEEIELTASL HPH+V FIGVAWN+L+NL MVLE+V
Sbjct  431  NGQQVAIKRLLQNKQQKAENVQAFAEEIELTASLDHPHVVSFIGVAWNTLNNLVMVLEYV  490

Query  431  SEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLD  490
              G LQ +L +N+D+LSWA D+I+MAV +A+AL+YLH  +P++IHRDLKS NILLT  L+
Sbjct  491  PMGSLQTYLDQNADLLSWARDKIHMAVGIAQALDYLHGHTPSLIHRDLKSTNILLTHMLE  550

Query  491  PKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPY  550
            PKLIDFGVSRG  DLTMTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVLSELDTG+IPY
Sbjct  551  PKLIDFGVSRGTADLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGKIPY  610

Query  551  FDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQ  610
             D +   G ++ P QILQ+V++G LRP+FS DCPPRI R+ +ACL+ DP+ RPTAQ+L+ 
Sbjct  611  HDALTGAGGRVKPVQILQDVVSGALRPTFSSDCPPRILRVGSACLAQDPATRPTAQQLVS  670

Query  611  WLEG  614
             L G
Sbjct  671  ELVG  674

>PHYSO_253195
Length=677

 Score = 681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/626 (56%), Positives = 431/626 (69%), Gaps = 60/626 (10%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIA+QLY RH++GDT A +S+ SVP AVT RL+   IAF  LPGLVQ AVLWD+GF
Sbjct  44   GTNSDIAQQLYIRHKAGDTDAKLSLNSVPAAVTQRLNRFNIAFDDLPGLVQRAVLWDSGF  103

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP+ DPVQIWT  D+TMA++AV    ++   CT   C QPND  AY +  CSG Q+LN
Sbjct  104  AISPDNDPVQIWTMDDYTMAELAVPKAQVSGQGCTFKNCSQPNDVTAYYTLICSGDQMLN  163

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            VSRC+ DTFEDS A  ++G MWS GG    TP +RLR+H W +P T  SYSVYA+HTVS+
Sbjct  164  VSRCVADTFEDSAATSYMGSMWSVGGGPNATPQLRLRNHAWKDPVTKDSYSVYAIHTVSN  223

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG  286
            ADDP WN CP ++GY++L VPCH+R EF+DAEM A+ KP GS WVT WLK+EF  G+SSG
Sbjct  224  ADDPAWNVCPADDGYAALTVPCHRRDEFTDAEMEAMTKPTGSAWVTTWLKEEF--GESSG  281

Query  287  FD----------------------------ElllipillsssCCDFDVVSPNYLG-----  313
            F+                              + I     S+ CD   VSP Y       
Sbjct  282  FNTLLLIPIILGAVVVIAGASVAWFCWRRRAKVKIEEETMSTTCDLVGVSPQYRAENSVP  341

Query  314  -------VVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPY  366
                     A  +A   T   T+ G S SS    YES GS +T KILL SQHL+  R+ Y
Sbjct  342  RPTVTASTPAKHRATTLTSRLTTLGSSFSSLAEAYESPGSCKTLKILLSSQHLVERRLQY  401

Query  367  ESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPH  408
            E+++FQ  LSK +SGE W+C++ G+  A                 FAEE+ELTASL HP+
Sbjct  402  ENITFQSALSKGSSGEVWVCEHDGQQVAVKRLLQTKNQKAENVLEFAEEVELTASLDHPN  461

Query  409  IVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHS  468
            IV F+GVAWN+L+NL +VLE+V  G LQ +L KN+D+LSWA D+++MAV +A+ALEYLH 
Sbjct  462  IVGFVGVAWNTLNNLLLVLEYVPMGSLQTYLQKNADLLSWARDKVHMAVGIAKALEYLHG  521

Query  469  RSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYS  528
             +PA+IHRDLKSNNILLT+ L+PKLIDFGVSRG ++LTMTAGVGTPYWTAPE+LEG RY+
Sbjct  522  HTPALIHRDLKSNNILLTDRLEPKLIDFGVSRGTVELTMTAGVGTPYWTAPEILEGKRYT  581

Query  529  EKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQ  588
            E+ADIYSFGVVLSELDTGRIPY D +   G K  P QILQ+V+ GTLRP+F+ DCPPRI 
Sbjct  582  EQADIYSFGVVLSELDTGRIPYHDALTEGGGKAKPVQILQDVVCGTLRPTFTKDCPPRIL  641

Query  589  RIAAACLSFDPSDRPTAQELIQWLEG  614
            R+ +ACL+ DPS RPTA++LIQ L+G
Sbjct  642  RVGSACLAQDPSSRPTAEQLIQELQG  667

>HYAP_14440
Length=647

 Score = 676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/613 (55%), Positives = 421/613 (69%), Gaps = 47/613 (8%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G NSDIARQLY +H +G     V +  +P  V  RLD   I F+ LPGLVQ AVLWD+GF
Sbjct  28   GGNSDIARQLYIQHVAGKVDDRVDLTVIPAVVQRRLDPYNIVFSDLPGLVQRAVLWDSGF  87

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             +SP  +PVQIWT  +FTMAD+AV    +    CT+ +C QPND   Y +Q CSGTQ+L+
Sbjct  88   AVSPLNEPVQIWTLQNFTMADLAVPEKQVKTAGCTLKKCVQPNDITGYYTQTCSGTQMLS  147

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             SRC++DTF+D GA  FLG MWS GGD  MTP IRLRDH+WT+P +  S+SVYAVHTV +
Sbjct  148  ASRCVIDTFKDDGAVGFLGAMWSKGGDPGMTPLIRLRDHSWTDPISNDSFSVYAVHTVPN  207

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG  286
            A D  WNQCPV+  Y+SL VPCH+R   +D    A++ P GS+WVT WL+++F V   SG
Sbjct  208  ALDAVWNQCPVHTKYASLTVPCHRRDMITDEVKMAMSVPSGSDWVTTWLENDFVV--PSG  265

Query  287  FDElllipillsss-----------CCDFDVV---------------SPNYLGVVAHEQA  320
            FD  +++ I+L+             CC                    +P Y      +  
Sbjct  266  FDTSMVVAIILAVLTMLVILAFGWYCCRHRSSRSKKAASSVYKLAGDAPQYSDAWTSKTG  325

Query  321  RRGTVATT--SYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
             R T  +   ++  S+ S  GD+ESAGSN+T KILL S+ L   RIPYE+L  Q  +SK 
Sbjct  326  NRSTDRSLRLTHQSSLFSSSGDFESAGSNRTLKILLGSKCLQQKRIPYENLMLQEPISKG  385

Query  379  ASGEAWICQY-GRPTA----------------FAEEIELTASLIHPHIVKFIGVAWNSLS  421
            ASGE WIC Y G+  A                FAEEIEL+ASL+HP++V+FIGVAWNSL 
Sbjct  386  ASGEVWICAYRGKTVAVKRLIRGSRNAETVRTFAEEIELSASLVHPNVVEFIGVAWNSLD  445

Query  422  NLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSN  481
            NL+MVLE+   G+LQ +LHKN+D+LSWA D+I MAVA+A+AL+YLH RSPAIIHRDLK N
Sbjct  446  NLAMVLEYFPRGNLQNYLHKNADLLSWARDKIQMAVAIAQALQYLHGRSPAIIHRDLKCN  505

Query  482  NILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLS  541
            NILLT++L PKLIDFGVSRG++D+TMTAGVGTPYW APE+LEG RY+E+ADIYSFGVVLS
Sbjct  506  NILLTDNLQPKLIDFGVSRGLVDITMTAGVGTPYWAAPEILEGKRYTEQADIYSFGVVLS  565

Query  542  ELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSD  601
            ELDTG IPY + V   G +   FQILQ+VMAG+LRPSFS DCPPRI+R+  ACLS DPSD
Sbjct  566  ELDTGEIPYHNAVTESGGQATSFQILQDVMAGSLRPSFSRDCPPRIRRVGLACLSLDPSD  625

Query  602  RPTAQELIQWLEG  614
            RPT  +LIQ LEG
Sbjct  626  RPTTNQLIQGLEG  638

>PITG_20767
Length=661

 Score = 671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/643 (54%), Positives = 435/643 (68%), Gaps = 57/643 (9%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            Q +T++FRSLEE    +SS     S  F+G++SDIA+QLY RH++GDT   V + SVPTA
Sbjct  16   QGHTVSFRSLEE----TSSSSPSSSCVFNGSDSDIAQQLYIRHKAGDTGDQVELTSVPTA  71

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            V+ RLD++ + F  LPGLVQ AVLWDTGF I+P   PVQI+   + TM +IA+   +++ 
Sbjct  72   VSGRLDAINVDFNSLPGLVQRAVLWDTGFAIAPGNVPVQIYPMHNRTMDNIAIPKWEVSG  131

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
            V+CT   C QPND  AY S  C+G Q+LN S C++D FEDSGA  +LG MW+ GGD  + 
Sbjct  132  VDCTFTNCSQPNDITAYYSHTCTGWQMLNTSHCVIDVFEDSGAGTYLGNMWANGGDPDVA  191

Query  198  PHIRLRDHTWTEP--TTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFS  255
            P I LRDHTWTEP   T  ++SVY VHTV S+ +P W QCP+  GY ++ +PC +R  F+
Sbjct  192  PLIELRDHTWTEPVFNTSTTFSVYVVHTVYSSQEPAWGQCPL--GYGAVSIPCARRDAFT  249

Query  256  DAEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFD-------------------------E  289
            D  MAA    P GS WVT WL+DEFA   SSGFD                         +
Sbjct  250  DEFMAANTTIPTGSAWVTTWLEDEFA-EKSSGFDTILLIPIILGVVAVLGALGLGWFCWK  308

Query  290  lllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQT  349
                     S+    D+ +  YL V   E    G    T+ G +ISSH   YESAGSN+T
Sbjct  309  RKAENRAHKSTSAAHDMETDQYLAVGTPEMIL-GPTGLTTQGSTISSH---YESAGSNKT  364

Query  350  FKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RP  391
             KILL S+HL G RIPY+SL F+  +SK ASGE WICQY                   + 
Sbjct  365  LKILLDSEHLQGKRIPYDSLLFERAVSKGASGEVWICQYNGQQVAAKRLLQSKDQNAEKV  424

Query  392  TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGD  451
             AFA EIEL+ASL+HPHIV+FIGVAWNSL+NL+MVLE    G+LQ +L KNSD+LSWA D
Sbjct  425  QAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMVLELFPMGNLQNYLQKNSDLLSWARD  484

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            +I+MA+ VA+AL YLH+R+P +IHRDLKSNNILLT+ L+PKLIDFGVSR  +DLTMTAGV
Sbjct  485  KIHMAIGVAQALAYLHARTPPLIHRDLKSNNILLTDKLEPKLIDFGVSRDTVDLTMTAGV  544

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GTPYWTAPE+LEG RY+E+ADIYSFGVVL+ELDT +IPY D     G K  PFQILQ+VM
Sbjct  545  GTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDAATEHGGKPKPFQILQDVM  604

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            AG LRP+FS DCPPRIQ+I  ACL+ +P DRP+AQEL+Q L+G
Sbjct  605  AGKLRPTFSKDCPPRIQKIGMACLALNPEDRPSAQELVQELQG  647

>PHYRA_84551
Length=638

 Score = 668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/640 (54%), Positives = 438/640 (68%), Gaps = 59/640 (9%)

Query  21   TITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTD  80
            T+TFRSL E  P      +  +F F+G+NSDIA+QLY RH++GD+   V++ SVPTAVTD
Sbjct  9    TVTFRSLAETSP------TSAAFVFNGSNSDIAQQLYIRHQAGDSGDQVTLTSVPTAVTD  62

Query  81   RLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNC  140
            RLD L + F  LPGLVQ AVLWDTGF I+P   PVQ++   + +MADIAV   ++ NV C
Sbjct  63   RLDPLNVDFATLPGLVQRAVLWDTGFVIAPGNVPVQVYPKNNRSMADIAVQKYEVFNVQC  122

Query  141  TMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHI  200
            T+  C QP+    Y ++YC+G Q+LN S C++D FEDSGA  +LG MW+ GGD    P I
Sbjct  123  TVKNCSQPSGEDGYYTRYCTGYQMLNTSHCVIDVFEDSGAGTYLGNMWAAGGDPDTVPEI  182

Query  201  RLRDHTWTEPTTGV--SYSVYAVHTVSSADDPTWNQCPVNNGYSS-LIVPCHKRSEFSDA  257
             +RDH+W++    V   +SVY VHT+SS D+P W+ CP ++GY+S L VPCH+R +FSD 
Sbjct  183  EVRDHSWSDYFNDVMTDFSVYVVHTMSSTDEPAWDTCPADDGYTSPLSVPCHRRDQFSDE  242

Query  258  EMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFDEl------------------------ll  292
             MAA    P GS WVT WL+DEFA  + SGF+++                          
Sbjct  243  FMAANTTVPTGSAWVTTWLEDEFA--EDSGFNKVLLVPIILGILVVLGGGLGWFCWKRRA  300

Query  293  ipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKI  352
                  S+   +++   +Y+GV   E +      TT+ G +ISSH   YESAGSN+T K+
Sbjct  301  KTNADKSATAAYELEGEHYVGVATPELSLHPM--TTTQGSTISSH---YESAGSNKTLKV  355

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAF  394
            LL S+HL G RIP+ESLSF+  LSK ASGE W+C Y                      AF
Sbjct  356  LLGSEHLRGKRIPFESLSFERALSKGASGEVWVCAYNGQKVAVKRLLQSKEQKAENVQAF  415

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIY  454
            AEEI+L+ASL+HPHIV+FIGVAWNSL+NL +VLEF   G+LQ +L ++ D+LSWA D+I+
Sbjct  416  AEEIDLSASLVHPHIVEFIGVAWNSLNNLVLVLEFFPRGNLQSYLQQHGDLLSWARDKIH  475

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTP  514
            MA+ VA+ALEYLH+R+P +IHRDLKSNNILLT+ L+PKLIDFGVSRG +D TMTAGVGTP
Sbjct  476  MAIGVAQALEYLHARTPPLIHRDLKSNNILLTDKLEPKLIDFGVSRGTVDNTMTAGVGTP  535

Query  515  YWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGT  574
            YWTAPE+LEG RY+E+ADIYSFGVVL+ELDT +IPY +     G K  PFQILQ+VMAG 
Sbjct  536  YWTAPEILEGKRYTEQADIYSFGVVLTELDTCKIPYSNAATEGGGKPKPFQILQDVMAGK  595

Query  575  LRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            LRPSFS DCPPRI+R+   CL+ DP+ RPTA ELIQ LEG
Sbjct  596  LRPSFSEDCPPRIKRVGLRCLAVDPAGRPTAHELIQELEG  635

>PITG_17576
Length=661

 Score = 664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/643 (54%), Positives = 433/643 (67%), Gaps = 57/643 (9%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            Q +T++FRSLEE    +SS     S  F+G++SDIA+QLY RH++GDT   V + SVPTA
Sbjct  16   QGHTVSFRSLEE----TSSSSPSSSCVFNGSDSDIAQQLYIRHKAGDTGDQVELTSVPTA  71

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            V+ RLD++ + F  LPGLVQ AVLWDTGF I+P   PVQI+   + TM +IA+   +++ 
Sbjct  72   VSGRLDAINVDFNSLPGLVQRAVLWDTGFAIAPGNVPVQIYPMHNRTMDNIAIPKWEVSG  131

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
            V+CT   C QPND  AY S  C+G Q+LN S C++D FEDSGA  +LG MW+ GGD  + 
Sbjct  132  VDCTFTNCSQPNDITAYYSHTCTGWQMLNTSHCVIDVFEDSGAGTYLGNMWANGGDPDVA  191

Query  198  PHIRLRDHTWTEP--TTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFS  255
            P I LRDHTWTEP   T  ++SVY VHTV S+ +P W QCP+  GY ++ +PC +R  F+
Sbjct  192  PLIELRDHTWTEPVFNTSTTFSVYVVHTVYSSQEPAWGQCPL--GYGAVSIPCARRDAFT  249

Query  256  DAEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFD-------------------------E  289
            D  MAA    P GS WVT WL+DEFA   SSG D                         +
Sbjct  250  DEFMAANTTIPTGSAWVTTWLEDEFA-EKSSGLDTILLIPIILGVVAVLGALGLGWFCWK  308

Query  290  lllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQT  349
                     S+    D+ +  YL V   E    G    T+ G +ISSH   YESAGSN+T
Sbjct  309  RKAENRAHKSTSAAHDMETDQYLAVGTPEMIL-GPTGLTTQGSTISSH---YESAGSNKT  364

Query  350  FKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RP  391
             KILL S+HL G RIPY+SL F+  +SK ASGE WICQ                    + 
Sbjct  365  LKILLDSEHLQGKRIPYDSLLFERAVSKGASGEVWICQCNGQQVAAKRLLQRRDQNAEKV  424

Query  392  TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGD  451
             AFA EIEL+ASL+HPHIV+FIGVAWNSL+NL+MVLE    G+LQ +L KNSD+LSWA D
Sbjct  425  QAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMVLELFPMGNLQNYLQKNSDLLSWARD  484

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            +I+MA+ VA+AL YLH+R+P +IHRDLKSNNILLT+ L+PKLIDFGVSR  +DLTMTAGV
Sbjct  485  KIHMAIGVAQALAYLHARTPPLIHRDLKSNNILLTDKLEPKLIDFGVSRDTVDLTMTAGV  544

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GTPYWTAPE+LEG RY+E+ADIYSFGVVL+ELDT +IPY D     G K  PFQILQ+VM
Sbjct  545  GTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDAATEHGGKPKPFQILQDVM  604

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            AG LRP+FS DCPPRIQ+I  ACL+ +P DRP+AQEL+Q L+G
Sbjct  605  AGKLRPTFSKDCPPRIQKIGMACLALNPEDRPSAQELVQELQG  647

>PPTG_16201
Length=656

 Score = 662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/643 (54%), Positives = 435/643 (68%), Gaps = 55/643 (9%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            Q  T+TFRSLE     SSS  S  S+ F+G++SDIA+QLY R+++GDTS  V + SVPTA
Sbjct  19   QGQTVTFRSLEAT--SSSSALSSSSYVFNGSDSDIAQQLYIRYKAGDTSDQVELTSVPTA  76

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            VT+RLD++K+ FT LPGLVQ AVLWDTGF I+P    VQI+   + TM +IA+   +++ 
Sbjct  77   VTERLDAIKVDFTGLPGLVQRAVLWDTGFAIAPGNTAVQIYPMHNRTMDNIAIPKWEVSG  136

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
            V+CT   C QPN+  AY S  C+G Q+LN S C++D FEDSGA  +LG MW+ GGD  + 
Sbjct  137  VDCTFTNCSQPNEVTAYYSHTCTGWQMLNTSHCVIDVFEDSGAGTYLGNMWANGGDPDVA  196

Query  198  PHIRLRDHTWTEPT--TGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFS  255
            P I LRDHTWTEP      ++SVY VHTVSS+ +P W +CP  +GY ++ +PC +R +F+
Sbjct  197  PLIELRDHTWTEPVFNKSTTFSVYVVHTVSSSQEPAWGECP--SGYGTVSIPCARRDQFT  254

Query  256  DAEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFD-------------------------E  289
               MAA    P GS WVT WL  EFA  +SSGFD                         +
Sbjct  255  AEFMAANTTIPTGSAWVTTWLAQEFA-EESSGFDYILLVPIILGALVVLGGIGLGWFCWK  313

Query  290  lllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQT  349
                     S+    ++ +  YL V   E    G    T+ G ++SSH   YESAGSN+T
Sbjct  314  RKAKNNAQKSTSAAHELETDQYLAVGTPEMIL-GPTGMTTQGSTLSSH---YESAGSNKT  369

Query  350  FKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RP  391
             KILL S+HL G RIPY+SL F+  +SK ASGE WICQY                   + 
Sbjct  370  LKILLDSEHLQGKRIPYDSLVFERAVSKGASGEVWICQYNGQKVAAKRLLQTKEQNAEKV  429

Query  392  TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGD  451
             AFA EIEL+ASL+HPHIV+FIGVAWNSL+NL+MVLEF   G+LQ +L KN+D+LSWA D
Sbjct  430  QAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMVLEFFPMGNLQNYLQKNADLLSWARD  489

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            +I+MAV VA+ALEYLH R+P +IHRDLKSNNILLT+ L+PKLIDFGVSR  +DLTMTAGV
Sbjct  490  KIHMAVGVAQALEYLHDRTPPLIHRDLKSNNILLTDKLEPKLIDFGVSRDTVDLTMTAGV  549

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GTPYWTAPE+LEG RY+E+ADIYSFGVVL+ELDT +IPY D     G K  PFQILQ+VM
Sbjct  550  GTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDATTEHGGKPKPFQILQDVM  609

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            AG LRP+FS DCPPRI++I  ACL+  P DRPTA EL+  L+G
Sbjct  610  AGKLRPTFSEDCPPRIKKIGMACLALSPEDRPTAHELVLELQG  652

>PPTG_16187
Length=640

 Score = 658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/609 (54%), Positives = 419/609 (69%), Gaps = 49/609 (8%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQL  RH++GDT+  V++ S+PTA+ DRL  L I F  LPGLVQ AVLWDTGF
Sbjct  28   GTNSDIARQLLIRHQAGDTAEQVNLTSIPTAILDRLIPLNINFDGLPGLVQRAVLWDTGF  87

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP  +P+QIWT  ++TMAD+AV   D++ V+CT L C QP++  A+ +QYC+G Q+LN
Sbjct  88   AISPGNNPIQIWTMQNYTMADLAVPKSDVSFVDCTYLNCSQPSEEIAHYAQYCTGWQMLN  147

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTT----GVSYSVYAVH  222
            VSRC+ D FED GA  +LG+MWSTGGD  MTP IRLRDHTWT+        V++SVY VH
Sbjct  148  VSRCVADDFEDPGADTYLGMMWSTGGDPNMTPSIRLRDHTWTQDIAEFGGNVTFSVYVVH  207

Query  223  TVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAA-VNKPRGSEWVTMWLKDEFAV  281
            TVS   DP WNQCP NNG+ SL VPCH++ EF+D  MAA    P GSE VT WLK+EFA+
Sbjct  208  TVSHELDPAWNQCPPNNGFGSLTVPCHRKIEFTDEYMAANTTVPTGSELVTTWLKNEFAM  267

Query  282  GDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSIS------  335
                   E     + +        +V+   LG +   +  + ++     G   +      
Sbjct  268  -------EKTQSQMWIPVLLSVIIIVAGVVLGWLGCRRKSKASMVKQISGAKGANSDSHR  320

Query  336  ------------SHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEA  383
                        S    YE AGSN+T +ILL S+HL G RIPYES+ F+  +SK ASGE 
Sbjct  321  SLSISSSTSLPGSESLHYERAGSNKTLQILLDSEHLEGKRIPYESVVFETAISKGASGEV  380

Query  384  WICQYGRPTA------------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSM  425
            W+C+Y    A                  FA+EIELTASL+HP+IV+FIGVAWNSL NL M
Sbjct  381  WVCEYNGQKAAVKRLLQRKKQKAESVQEFAKEIELTASLVHPNIVQFIGVAWNSLDNLVM  440

Query  426  VLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILL  485
            +LE++    L+ +L KN D LSWA D+IY+A+ +A ALEYLH+R+P +IHRDLKS+N+LL
Sbjct  441  LLEYLPTS-LKDYLEKNKDRLSWARDKIYIAIGIARALEYLHARTPPLIHRDLKSSNVLL  499

Query  486  TEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDT  545
            T+ ++PK+IDFGVSRG ++L+MTAGVGTP+WTAPE+LEG  Y+EKADIYS GVVLSELDT
Sbjct  500  TDSVEPKIIDFGVSRGRVELSMTAGVGTPFWTAPEILEGNHYTEKADIYSLGVVLSELDT  559

Query  546  GRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTA  605
              +PY D V  DG KL PFQIL+EVM+GT+RPSFS +CP RI+RI +ACLS +PS R TA
Sbjct  560  CEVPYHDAVSEDGTKLKPFQILKEVMSGTMRPSFSQECPARIRRITSACLSLEPSRRLTA  619

Query  606  QELIQWLEG  614
            Q+L++ LEG
Sbjct  620  QQLVRQLEG  628

>PHYCA_563934
Length=645

 Score = 653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/640 (54%), Positives = 432/640 (68%), Gaps = 65/640 (10%)

Query  21   TITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTD  80
            TITFRSL+++ P SS           G NSDI+RQLYTR+++GD+   V + +VPTAV+ 
Sbjct  21   TITFRSLQDEIPSSSF----------GPNSDISRQLYTRYKAGDSVVQVELNAVPTAVSK  70

Query  81   RLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNC  140
            RL  L IAF  LPGLVQ AVLWDTGF ISP+ D VQ+W   +++MADIA+   D+ NV+C
Sbjct  71   RLQPLHIAFQSLPGLVQRAVLWDTGFAISPHNDAVQMWPMKNYSMADIAIPKTDVANVDC  130

Query  141  TMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHI  200
            + L C QPN+  AY +QYC+G QILN SRC+VD F+DSGA  FLG+MWS GGD  +TP +
Sbjct  131  SFLNCSQPNEVEAYYTQYCTGYQILNASRCVVDQFQDSGAGSFLGMMWSVGGDPNITPEL  190

Query  201  RLRDHTWTEPTT----GVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSD  256
            RLRDHTWT+        V++SVYAVHTVSS +DP W+ CP  +GY+SL +PCH+R EFSD
Sbjct  191  RLRDHTWTQDIEVFGGNVTFSVYAVHTVSSENDPAWDVCP--SGYASLTIPCHRRDEFSD  248

Query  257  AEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFDEllli---------------------p  294
              MAA    P GS WVT WL++EFA   SSGF+++ LI                      
Sbjct  249  EYMAANTTVPVGSAWVTTWLEEEFA--QSSGFNKIFLIPILLSIFLVIGVSWFCWRCRGK  306

Query  295  illsssCCDFDVVSP-NYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKIL  353
                S+  DFD+ S  +Y G    +   R  + T+     +S+    YESAGSN T +IL
Sbjct  307  KKTPSTTADFDLNSTCHYWG---GDMVFRPMMVTSQLSSQLSTLSMQYESAGSNTTLQIL  363

Query  354  LHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFA  395
            L S++L G  + Y+SL F   +SK ASGE W C Y                      AFA
Sbjct  364  LGSEYLQGKHVAYDSLVFDKAISKGASGEVWFCDYNGQKVAVKRLLQTKHQKAQHVQAFA  423

Query  396  EEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEF---VSEGDLQGFLHKNSDVLSWAGDR  452
            EEIEL+ASL+HP+IV+FIGVAWN+L+NL MV+E+   +  G+LQ +L  N+  LSW+ D+
Sbjct  424  EEIELSASLVHPYIVEFIGVAWNTLNNLVMVMEWQQNLPMGNLQRYLKVNNSKLSWSKDK  483

Query  453  IYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVG  512
            IY+A+ +A+ALEYLH RS  IIHRDLKS+NILLT +L PKLIDFGVSRG +DLTMT G+G
Sbjct  484  IYIAIGIAQALEYLHGRSSPIIHRDLKSSNILLTNELKPKLIDFGVSRGKIDLTMTGGIG  543

Query  513  TPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMA  572
            TPYWTAPEVLEG RYSE+ADIYSFGVVLSELDTG+ PY D V   G    PF ILQ+VMA
Sbjct  544  TPYWTAPEVLEGKRYSEQADIYSFGVVLSELDTGKAPYCDAVTEHGGMPKPFYILQDVMA  603

Query  573  GTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            G LRP+FS DCP RI+R+  ACL+ + S RP+AQ+L+Q L
Sbjct  604  GRLRPTFSQDCPLRIKRLGLACLALNVSRRPSAQKLVQEL  643

>PHYSO_520072
Length=661

 Score = 652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/643 (53%), Positives = 429/643 (67%), Gaps = 55/643 (9%)

Query  21   TITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTD  80
            T+TFRSLEE    +SS  S  SF F+G+NSDIARQL+ RHR+G T  ++S+  VPTAV D
Sbjct  21   TVTFRSLEE----TSSASSSSSFVFNGSNSDIARQLHIRHRAGATGDSISLTEVPTAVKD  76

Query  81   RLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNC  140
            RLD+L IAF  LPGLVQ AVLWDTGF I+P   PVQIW  G+ TMADIAV   +++NV C
Sbjct  77   RLDALNIAFDDLPGLVQRAVLWDTGFAIAPGNKPVQIWPMGNRTMADIAVQKYEVSNVQC  136

Query  141  TMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHI  200
            T   C QPN   A+ S  C+G Q+ N S C+ + F D  A  +LG MW++GGD  + P I
Sbjct  137  TFTNCSQPNGVTAFYSHTCTGFQMQNTSHCVANDFVDDAASTYLGNMWASGGDPDVIPEI  196

Query  201  RLRDHTWTEPTTGVS----YSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSD  256
             LRDHTW+E     +    +SVY VHTVSS+D+  W  CP +  Y ++ +PC +R +F+D
Sbjct  197  ELRDHTWSEYIAEFNGTFDFSVYVVHTVSSSDEVAWGACPDDGEYGAVSIPCARRDQFTD  256

Query  257  AEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFD-------------------------El  290
            A MA     P G+ WVT WL++EFA  D  GF+                           
Sbjct  257  AYMAENTTTPTGTAWVTTWLQEEFAGEDDDGFNLVLLVPIILGVLVVIGLGWFFWRRRAK  316

Query  291  llipillsssCCDFDVVSPNYLGVVAHE-QARRGTVATTSYGPSISSHQGDYESAGSNQT  349
                   ++  C+ +V S  Y+ + A E      +   T+ G +ISS    YESAGSN+T
Sbjct  317  QRAQKSTTNPHCELEVDSVQYMTMGAPELNPTMMSSHPTTQGSTISSQH--YESAGSNKT  374

Query  350  FKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RP  391
             KILL S+ L G RIP++S+ F+  LSK ASGE WIC+Y                     
Sbjct  375  LKILLGSEQLQGKRIPFDSIIFERALSKGASGEVWICEYNGQKVAAKRLLQTKDQKAENV  434

Query  392  TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGD  451
             AFAEEI+L+ASL+HPHIV+FIGVAWNSL+NL MVLEF  +G+LQ +LHK+ D+LSWA D
Sbjct  435  QAFAEEIQLSASLVHPHIVEFIGVAWNSLNNLIMVLEFFPKGNLQNYLHKHGDLLSWARD  494

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            +I+MA+ VA+ALEYLH+R+P +IHRDLKSNNILLT+ L+PKLIDFGVSR  +DLTMTAGV
Sbjct  495  KIHMAIGVAQALEYLHARTPPLIHRDLKSNNILLTDQLEPKLIDFGVSRDTIDLTMTAGV  554

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GTPYWTAPE+ EG RY+E+ADIYSFGVVL+ELDT +IPY +     G    PFQILQ+VM
Sbjct  555  GTPYWTAPEIHEGKRYTEQADIYSFGVVLTELDTCKIPYSNAATEGGGMPKPFQILQDVM  614

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            AG LRPSFS DCPPRIQRI  ACLS DPS RPTA+EL++ L G
Sbjct  615  AGKLRPSFSQDCPPRIQRIGLACLSIDPSARPTARELVKELGG  657

>PPTG_16199
Length=666

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/644 (52%), Positives = 431/644 (67%), Gaps = 55/644 (9%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            Q +TITFRSL  QD  S+S  S+ SF FDGTNSDIARQLY R+++GD+S  + + S+P A
Sbjct  20   QAHTITFRSL--QDESSASSTSNSSFVFDGTNSDIARQLYIRYKAGDSSEQLELNSIPAA  77

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            VT RL    + F  LPGLVQ AVLWD+GF +SP  D VQ+W    ++MA IA+   D+ N
Sbjct  78   VTKRLHPFNVHFNDLPGLVQRAVLWDSGFAVSPKNDAVQMWPMKGYSMAAIAIPKSDVAN  137

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
            V+CT L C QPND  AY ++YC+G QILN SRC+VD FEDSGA  FLG+MWS GGD  MT
Sbjct  138  VDCTFLNCSQPNDVEAYYTKYCTGYQILNASRCVVDLFEDSGAGSFLGMMWSVGGDPDMT  197

Query  198  PHIRLRDHTWTEPTT----GVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSE  253
            P +RLRDHTWT+        +++SVYAVHTVS  +DP W+ CP   GY+SL +PCH+R +
Sbjct  198  PELRLRDHTWTQDIEEFGGNITFSVYAVHTVSIVNDPAWDVCPA--GYASLTIPCHRRDQ  255

Query  254  FSDAEMAAVNK-PRGSEWVTMWLKDEFAVGDSSGFDE-----------------------  289
            F+D  MAA    P GSEWVT WL+ EFA   SSGFDE                       
Sbjct  256  FTDEYMAANTMLPTGSEWVTTWLEKEFA--QSSGFDEIVLIPIILSVVIVLGFGWFCWKR  313

Query  290  --lllipillsssCCDFDVVS-PNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGS  346
              +       +S+  D+D  S  +Y G    +   R  + T+     +SS    YESAGS
Sbjct  314  RAMRKKDERSTSATADYDFNSTSHYWGGGTPDMVLRPMMVTSQLSSQLSSLSMQYESAGS  373

Query  347  NQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG-----------------  389
            N T +ILL+S+HL G  + +ES+ F+  +SK ASGE W+C Y                  
Sbjct  374  NTTLQILLNSEHLQGKHLAFESIIFEKAISKGASGEVWVCDYDGQQVAVKRLLQTKHQKA  433

Query  390  -RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSW  448
                AFAEEIEL+ASL+HP++V+FIGVAWN+L+NL MV+E++  G LQ +L  NS++LSW
Sbjct  434  QHVQAFAEEIELSASLVHPNVVEFIGVAWNTLNNLVMVMEYLPMGSLQRYLRVNSELLSW  493

Query  449  AGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMT  508
            + D++ + + + +ALEYLHSR P++IHRDLKS+NILLT  L+PKLIDFGVSR  +DLTMT
Sbjct  494  SKDKLRITIEIVQALEYLHSRKPSLIHRDLKSSNILLTNKLEPKLIDFGVSRDKIDLTMT  553

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQ  568
              +GTPYWTAPEVLEG RY+E+ADIYSFGV+LSELDTG+ PY D V  +G    PF +LQ
Sbjct  554  GEIGTPYWTAPEVLEGKRYTERADIYSFGVMLSELDTGKAPYSDAVTENGGMPKPFYVLQ  613

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            +VMAG LRPSF  DCP RI+R+  ACL+ DP  RPTA+EL+Q L
Sbjct  614  DVMAGRLRPSFLKDCPLRIKRVGLACLALDPLRRPTARELVQEL  657

>PHYRA_84553
Length=664

 Score = 647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/619 (53%), Positives = 415/619 (67%), Gaps = 59/619 (10%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G+NSDIA+QLY R+++GD     ++ S+PTAVTDRL+ L I F  LPGLVQ AVLWD+GF
Sbjct  47   GSNSDIAQQLYVRYKAGDACDQATLTSIPTAVTDRLEPLNINFNSLPGLVQRAVLWDSGF  106

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GISP  +P+QIWT  +++MA IAV   ++ NV+CT L C QPND  AY ++YC+G QILN
Sbjct  107  GISPGNEPIQIWTLENYSMAQIAVPKYEVANVDCTFLNCSQPNDVEAYYTKYCTGYQILN  166

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTT----GVSYSVYAVH  222
             SRC+ DTFED GA DFLG+MWSTGGD  MTP +R RDHTWT+        +++SVY+VH
Sbjct  167  ASRCVADTFEDPGAGDFLGMMWSTGGDPDMTPELRFRDHTWTQDVEQFGGNITFSVYSVH  226

Query  223  TVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAA-VNKPRGSEWVTMWLKDEFAV  281
            TVSS++DP W+ CP  +GY+S+ VPCH+R EF+DA MAA   KP GS WVT WL+ EFA 
Sbjct  227  TVSSSEDPAWDVCP--SGYASVTVPCHRRDEFTDAFMAANTTKPTGSAWVTTWLQQEFA-  283

Query  282  GDSSGFD-----------------------------ElllipillsssCCDFDVVSPNYL  312
               SGFD                             E             D+        
Sbjct  284  -QDSGFDMLLFIPIVLGAVAVVGLVGVFWRWRVKKKEQEKTLSNAWEHSGDYSYFMS---  339

Query  313  GVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQ  372
            G    E   R  + T+     +SS    YESAGSN+T KILL S+HL    +P++SL FQ
Sbjct  340  GSEPGEMVLRPMIVTSQLSTQLSSLSSHYESAGSNKTLKILLGSEHLQDKYMPFDSLVFQ  399

Query  373  MELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIG  414
              LSK ASGE WIC+Y GR  A                 FAEEIEL ASL+HPHIV+FIG
Sbjct  400  KALSKGASGEVWICEYNGRKVAVKRLLQSKEQKAQNVQAFAEEIELGASLVHPHIVEFIG  459

Query  415  VAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAII  474
            VAWN+L+NL MVLE++ +G LQ +L  +   LSW   +++MAV +A+ALEYLH RSP++I
Sbjct  460  VAWNTLNNLVMVLEYLPKGSLQQYLKLDGSQLSWWMGKLHMAVGIAQALEYLHGRSPSLI  519

Query  475  HRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIY  534
            HRDLKS+NILLTE+L+PKLIDFGVSR   + TMT G+GTPYWTAPE+L G RY+E+ADIY
Sbjct  520  HRDLKSSNILLTEELEPKLIDFGVSRDRAEATMTGGIGTPYWTAPEILIGKRYTEQADIY  579

Query  535  SFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAAC  594
            SFGVVLSELDTG+ PY DT+   G    PF ILQ+VMAG LRPSFS  CP  + ++  +C
Sbjct  580  SFGVVLSELDTGKSPYSDTLTECGGMPKPFYILQDVMAGKLRPSFSPTCPLHVLQLGLSC  639

Query  595  LSFDPSDRPTAQELIQWLE  613
            L+ DP++RPTA+EL+QWLE
Sbjct  640  LAIDPANRPTARELVQWLE  658

>PPTG_16185
Length=632

 Score = 645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/612 (53%), Positives = 410/612 (67%), Gaps = 44/612 (7%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQLY RH+ GD    V++ S+P A+T RL S  I F  LPGLVQ AVLWD+GF
Sbjct  12   GTNSDIARQLYIRHKKGDVGHNVTLSSIPEAITGRLKSFNIKFDDLPGLVQRAVLWDSGF  71

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISPN + VQI    ++TMA++AV  D++++  CT   C QPN+  A  +  CSG Q+ +
Sbjct  72   AISPNNEAVQIRPINNYTMAELAVPMDEVSDAGCTFRNCSQPNNETASYTLICSGEQMFS  131

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            VSRC+VD FED+GA  + G MW+ GG   M PHIRLR+H W +P + VSYSVYAVHTV S
Sbjct  132  VSRCVVDIFEDNGAGTYFGAMWAKGGHPDMAPHIRLREHKWNDPVSNVSYSVYAVHTVPS  191

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG  286
              + TWNQC   +GY +L VPC++R   +    A +  P GS WVT WL +EF      G
Sbjct  192  ELEATWNQCAPYDGYGALAVPCYRRDNVTVEMDAQLTTPTGSSWVTNWLDEEFGEKSDQG  251

Query  287  FDElllipillsssCC---------------------------DFDVVSPNYLGVVAHEQ  319
             D ++L+ I++ S                               FDV SP Y+     + 
Sbjct  252  LDTMVLVLIIVGSVIVLGLFGLGWYCWRRRSKRREGKPELEADGFDVESPFYMTPELAKP  311

Query  320  ARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAA  379
                +   T      S    DYESAGSN+T +ILLHS++L G RIPYES+ F+  LSK  
Sbjct  312  PAASSGRPTQQSSLFSQSSIDYESAGSNRTLEILLHSRYLQGRRIPYESVVFKTTLSKGV  371

Query  380  SGEAWICQY-GRPTA----------------FAEEIELTASLIHPHIVKFIGVAWNSLSN  422
            +GE W+C+Y GR  A                FAEEIEL+ASL+HP IV+FIGVAWNSL+N
Sbjct  372  NGEVWMCEYNGRKVAVKHLIQENQKAETVQAFAEEIELSASLVHPSIVEFIGVAWNSLNN  431

Query  423  LSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNN  482
            L+MVLE+  +G+LQ +LHKN+D+L+WA D+I MAVAVA+AL+YLH R   IIHRDLKSNN
Sbjct  432  LAMVLEYFPKGNLQSYLHKNADLLTWARDKIQMAVAVADALQYLHGRFTPIIHRDLKSNN  491

Query  483  ILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            ILLT+ L+PKLIDFGVSRG ++LTMTAG+GTPYWTAPE+LEG RY+E+ADIYSFGVVLSE
Sbjct  492  ILLTKQLEPKLIDFGVSRGRVELTMTAGIGTPYWTAPEILEGKRYTEQADIYSFGVVLSE  551

Query  543  LDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDR  602
            LDTG+ PY D     G+K  PFQILQ+++ G L+PSF+  CPPRI R+  ACLSFDPS R
Sbjct  552  LDTGKTPYHDARTQGGSKAKPFQILQDIVDGCLQPSFTRQCPPRIYRVGMACLSFDPSLR  611

Query  603  PTAQELIQWLEG  614
            PTA +LI+ LEG
Sbjct  612  PTASQLIRELEG  623

>PHYKE_3
Length=598

 Score = 643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/562 (57%), Positives = 391/562 (70%), Gaps = 54/562 (10%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIA+QLY RH++GDT   V++ S+PTAV +RLD L I F +LPGLVQ AVLWDTGF
Sbjct  43   GTNSDIAQQLYIRHQAGDTKDTVTLSSIPTAVANRLDPLNIDFNNLPGLVQRAVLWDTGF  102

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISPN DP+QIWT  +++MADIAV   D+T V+CT L C QP+   AY SQYC+G Q+LN
Sbjct  103  AISPNDDPIQIWTMKNYSMADIAVPMSDVTKVDCTFLNCSQPDGEVAYYSQYCTGYQMLN  162

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTE----PTTGVSYSVYAVH  222
            VSRC+ D FEDS A+DF+G+MWS GGD  M P +RL DH WTE      T VSYSVY VH
Sbjct  163  VSRCVADIFEDSSARDFMGMMWSKGGDPDMAPELRLLDHAWTEYNNWTDTNVSYSVYVVH  222

Query  223  TVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVG  282
            TVS  +DP WN CP NNGY+SL VPCH+  ++S  E+AA+ K  GS W+T WL+ EFA  
Sbjct  223  TVSRENDPAWNNCPANNGYASLTVPCHRSDQYSADELAAMTKTSGSAWMTTWLEQEFA--  280

Query  283  DSSGFD--------------------------ElllipillsssCCDFDVVSPNYLGVVA  316
            + S F+                                  LS+  C+  V SP YLG   
Sbjct  281  EDSSFNLVLLVPIILGVLVVIAAIGGWFWWRRRSKAKAKNLSTGGCEIGVQSPEYLGGST  340

Query  317  HEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELS  376
             E +R  TV T     + SSH  +YESAGSN+T KILL SQHL+G RI YESL+F+  LS
Sbjct  341  PEISRMPTVMTNQ---TTSSHL-EYESAGSNKTLKILLGSQHLMGKRISYESLTFEKALS  396

Query  377  KAASGEAWICQY------------------GRPTAFAEEIELTASLIHPHIVKFIGVAWN  418
            K ASGE W+C+Y                  G   AFAEEIEL+A+L HPHIV FIGVAWN
Sbjct  397  KGASGEVWVCEYNSHKVAVKRLLQTKDQNAGSVQAFAEEIELSATLDHPHIVSFIGVAWN  456

Query  419  SLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
            SL+NL MVLEF+ +G+LQ +L KN+D+LSWA D+I MA+ +A+ALEYLH+R+P +IHRDL
Sbjct  457  SLNNLVMVLEFLPQGNLQNYLQKNADLLSWARDKIQMAIGIAQALEYLHNRTPPLIHRDL  516

Query  479  KSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGV  538
            KSNNILLT  L+PKLIDFGVSR   ++TMTAGVGTPYWTAPEVLEG RY+E+ADIYSFGV
Sbjct  517  KSNNILLTSHLEPKLIDFGVSRDRTEITMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGV  576

Query  539  VLSELDTGRIPYFDTVDHDGAK  560
            VLSELDT +IPY D V  DG++
Sbjct  577  VLSELDTCKIPYADAVTEDGSR  598

>PPTG_16186
Length=608

 Score = 642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/595 (55%), Positives = 413/595 (69%), Gaps = 44/595 (7%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQL+TRH++GD+   V++ S+P AV DRL+ L I F  LPGLVQ AVLWDTGF
Sbjct  27   GTNSDIARQLFTRHQAGDSDDRVNLTSIPAAVLDRLNPLNIDFHDLPGLVQRAVLWDTGF  86

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP  DPVQIWT  + +MAD+AV    +TNV+CT L C QPN   A+ SQYC+G Q+LN
Sbjct  87   SISPGNDPVQIWTMHNHSMADLAVPKYQVTNVDCTYLNCSQPNGVTAHYSQYCTGWQMLN  146

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTT----GVSYSVYAVH  222
            VSRC+ D FED GA  +LG+MWS GGD  MTP IRLRDHTWT+        +++SVY VH
Sbjct  147  VSRCVADVFEDPGAGTYLGMMWSVGGDPDMTPLIRLRDHTWTQDIAEFGGNITFSVYVVH  206

Query  223  TVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAA-VNKPRGSEWVTMWLKDEFAV  281
            TV    DP WN+CP +  Y+SL VPCH+R E+SD E+AA + KP GS WV  WL+ EFA 
Sbjct  207  TVPHELDPAWNECPHDESYASLTVPCHRRDEYSDEEVAANMTKPTGSAWVNTWLETEFA-  265

Query  282  GDSSGFDElllipillsssCCDFDVVSPNYLGVV----AHEQARRGTVATTSYGPSISS-  336
             + S FD +               ++ P  +G++       Q R     +T+ G +  S 
Sbjct  266  REKSEFDTM---------------LLVPIIVGILFVLWFCWQCRSKQKLSTARGDTRRSS  310

Query  337  -HQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPT--  392
                +Y S   NQT +IL  S++L G RI +E+LSF+   S+ ASGE W+C+Y GR    
Sbjct  311  LSNPNYCSPNVNQTLQILFGSEYLQGKRISFENLSFRRLASRGASGEIWVCEYNGRQVAA  370

Query  393  --------------AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGF  438
                          AFAEEIELTA L+HP+IV+FIGV WNSLSNL+MV+EF  +G LQ +
Sbjct  371  KRLHTKDLNAVKVQAFAEEIELTARLVHPNIVEFIGVVWNSLSNLTMVIEFYPKGCLQDY  430

Query  439  LHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGV  498
            LHKN ++LSW  +++ + V +A+ALEYLH+ SP +IHRD+KSNN+L++ +L+PKLIDFGV
Sbjct  431  LHKNKNLLSWGQEKMRITVGIAKALEYLHAHSPPLIHRDVKSNNVLISNELEPKLIDFGV  490

Query  499  SRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG  558
            SR V+DLTMTAG+GTP+WTAPEVLEG RY+E+ADIYSFGVVLSELD  + PY D V   G
Sbjct  491  SRVVLDLTMTAGIGTPFWTAPEVLEGDRYTEQADIYSFGVVLSELDMCKTPYTDAVTEGG  550

Query  559  AKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            +K   FQILQEVMAG LRP+FS DCP R+ R+A ACLS DPS RPTA E+I+ L+
Sbjct  551  SKARHFQILQEVMAGELRPNFSEDCPSRVLRVAMACLSLDPSSRPTASEVIRQLD  605

>PHYSO_337966
Length=668

 Score = 639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/642 (52%), Positives = 424/642 (66%), Gaps = 53/642 (8%)

Query  21   TITFRSLEEQDPEssslpsdfsfdfd----GTNSDIARQLYTRHRSGDTSAAVSIKSVPT  76
            TITFRSLE     S S  S    +      GTNSDIA+QLY RH++GDT  A+ +  VP+
Sbjct  20   TITFRSLEAAASGSYSSSSALPTNASFVFDGTNSDIAQQLYIRHKAGDTGVALDLTFVPS  79

Query  77   AVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDIT  136
            AVT RL  L IAF  LPGLVQ AVLWD+GF +SP+ DPVQIWT GD+++ DIA+   D+ 
Sbjct  80   AVTKRLSPLNIAFNDLPGLVQRAVLWDSGFAVSPDNDPVQIWTMGDYSITDIAIPKADVA  139

Query  137  NVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATM  196
            NV+CT L C QPN   AY ++ C+G QILN SRC+VD FED GA  FLG MWSTGG    
Sbjct  140  NVDCTFLNCSQPNAETAYFTKTCTGYQILNASRCVVDLFEDPGAGSFLGTMWSTGGFPNR  199

Query  197  TPHIRLRDHTWT----EPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRS  252
            TP +RLR+HTWT    E    +++SVY+VHTV S +D TWN CP  +GY SL VPC  R+
Sbjct  200  TPELRLREHTWTQDIDEFGGNITFSVYSVHTVPSREDSTWNVCP--SGYGSLTVPCIPRN  257

Query  253  EFSDAEMAA-VNKPRGSEWVTMWLKDEFAVGDSSGFDElll-------------------  292
            + SDA M A  + P GS WVT WL+DEFA GDS GF++LLL                   
Sbjct  258  QVSDAYMVANTSVPTGSAWVTTWLEDEFA-GDS-GFNKLLLIPILLSVLLVIGGVGWYLW  315

Query  293  ---ipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQT  349
                  L      ++  VSP+Y      +   R  V T+      S+    YES GSN+T
Sbjct  316  RLRAKKLAEKLTYEYGAVSPHYWSGGTPDMVVRPMVVTSQLTSQFSTLSSHYESVGSNKT  375

Query  350  FKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------  392
             +ILL S+HL G  IP+ESL+F+  +SK ASGE WIC+Y                     
Sbjct  376  LQILLGSEHLQGKHIPFESLAFEKAISKGASGEVWICEYNGQKVAVKRLLQTKHQRAHDV  435

Query  393  -AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGD  451
             AFAEEIEL+ASL HP+IV+FIGVAWN+L+NL MV+E +  G LQ +L ++  +LSW+  
Sbjct  436  QAFAEEIELSASLAHPNIVEFIGVAWNTLNNLVMVIELLPMGSLQRYLREDGMLLSWSNG  495

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            ++ MA+ +A ALEYLH+R+P +IHRDLKS+NILLT+ L+PKLIDFG SR  +DLTMT G+
Sbjct  496  KLEMAIGIASALEYLHARTPPLIHRDLKSSNILLTKTLEPKLIDFGASRDTIDLTMTGGI  555

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GTPYWTAPEVLEG RYS++ADIYSFGVVLSELDTG+ PY D V  +G    PF +LQ+VM
Sbjct  556  GTPYWTAPEVLEGKRYSQRADIYSFGVVLSELDTGKAPYADAVTENGGMPKPFYVLQDVM  615

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            AG LRPSFS +CP  I+R+  ACL+ +P +RPT +EL+  L+
Sbjct  616  AGRLRPSFSKNCPVWIKRLGLACLALEPRNRPTVRELVHELQ  657

>PHYSO_337952
Length=619

 Score = 615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/594 (54%), Positives = 399/594 (67%), Gaps = 42/594 (7%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIA+QLYTRHR+GD++  V++ SVP AV DRLD L I F  LPGLVQ AVLWD+GF
Sbjct  36   GTNSDIAQQLYTRHRAGDSTDQVNLTSVPAAVIDRLDPLNIDFGELPGLVQRAVLWDSGF  95

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             I+P  DPVQIWT    +MAD+A+   D+  V+CTM  C QPN+  AYSSQ CS +QILN
Sbjct  96   AIAPGNDPVQIWTLYKHSMADLALPVSDVLTVDCTMTNCSQPNNITAYSSQSCSSSQILN  155

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTG---VSYSVYAVHT  223
            + RC+ DTFED+GA  +LG  W+ GGD    P + LR+H+W E T     V  SVYAVHT
Sbjct  156  MVRCVADTFEDNGAGTYLGTFWANGGDPGGIPGLLLREHSWAESTAQNETVINSVYAVHT  215

Query  224  VSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
              SAD+  W  CP  +GY+S  VPC +R  +   + A +  P+ S WVT WL++EFA G 
Sbjct  216  TPSADEAAWATCP-TSGYASFTVPCQRRDAYR-GDTAGLRVPKASAWVTKWLEEEFAHG-  272

Query  284  SSGFDElllipillsssCCDFDVVSPNYLGVVAH------EQARRGTVATTSYGPSISSH  337
                           S      V +   +G+ A       ++ ++ +  T+S        
Sbjct  273  ------------FPLSLVIVIVVSAIAAIGIGAFCWHRRIQRVKQQSSTTSSEARLRPPA  320

Query  338  QGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----  392
            +  YE+AG+N+T  +LL+S++L G RIPYESL F   LSK A GE W+C Y R       
Sbjct  321  ESVYEAAGTNETLHLLLNSEYLQGKRIPYESLVFDKALSKGAYGEVWLCDYNREKVAVKR  380

Query  393  -------------AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL  439
                         AFAEEIEL+ASL+HP+IV+FIGVAWNSLSNL MVLEF  +G LQ +L
Sbjct  381  LLQSKQQKADKVHAFAEEIELSASLVHPNIVEFIGVAWNSLSNLVMVLEFFPKGSLQNYL  440

Query  440  HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVS  499
            H+    LSWA D+I +A+ +A AL+YLH+R+P +IHRDLKSNNILLTE L PKLIDFGVS
Sbjct  441  HQGGGQLSWASDKITLAIGIARALDYLHARTPPLIHRDLKSNNILLTEALGPKLIDFGVS  500

Query  500  RGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA  559
            RG +DLTMTAGVGTPYWTAPE+LE  RY EKAD+YSFGVVLSELDT  IP+ D +  DG+
Sbjct  501  RGKVDLTMTAGVGTPYWTAPEILESKRYDEKADVYSFGVVLSELDTCEIPFSDALTEDGS  560

Query  560  KLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            K  PFQILQ VM GTL+P FS DCPP I++IA +CL  DP+DRPTA +LI+ LE
Sbjct  561  KAKPFQILQNVMKGTLQPRFSTDCPPVIRQIALSCLKLDPADRPTASQLIRDLE  614

>PPTG_16190
Length=641

 Score = 548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/633 (46%), Positives = 391/633 (62%), Gaps = 70/633 (11%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G++SD++RQLY R ++ D+ A V++  VP AV  RLD L++ ++ LPGL QLA+LWD+GF
Sbjct  13   GSSSDLSRQLYYRAKANDSVAQVTLNPVPDAVQSRLDDLELDWSKLPGLAQLALLWDSGF  72

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             I+ N D VQ+WT    +M+ +A++  +  N  C    C +P+D   Y S+YC+G Q+  
Sbjct  73   AINSNNDAVQVWTLEGHSMSTLALTLTEYENAGCVPKNCTEPDDAIMYESRYCNGAQMSY  132

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++C+V  F+  GA  +   MW  GG++   P +R+  H W +   G  Y + A+HTV++
Sbjct  133  AAKCVVQDFDGDGA--YHAAMWGIGGNSESAPALRMLKHEWND--NGTDYEIMALHTVTA  188

Query  227  ADDPTWNQCPVNN---GYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWL----KDEF  279
             ++P WN CP++N   GY SL+ PC      +      + +  GS WV+ WL    KD  
Sbjct  189  ENEPGWNACPISNMNGGYGSLVFPCRTTGNITAENKKQMKEVTGSAWVSEWLVTDYKDTA  248

Query  280  AVGDSSGFDEllli-------------------pillsssCCD-FD---------VVSPN  310
             V DSSGF+ LLLI                          C D F+         VV+P+
Sbjct  249  GV-DSSGFNMLLLIPIILGVLVIFALIGLVFYCKKKRRQRCLDEFEESTTGESPYVVAPS  307

Query  311  YLGVVAHEQARRGTVA------TTSYGPSISSHQ-----GDYESAGSNQTFKILLHSQHL  359
                   +   R TVA      T +Y  +  + Q     G++ S GSN T  +LL S++L
Sbjct  308  AKSFDQRDTLARPTVAVSEDMTTATYSGADQTIQFPGYGGEFMSGGSNTTLSVLLMSEYL  367

Query  360  LGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELT  401
            +G RIP E+L+F+  LSK ASGE WIC+Y G+  A                 FA EI+L 
Sbjct  368  VGQRIPLENLNFERALSKGASGEVWICEYAGQKVAAKRLLQTKENKAEDVHEFALEIDLN  427

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAE  461
            A L HP+I  FIGVAW SL+NL+MV+E+   GDLQ +L +N+D+LSWA D+I+MAV VA 
Sbjct  428  ARLEHPNIGAFIGVAWGSLNNLTMVIEYFPLGDLQKYLKRNADLLSWARDKIHMAVGVAR  487

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEV  521
            ALEYLH  SP IIHRDLKS NILLT  L+ K+IDFGVSRG +D TMTAGVGTP+WTAPE+
Sbjct  488  ALEYLHGYSPPIIHRDLKSKNILLTRQLEAKVIDFGVSRGRLDNTMTAGVGTPFWTAPEI  547

Query  522  LEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSV  581
            LEG RYSE+ADIYSFGVVLSELDTG+IP++D    DG K  PF ILQEVMAGTLRPSFS 
Sbjct  548  LEGKRYSEQADIYSFGVVLSELDTGKIPFYDCAGSDGKKTKPFHILQEVMAGTLRPSFSP  607

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            DCPPRI+RI   C   DPS RP+A +L++ L+G
Sbjct  608  DCPPRIRRIGVLCCQHDPSRRPSAAQLVEMLQG  640

>PHYRA_84555
Length=663

 Score = 526 bits (1354),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 288/636 (45%), Positives = 386/636 (61%), Gaps = 72/636 (11%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++G  +  ++  +VP  +  RLD L +A+  LPG+ Q A+LWD+GF
Sbjct  28   GTNSDLARQLYLRAQAGADAPQITNLAVPDLLQKRLDELHLAWDKLPGIAQRALLWDSGF  87

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++ +   VQIWT    +M D+AV       V C  + C QP++T   S++ C+G Q+LN
Sbjct  88   GVTLDNKAVQIWTLAGHSMTDLAVPLAQFQAVGCVEMNCTQPDNTTRLSNRNCNGAQMLN  147

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTG--VSYSVYAVHTV  224
              RC+++ FED   ++    MW TGGD    P  R+R H W + ++G  ++Y+V AVHTV
Sbjct  148  AVRCVMEDFED--PENIHASMWVTGGDPKAVPVPRVRKHEWIDGSSGSVINYTVLAVHTV  205

Query  225  SSADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAV  281
               ++P W +CP    N GY SL++ CH  +E SD  M    +  GS WV+ WL DE++ 
Sbjct  206  DIDNEPGWGECPTDAQNGGYGSLVLSCHSTAETSDEVMNEKQEVEGSPWVSRWLVDEYSS  265

Query  282  GDSSG---FDElllipillsssCCDFDVV-------------SPNYLGVVAHEQ------  319
              S+G   FD L+LI  +++  C    V+             + N L     E+      
Sbjct  266  VASTGSGKFD-LVLIAPIVAGVCVIVGVIGLVIFFKRRRSNRADNVLIESPQERPSSMYG  324

Query  320  ARRGTVATTSYGPSISSHQGDYESA------------------------GSNQTFKILLH  355
            A + T A  +      S +G  E A                        GSN+T KILL 
Sbjct  325  AYKDTAADGAKNGPCRSTEGTIEDAETAPYRRCDDGVKRSSLYEDDFSSGSNETLKILLR  384

Query  356  SQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEE  397
            S+ L+G RIPYE L+++  LSK ASGE W+ +Y G+  A                 FA+E
Sbjct  385  SEFLVGKRIPYEMLTYERALSKGASGEVWVGEYEGKQVAMKRLLQTKNNRAEQVEEFAKE  444

Query  398  IELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAV  457
            IEL+ASLIHP+IV F+GVAWNSL+NL MVLEF   GDL  +L KNSD+LSW  D++ +AV
Sbjct  445  IELSASLIHPNIVAFLGVAWNSLNNLVMVLEFFPVGDLHEYLSKNSDLLSWTKDKMEIAV  504

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             V  A+ YLHSR+P +IHRDLKS NILLT  L+PKLIDFGVSR   + +MTAGVGTPYWT
Sbjct  505  GVMRAVGYLHSRTPPLIHRDLKSKNILLTRRLEPKLIDFGVSRDRQEHSMTAGVGTPYWT  564

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRP  577
            APE+LEG RY+E++DIYSFGVVL+ELDTG+IPY D +  DG K  PF IL +VMAG LRP
Sbjct  565  APEILEGKRYTEQSDIYSFGVVLTELDTGKIPYHDALTPDGKKPKPFHILADVMAGVLRP  624

Query  578  SFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            +FS DCP  ++RI  AC   DP  RPTA +++Q L+
Sbjct  625  NFSDDCPRAVRRIGVACCQQDPERRPTAAQILQMLK  660

>PPTG_16198
Length=656

 Score = 522 bits (1344),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 276/631 (44%), Positives = 371/631 (59%), Gaps = 71/631 (11%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+A+QLY R R+GD         +P  +  RLD L++ +  LPG+ Q A+LWD+GF
Sbjct  28   GTNSDLAKQLYNRARAGDDVEKFPKFEIPQTLQTRLDQLQLDWYKLPGIAQRALLWDSGF  87

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GIS    PV+IWT  D +MAD+AV       VNCT+ EC Q + + +Y++  C G  +L 
Sbjct  88   GISSYNRPVKIWTLNDHSMADLAVPKSRYEAVNCTVKECTQRDGSISYANYKCLGRDMLK  147

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+V+ FED    D    MW TGGD  + P +R+  H W +     SY V+AVHT+  
Sbjct  148  AARCVVEDFEDE--TDIHAAMWVTGGDPEVVPTLRVNKHEWKDMHDNNSYIVFAVHTIDQ  205

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA---  280
              +P W+QC     NNGY SL++PCH  +  +    ++  +  GS WV+ WL +E++   
Sbjct  206  NGEPAWDQCAKANQNNGYGSLVLPCHTTANITAEINSSKQEVTGSAWVSQWLVEEYSSVA  265

Query  281  --------------------------VG-------------DSSGFDElllipillsssC  301
                                      +G             D  GF E  + P     SC
Sbjct  266  GTTDDGEINLSLLAPIVAGVLVVIGVIGLFVFLKKRRQSREDPIGFTESPVCPDNYYQSC  325

Query  302  CDFDVVSPNYLGVVAHEQAR--RGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHL  359
             D D  + + +  V   +    +G   T    PS +   G    +GSN+T  IL +S+ L
Sbjct  326  RDLDFGARSTVHTVVDSETATYKGVDRTIKLKPSYTGEFG----SGSNRTLNILHNSEFL  381

Query  360  LGNRIPYESLSFQMELSKAASGEAWICQ------------------YGRPTAFAEEIELT  401
            +G R+ Y+S+ F+  LSK A+GE W+C+                   G    FA+EIEL+
Sbjct  382  VGKRLSYDSIIFKQALSKGANGEVWLCECQNEQVAVKRLFQNQNHHAGEVEEFAQEIELS  441

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAE  461
            ASL HP+IV FIG+AWNSL+NL MVLE+   GDLQ  L KN D++SW+ D+I++AV  A 
Sbjct  442  ASLKHPNIVSFIGMAWNSLNNLVMVLEYFPMGDLQSCLQKNGDLMSWSRDKIHIAVGTAS  501

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEV  521
            AL+YLHSR+P +IHRDLKS NILLT  L+ KLIDFGVSR   + +MTAGVGTPYWTAPE+
Sbjct  502  ALQYLHSRTPPLIHRDLKSKNILLTRALEAKLIDFGVSRARQEYSMTAGVGTPYWTAPEI  561

Query  522  LEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSV  581
            LEG RY+E+AD+YSFGVVLSELDT ++P+ D    DG KL P QIL +VMAG LRPSFS 
Sbjct  562  LEGKRYTEQADLYSFGVVLSELDTCKLPFHDAFTSDGKKLKPVQILADVMAGMLRPSFSN  621

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            +CP RI+RI  AC   DPS RP+A +++  L
Sbjct  622  ECPQRIRRIGVACCQQDPSRRPSAAQVVSML  652

>PHYSO_337957
Length=656

 Score = 517 bits (1332),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 276/616 (45%), Positives = 383/616 (62%), Gaps = 51/616 (8%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++GD++A     SVP+AV  RLD LK+ ++ LPG+ Q A+LWD+GF
Sbjct  33   GTNSDLARQLYFRAKAGDSAAQFKNISVPSAVQARLDELKLDWSKLPGIAQRALLWDSGF  92

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++ +  PV IWT    +MAD+AV         C  + C QP +T +YS+ +C G Q+L 
Sbjct  93   GVTKDSQPVPIWTLNGHSMADLAVPLPQFQAAGCEEMACEQPGNTTSYSNLWCGGAQMLK  152

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            V+RC+V+ FED+   +    MW TGG+    P +++R H W +   G SY V+AVHT+  
Sbjct  153  VARCVVEDFEDN--DEIHAAMWVTGGNPAEVPTLKVRKHEWKDERDGNSYVVFAVHTLEL  210

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEF---A  280
            AD+P+WN C +   N+GY SL++PC+  +  ++     + + +GS WV  WL +++   A
Sbjct  211  ADEPSWNSCALATQNDGYGSLVLPCYTTANITEGIKNDMEQTKGSLWVARWLSEDYGTAA  270

Query  281  VGDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSH-QG  339
               S GF+ +LL+PI++ +            +     +++R   +  T   PS +   QG
Sbjct  271  KATSKGFNLVLLVPIIIGAIIVVLLGALLVLVQRRRRQRSRENQLPDTVASPSSNIRAQG  330

Query  340  ----------DYESAGS--------------NQTFKILLHSQHLLGNRIPYESLSFQMEL  375
                          AGS              N T K LL S+ L G RIPYES+  +  +
Sbjct  331  PRSLRDPYTLHVAGAGSRFVNNSTMQSSEYGNATLKALLSSERLSGKRIPYESIVLKRMI  390

Query  376  SKAASGEAWICQ-YGRPTA-----------------FAEEIELTASLIHPHIVKFIGVAW  417
            SK A GE W+    G+  A                 FA+EIE++ASLIHP+IV F+GVAW
Sbjct  391  SKGAYGEVWLGDIVGQQVAVKRLLQNKTHLAEEVEEFAQEIEISASLIHPNIVAFVGVAW  450

Query  418  NSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRD  477
            NSL+NL+MV+E+   GDLQ +L KN D+LS   D+I +A  +A ALEYLH+R+P +IHRD
Sbjct  451  NSLNNLAMVIEYFPTGDLQTYLRKNFDLLSLPKDKIPIAAGIALALEYLHARTPPLIHRD  510

Query  478  LKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            LKS N+LLT+ L+ KLIDFGVSRG  + +MTAGVGTPYW+APE+LEG +Y+E+ADIYSFG
Sbjct  511  LKSKNVLLTKKLEAKLIDFGVSRGRQENSMTAGVGTPYWSAPEILEGRKYTEQADIYSFG  570

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
            VV+SELDTG IPY DT+  DG KL P QIL EV+AG LRP+ S DCP +I+ I  AC   
Sbjct  571  VVMSELDTGMIPYQDTLTSDGKKLEPIQILAEVVAGRLRPTLSKDCPQQIRDIFEACCHQ  630

Query  598  DPSDRPTAQELIQWLE  613
            DP  RPTA ++++ L+
Sbjct  631  DPDQRPTAAQVVKLLQ  646

>PHYSO_325252
Length=656

 Score = 517 bits (1331),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 276/616 (45%), Positives = 383/616 (62%), Gaps = 51/616 (8%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++GD++A     SVP+AV  RLD LK+ ++ LPG+ Q A+LWD+GF
Sbjct  33   GTNSDLARQLYFRAKAGDSAAQFKNISVPSAVQARLDELKLDWSKLPGIAQRALLWDSGF  92

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++ +  PV IWT    +MAD+AV         C  + C QP +T +YS+ +C G Q+L 
Sbjct  93   GVTKDSQPVPIWTLNGHSMADLAVPLPQFQAAGCEEMACEQPGNTTSYSNLWCGGAQMLK  152

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            V+RC+V+ FED+   +    MW TGG+    P +++R H W +   G SY V+AVHT+  
Sbjct  153  VARCVVEDFEDN--DEIHAAMWVTGGNPAEVPTLKVRKHEWKDERDGNSYVVFAVHTLEL  210

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEF---A  280
            AD+P+WN C +   N+GY SL++PC+  +  ++     + + +GS WV  WL +++   A
Sbjct  211  ADEPSWNSCALATQNDGYGSLVLPCYTTANITEGIKNDMEQTKGSLWVARWLSEDYGTAA  270

Query  281  VGDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSIS-SHQG  339
               S GF+ +LL+PI++ +            +     +++R   +  T   PS +   QG
Sbjct  271  KATSKGFNLVLLVPIIIGAIIVVLLGALLVLVQRRRRQRSRENQLPDTVASPSSNIRAQG  330

Query  340  ----------DYESAGS--------------NQTFKILLHSQHLLGNRIPYESLSFQMEL  375
                          AGS              N T K LL S+ L G RIPYES+  +  +
Sbjct  331  PRSLRDPYTLHVAGAGSTFVNNSTMQSSEYGNATLKALLSSERLSGKRIPYESIVLKRMI  390

Query  376  SKAASGEAWICQ-YGRPTA-----------------FAEEIELTASLIHPHIVKFIGVAW  417
            SK A GE W+    G+  A                 FA+EIE++ASLIHP+IV F+GVAW
Sbjct  391  SKGAYGEVWLGDIVGQQVAVKRLLQNKTHLAEEVEEFAQEIEISASLIHPNIVAFVGVAW  450

Query  418  NSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRD  477
            NSL+NL+MV+E+   GDLQ +L KN D+LS   D+I +A  +A ALEYLH+R+P +IHRD
Sbjct  451  NSLNNLAMVIEYFPTGDLQTYLRKNFDLLSLPKDKIPIAAGIALALEYLHARTPPLIHRD  510

Query  478  LKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            LKS N+LLT+ L+ KLIDFGVSRG  + +MTAGVGTPYW+APE+LEG +Y+E+ADIYSFG
Sbjct  511  LKSKNVLLTKKLEAKLIDFGVSRGRQENSMTAGVGTPYWSAPEILEGRKYTEQADIYSFG  570

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
            VV+SELDTG IPY DT+  DG KL P QIL EV+AG LRP+ S DCP +I+ I  AC   
Sbjct  571  VVMSELDTGMIPYQDTLTSDGKKLEPIQILAEVVAGRLRPTLSKDCPQQIRDIFEACCHQ  630

Query  598  DPSDRPTAQELIQWLE  613
            DP  RPTA ++++ L+
Sbjct  631  DPDQRPTAAQVVKLLQ  646

>PPTG_16192
Length=637

 Score = 508 bits (1309),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 270/613 (44%), Positives = 381/613 (62%), Gaps = 56/613 (9%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R  +  + +  +   +P+AV DRLD L + +  LPG+ Q A+LWD+GF
Sbjct  31   GTNSDLARQLYFRANAEASVSQFNNLEIPSAVQDRLDELDLDWNKLPGIAQRALLWDSGF  90

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++ +  PV+IWT  + TMA++AV  + +  V C    C QP++T +YS+++C G Q+L 
Sbjct  91   GLTASYTPVKIWTLNNHTMANLAVPLEQVRAVGCEEKACVQPDNTTSYSNEWCGGAQLLQ  150

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+V+ F D+G  D    MW TGG+  + P   +  H W +     SY V+A+HT+  
Sbjct  151  AARCVVEDFVDTG--DIHAAMWVTGGNPIVIPTPHVLKHEWKDQRDKNSYIVFAIHTLDF  208

Query  227  ADDPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
             D+P WN CP    N+GY SL+VPC      ++A M A+ +  GS WV+ WL ++++  D
Sbjct  209  DDEPAWNTCPDSTQNDGYGSLVVPCFTTDNITNATMEAMKEVEGSPWVSRWLVEDYSTPD  268

Query  284  SSGFDElllipillsssCCDFDVVSPNYLG--VVAHEQARRGTVATTSYGPSI-------  334
               F  +LL+PI+         V +   LG  ++  ++ +R   +T+S G  I       
Sbjct  269  EHEFKMILLVPIIGGI------VATIGLLGLLIIVKQRRQRQPKSTSSDGAQICSKDLKR  322

Query  335  ---------SSHQ-------GDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
                     SSH        GD+E   S  T +  + S+ LL  RIPY+S+ F+  +SK 
Sbjct  323  GYRNSNQGLSSHHPANNSTFGDFEWTSS--TLRETIGSESLLDKRIPYDSIHFERVVSKG  380

Query  379  ASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSL  420
            ASGE W+  + G+  A                 FA+EI+L+ASL HP+IV FIGVAWNSL
Sbjct  381  ASGEVWLADFQGQQVAVKRLLQSKTHSADEVEEFAQEIQLSASLTHPNIVGFIGVAWNSL  440

Query  421  SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKS  480
            +N  MVLEF+  GDLQ +L KN D+L W+ D+I++A+ +A ALEYLHSRSP +IHRDLKS
Sbjct  441  TNFVMVLEFLPLGDLQAYLRKNFDLLLWSKDKIHIAIGIALALEYLHSRSPPLIHRDLKS  500

Query  481  NNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL  540
             NIL+++ L+PKL DFGVSR   +  MTAGVGTPYW+APE+LEG +Y+E ADIYSFGVVL
Sbjct  501  RNILISKRLEPKLSDFGVSRTRQENIMTAGVGTPYWSAPEILEGKQYTELADIYSFGVVL  560

Query  541  SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS  600
            SELDT ++PY D +  +G    PF+IL EV+ G LRP+FS +C P+I+RI  AC   DP 
Sbjct  561  SELDTAKLPYHDALTPEGKSQKPFKILAEVITGVLRPTFSKECSPQIRRIGVACCQHDPD  620

Query  601  DRPTAQELIQWLE  613
             RPTA ++++ L 
Sbjct  621  RRPTAAQVLEMLR  633

>PHYCA_107484
Length=343

 Score = 495 bits (1275),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 242/332 (73%), Positives = 274/332 (83%), Gaps = 20/332 (6%)

Query  301  CCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL  360
              +FDVVSP+Y   VA +QA R +  ++ YGPS+SSH  DYESAGSNQTFKILLHSQHL 
Sbjct  8    ALEFDVVSPHY--AVARDQALRPSHPSSCYGPSVSSHPDDYESAGSNQTFKILLHSQHLY  65

Query  361  GNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIELTA  402
            GNRI Y+ L FQ ELSK A+GE WICQYG                     AFAEEI+LTA
Sbjct  66   GNRIAYDGLVFQSELSKGAAGEVWICQYGGQQVAVKKLLHTRDQKAEDVQAFAEEIDLTA  125

Query  403  SLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEA  462
            SLIHPHIVKFIGVAWNSLSNL+MVLE+V  G+L+ +LH NSD+LSWA D+I+MA+A+AEA
Sbjct  126  SLIHPHIVKFIGVAWNSLSNLAMVLEYVPGGNLKDYLHNNSDLLSWARDKIHMALAIAEA  185

Query  463  LEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVL  522
            LEYLH ++PAIIHRDLKSNNILLTE+LDPKLIDFGVSRG +D+TMTAGVGTPYWTAPEVL
Sbjct  186  LEYLHLQTPAIIHRDLKSNNILLTENLDPKLIDFGVSRGKLDVTMTAGVGTPYWTAPEVL  245

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
            EG RY+EKADIYSFGVVLSELDTGRIPYFD ++ DG KLMPFQILQEVM+GTLRPSF+ D
Sbjct  246  EGNRYTEKADIYSFGVVLSELDTGRIPYFDALEDDGTKLMPFQILQEVMSGTLRPSFTED  305

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            CP RIQRI AACL+ DP  RPTA+ELIQWLEG
Sbjct  306  CPLRIQRIGAACLALDPEQRPTARELIQWLEG  337

>PPTG_16193
Length=680

 Score = 507 bits (1306),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 269/635 (42%), Positives = 368/635 (58%), Gaps = 72/635 (11%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+A QLY R ++GDT+       VP  +  RL+ LK+ +  LPG+ Q A+LWD+GF
Sbjct  45   GTNSDLATQLYYRDKAGDTADQFDKFEVPKTLQTRLNELKLDWYKLPGIAQRALLWDSGF  104

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             I+    PV+IWT    +MAD+AV   +  +V CT+  C QPN+  + S+  C G  +L 
Sbjct  105  AITSANKPVKIWTLNGHSMADLAVPRSEFEDVGCTVKVCEQPNNKTSLSNNKCLGGDMLK  164

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+++ F DS   D    MW TGG+  + P  R+  H W +      Y V+A+HTV  
Sbjct  165  AARCVIEDFVDS--IDIHAAMWVTGGNPDVVPTPRVNKHAWNDSNDHKDYVVFAIHTVDL  222

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA---  280
              +P WNQC     N+GY SL++PCH     +    +A  +  G++WV+ WL ++++   
Sbjct  223  IGEPAWNQCAKADQNDGYGSLVLPCHTTENITAEIDSAKREATGTDWVSRWLVEDYSSIA  282

Query  281  --------------------------VGDSSGFDElllipillsssCCDFDVVSPNYL-G  313
                                      +G    F +           C +  V + NY  G
Sbjct  283  GTSPDNGKLNVLLIVSIAAGVLVVIGIGGLFFFCKRRRQAKKDLDYCEESPVCTNNYYQG  342

Query  314  V---------------VAHEQARRGTVATTSYGPSIS---SHQGDYESAGSNQTFKILLH  355
            +               +AH      T    +   +I     + G+++S GSN+T  IL +
Sbjct  343  IRDPDFLDDVSIPDRSIAHTVVDSETATYKAVDRTIKLKPFYTGEFDS-GSNRTLNILHN  401

Query  356  SQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEE  397
            S+ L+G R+ Y+S+ F+  LSK A+GE W+C+Y                       FA+E
Sbjct  402  SEFLVGKRLSYDSIIFKQALSKGANGEVWLCEYQNEQVAVKRLFQDQNHHADEVEEFAQE  461

Query  398  IELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAV  457
            IEL+ASL HP+IV FIG+AWNSL+NL MVLE+   GDLQ +L KN D++SW+ D+I++AV
Sbjct  462  IELSASLKHPNIVSFIGMAWNSLNNLVMVLEYFPMGDLQSYLQKNGDLMSWSRDKIHIAV  521

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
              A AL+YLHSR+P +IHRDLKS NILLT  L+ KLIDFGVSR   + +MTAGVGTPYWT
Sbjct  522  GTASALQYLHSRTPPLIHRDLKSKNILLTRALEAKLIDFGVSRARQEYSMTAGVGTPYWT  581

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRP  577
            APE+LEG RY+E+ADIYSFGVVLSELDT ++PY D V  DG  L P QIL +VMAG LRP
Sbjct  582  APEILEGKRYTEQADIYSFGVVLSELDTCKLPYHDVVGSDGKMLKPVQILADVMAGMLRP  641

Query  578  SFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            SFS +CP RI+RI  AC   DPS RP A +++  L
Sbjct  642  SFSDECPRRIRRIGVACCQQDPSRRPNAAQVVTML  676

>PHYCA_107239
Length=649

 Score = 471 bits (1211),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 267/631 (42%), Positives = 369/631 (58%), Gaps = 68/631 (11%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G+ SDIARQLY RH +G    + S  ++PTAVTDRL+ L ++F +LPGL+Q A+LWD+G+
Sbjct  24   GSTSDIARQLYLRHAAGQRIKSFSPNTIPTAVTDRLEPLNVSFDNLPGLLQRALLWDSGY  83

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP  D VQIWT G  +MA++AVS  +     CT L C QP+D+  Y++Q+C+GTQ+L 
Sbjct  84   VISPENDAVQIWTLGGRSMANLAVSKVEFDTTGCTALNCSQPDDSTYYANQFCTGTQMLT  143

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++C++D+F DS     L  MWS GGD  MTP IR   H W + +T  SY + AVHT++ 
Sbjct  144  AAKCLMDSF-DSDTSSHLA-MWSDGGDPEMTPQIRGVLHGWLDSSTDQSYLLSAVHTMTV  201

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSD---AEMAA-VNKPRGSEWVTMWLKDEFAVG  282
              +P +  C   +GY SL+VPC+  S  S    A M+A V+ P  + W+  +      + 
Sbjct  202  DSEPAYGTCN-QDGYGSLVVPCYTMSNTSADIVAVMSAPVHSPWVTTWIKQYQPKSDTIV  260

Query  283  DSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQAR----------------RGTVA  326
            +SS  D +     LL        + S      V  ++ R                R +  
Sbjct  261  NSSSDDGVGFNLWLLGPIILAAVIASVLIFFAVCKKRRRLRSVYLQRDSPADSECRSSQK  320

Query  327  TTSYGPSISSH--------------QGDYES-----------AGSNQTFKILLHSQHLLG  361
            +   GP  SS               Q D ES           + ++     L    +L+G
Sbjct  321  SKPTGPLSSSMSPDLQLMPSIRDSIQADRESIPALRETFCRYSAADNVQYTLTTDCNLVG  380

Query  362  NRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTAS  403
             RI +E +     LS+ A GE W C+Y G+  A                 F  EI+LTAS
Sbjct  381  KRIAWERIELGRLLSRGAFGEVWACRYAGKKVAVKRLLQTKKHTFLETENFTNEIQLTAS  440

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP+IV+FIGV W+SL NL+MV E++  GDLQ +L +N D+++WA D+I MA+ +A A+
Sbjct  441  LNHPNIVRFIGVTWSSLENLAMVEEYLPRGDLQKYLKRNGDLMTWARDKIDMAIGIARAI  500

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLE  523
            +YLH+R   +IHRD+K+ NILLT+ L PKLIDFG SR  +   M+AGVGTP+WTAPEVLE
Sbjct  501  DYLHTRE--VIHRDVKARNILLTKRLQPKLIDFGTSRLWVPNDMSAGVGTPFWTAPEVLE  558

Query  524  GARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDC  583
               Y+EKADIYSFGV+L+ELDT   PY +T+  +G K+ PF IL+EV+ GTLRPS + +C
Sbjct  559  STEYTEKADIYSFGVLLTELDTCEAPYHNTLGANGEKMKPFHILKEVVDGTLRPSLTPEC  618

Query  584  PPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            P RI+R A AC   DP  RP+A EL++ LEG
Sbjct  619  PQRIRRAAVACFQHDPKLRPSASELVRLLEG  649

>PHYSO_520885
Length=623

 Score = 466 bits (1199),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 269/614 (44%), Positives = 364/614 (59%), Gaps = 95/614 (15%)

Query  47   GTNSDIARQLYTRHRSGDTSAA-VSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTG  105
            GT+SD+ARQLY R +  DTS + V+I +VP AV  RLD +K+ ++ LPGL QLA+LWD+G
Sbjct  58   GTSSDLARQLYYRAKEDDTSVSQVTISAVPDAVQSRLDDMKLDWSKLPGLAQLALLWDSG  117

Query  106  FGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQIL  165
            F I+ + DPV++WT GD  M+ +A+SP                N+T A+ S  C+G Q+ 
Sbjct  118  FAINIHNDPVKMWTLGDNNMSTLALSP----------------NNTTAHESYLCNGAQMN  161

Query  166  NVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVS  225
              ++C+V+ F D   KD+   MW TGG+ +  P +R+  H W E      Y V A+HTV 
Sbjct  162  TAAKCVVEEFTD--GKDYNAAMWGTGGNPSAAPSLRVAKHEWWE-NGETHYVVMALHTVG  218

Query  226  SADDPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEF---  279
               +P WN C     N+G+ SL+ PC   +  + A  A   +  GS+WV  WL  ++   
Sbjct  219  IDQEPGWNACANSLQNDGFGSLVFPCRTTANLTAANEADKKEVEGSQWVEDWLVADYMAT  278

Query  280  -AVGDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQAR----RGTVATTSYGP--  332
                DS GF+ +LL+PI++ +      V    Y      +QA+      +  TT   P  
Sbjct  279  AKAEDSDGFNMILLVPIIVGALVVLALVALAFYCRRKRKQQAQKQQYEDSSTTTGQTPED  338

Query  333  -SISSHQG-------------DYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
             ++S++ G             ++ SAGSN T K+LL S+ L+G RIP ESL F+  LSK 
Sbjct  339  MTVSTYAGADQTIQFPAGYDSEFASAGSNTTLKVLLKSEFLVGKRIPLESLIFEKPLSKG  398

Query  379  ASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSL  420
            ASGE W+C+Y G+  A                 FA EIEL A L HP+I  FIGVAW+SL
Sbjct  399  ASGEVWVCEYAGQKVAAKRLLQTKDQKAEDVHEFALEIELNAHLQHPNIGAFIGVAWSSL  458

Query  421  SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKS  480
            +NL+MV+E+  +GDLQ +L KN+D+LSWA D+I+MAV                       
Sbjct  459  NNLAMVVEYFPQGDLQSYLRKNADLLSWAKDKIHMAVG----------------------  496

Query  481  NNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL  540
                    L+ K+IDFGVSRG +D TMTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVL
Sbjct  497  --------LEAKVIDFGVSRGRLDNTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVL  548

Query  541  SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS  600
            SELDT +IP+ D +D +G K  PF+ILQEVM+G LRPSFS DCPPRI+RI   C   DP+
Sbjct  549  SELDTCKIPFHDCMDTNGKKAKPFRILQEVMSGVLRPSFSEDCPPRIRRIGIMCCQHDPA  608

Query  601  DRPTAQELIQWLEG  614
             RPTA +L++ L+G
Sbjct  609  RRPTAAQLVEMLQG  622

>PITG_00005
Length=493

 Score = 443 bits (1139),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 253/537 (47%), Positives = 319/537 (59%), Gaps = 101/537 (19%)

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
            G++TMAD+AV   D++ V+CT L C QPN   A+ +QYC+G Q+LNVSR           
Sbjct  2    GNYTMADLAVPKADVSYVDCTYLNCSQPNGVTAHYAQYCTGWQMLNVSR-----------  50

Query  181  KDFLGIMWSTGGDATMTPHIRLRDHTWTE--PTTG--VSYSVYAVHTVSSADDPTWNQCP  236
                   W    D TMTP IRLRDH W +  P  G  +++ VY VHTV    DP WN+CP
Sbjct  51   -------W----DPTMTPSIRLRDHKWEQDIPEFGGLITFHVYVVHTVPHDLDPAWNECP  99

Query  237  VNNGYSSLIVPCHKRSEFSDAEMAA-VNKPRGSEWVTMWLKDEFAVGDSS---------G  286
            ++ GY+SL VPCH+R EF+D  MAA    P GS +VT WLK EFA  DS          G
Sbjct  100  LDEGYASLTVPCHRRIEFTDDYMAANTTVPAGSAFVTTWLKQEFAQEDSPSQLLIPVILG  159

Query  287  FDElllipillsssCCDFDVVSPNYLGVVAHEQA----------RRGTVATTSYGPSISS  336
                +    L   SC      S      + HE+           RR    ++      S+
Sbjct  160  VAIAVAGMALGWLSCRRKLEASMKQKSGIEHERRSQRSSGSSQERRAISISSPQQRRDSA  219

Query  337  HQGDY-ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA--  393
             Q  Y E AGSN+T   LL S+HL G RIP++S+ F+  +SK ASGE W+C++ R  A  
Sbjct  220  IQSLYCERAGSNKT---LLDSEHLEGKRIPFDSIVFERVISKGASGEVWVCEFNRQKAAV  276

Query  394  ----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQG  437
                            FA EIELTASLIHP+IV+FIGVAWNSL NL MVLE++S G L+ 
Sbjct  277  KRLLQRKKQKAESVQKFALEIELTASLIHPNIVQFIGVAWNSLDNLVMVLEYLSTGSLKE  336

Query  438  FLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFG  497
            FL +                                  R+  S+N+LLT+ ++PK+IDFG
Sbjct  337  FLEEP---------------------------------REFMSSNVLLTDSIEPKIIDFG  363

Query  498  VSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD  557
            VSRG++DL+MTAGVGTP+WTAPE+LEG  Y+EKAD+YSFGVVLSELDTG++PY D V  D
Sbjct  364  VSRGLVDLSMTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTED  423

Query  558  GAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            G KL P QIL+EVM+GT+RPSFS +CPPRI+RI  ACLS DPS RPTA EL++ LEG
Sbjct  424  GTKLKPVQILKEVMSGTMRPSFSDECPPRIRRIGTACLSLDPSSRPTAHELVRQLEG  480

>HYAP_14439
Length=414

 Score = 422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/406 (55%), Positives = 276/406 (68%), Gaps = 47/406 (12%)

Query  254  FSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDElllipillsss-----------CC  302
             +D    A++ P GS+WVT WL+++F V   SGFD  +++ I+L+             CC
Sbjct  2    ITDEVKMAMSVPSGSDWVTTWLENDFVV--PSGFDTSMVVAIILAVLTMLVILAFGWYCC  59

Query  303  DFDVV---------------SPNYLGVVAHEQARRGTVATT--SYGPSISSHQGDYESAG  345
                                +P Y      +   R T  +   ++  S+ S  GD+ESAG
Sbjct  60   RHRSSRSKKAASSVYKLAGDAPQYSDAWTSKTGNRSTDRSLRLTHQSSLFSSSGDFESAG  119

Query  346  SNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------  393
            SN+T KILL S+ L   RIPYE+L  Q  +SK ASGE WIC Y G+  A           
Sbjct  120  SNRTLKILLGSKCLQQKRIPYENLMLQEPISKGASGEVWICAYRGKTVAVKRLIRGSRNA  179

Query  394  -----FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSW  448
                 FAEEIEL+ASL+HP++V+FIGVAWNSL NL+MVLE+   G+LQ +LHKN+D+LSW
Sbjct  180  ETVRTFAEEIELSASLVHPNVVEFIGVAWNSLDNLAMVLEYFPRGNLQNYLHKNADLLSW  239

Query  449  AGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMT  508
            A D+I MAVA+A+AL+YLH RSPAIIHRDLK NNILLT++L PKLIDFGVSRG++D+TMT
Sbjct  240  ARDKIQMAVAIAQALQYLHGRSPAIIHRDLKCNNILLTDNLQPKLIDFGVSRGLVDITMT  299

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQ  568
            AGVGTPYW APE+LEG RY+E+ADIYSFGVVLSELDTG IPY + V   G +   FQILQ
Sbjct  300  AGVGTPYWAAPEILEGKRYTEQADIYSFGVVLSELDTGEIPYHNAVTESGGQATSFQILQ  359

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            +VMAG+LRPSFS DCPPRI+R+  ACLS DPSDRPT  +LIQ LEG
Sbjct  360  DVMAGSLRPSFSRDCPPRIRRVGLACLSLDPSDRPTTNQLIQGLEG  405

>PHYSO_253201
Length=540

 Score = 412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 219/542 (40%), Positives = 315/542 (58%), Gaps = 44/542 (8%)

Query  55   QLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDP  114
            +LY R ++GDT+   S   +P  +  RLD L++ +  LPG+ Q A+LWD+GF +SP  + 
Sbjct  19   KLYFRAKAGDTARPFSSLQLPLRLQQRLDDLQLVWGDLPGIDQRALLWDSGFALSPTNEV  78

Query  115  VQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDT  174
            +QIW  G ++M D+AV   +   V C  + C Q ++T + S+ +C+G Q++N +RC V+ 
Sbjct  79   IQIWPLGGWSMVDLAVPLVEFQAVGCVEINCTQTDNTTSLSNLFCNGEQMVNAARCAVED  138

Query  175  FEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQ  234
            F D    D    MW TGG+  + P   +  H W +  + +SY V A+HTV   D+  + +
Sbjct  139  FIDKS--DTRSAMWKTGGNPEVVPTSLIMRHIWKDGGSNISYDVAAIHTVGKDDEAAYGE  196

Query  235  CPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDEll  291
            C     N G+ S  +PC    + S+     + +  GS+WV+ WL + +    S       
Sbjct  197  CTTKEQNKGFGSRTLPCLSVGKMSEEAKTQMQEVEGSDWVSRWLVEAYGTQASDASSSN-  255

Query  292  lipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFK  351
                              N + +V       G+ AT     + S    + E+   N TF+
Sbjct  256  ----------------GGNTIILVLLIPIIAGSQATVDDTETASRRLAE-EALKRNSTFE  298

Query  352  ILLHSQ---HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA--------------  393
                S+   HL+  RIP+E++ F   +SK  +GE W+ +Y GR  A              
Sbjct  299  RDFSSESNEHLVEKRIPFENIRFDRAISKGVNGEVWVGEYSGRQVAIKRLLQARDNRAED  358

Query  394  ---FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG  450
               F+ EIEL+A+L+HP+ V FIGVAWN+L+NL MVLE+   GDL  +L KN D+L+WA 
Sbjct  359  VEEFSIEIELSANLVHPNNVTFIGVAWNTLNNLVMVLEYFPAGDLLAYLVKNEDLLTWAQ  418

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
            D++ +AV VA A+ YLHS+SP +IHRDLKS NI+LT  L+PKLIDFGVSRG  + +MTAG
Sbjct  419  DKLGIAVGVARAVRYLHSQSPPLIHRDLKSKNIMLTRKLEPKLIDFGVSRGRHEHSMTAG  478

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEV  570
            VGTPYW+APE+LE  RY+E+ DIYSFGVVLSELDTG++PY D +  DG K  PF IL +V
Sbjct  479  VGTPYWSAPEILEEKRYTEQTDIYSFGVVLSELDTGKLPYHDALTPDGKKPKPFHILSDV  538

Query  571  MA  572
            +A
Sbjct  539  IA  540

>PHYSO_337950
Length=575

 Score = 410 bits (1054),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 241/608 (40%), Positives = 329/608 (54%), Gaps = 105/608 (17%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G +SD+A QLY R ++G  +      +VP+AV  RL +L++ +  LPG+ Q A+LWD+GF
Sbjct  29   GISSDLALQLYFRAKAGAQADQFQSFTVPSAVQTRLGALQLEWGQLPGIAQRALLWDSGF  88

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             + P  + +Q+W     TMAD+AV   D   V C   +C QP+++ + S+ YC+G +++ 
Sbjct  89   AVPPTNEALQVWP---LTMADLAVLLADFHAVGCEEKKCSQPDNSTSSSNYYCTGAEMVA  145

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+VD F+DS   +    MW  GGD                                 
Sbjct  146  AARCVVDDFDDSSNPN--TAMWGIGGDPE-------------------------------  172

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
             D+P++N C     N G+ SL+ PC+     SDA ++   +  GS WV+ WL ++++V  
Sbjct  173  -DEPSYNTCATSDENGGFGSLVFPCYLARNASDAIISKRQQVNGSAWVSRWLVEDYSVSS  231

Query  284  SSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQG----  339
            + G D      +LL +  C   V +   L  V + + +  +   +   P+  + +     
Sbjct  232  AEGID-----MVLLIAIICGAVVFALVVLLAVVYRRRKCASQRDSGDQPTAPTLEDSDTV  286

Query  340  ----------------DYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEA  383
                            D+ S   N T K LL S+ L G  IPYES+ F+  +SK A GE 
Sbjct  287  PDRLVGKPNTVDPAYRDFTSEW-NLTLKTLLGSKSLTGKCIPYESVKFERAISKGAHGEV  345

Query  384  WICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSM  425
            W+ +Y G+  A                 FA+EIEL+ASL+H +IV FIGVAWNSLSNL M
Sbjct  346  WLGEYQGQQVAVKRLLQTKTLQADEVEEFAKEIELSASLVHHNIVTFIGVAWNSLSNLVM  405

Query  426  VLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILL  485
            VLE++  GDLQ FL  N   +SW  D I +AV +  ALEY HSRSP +IHRDLKS NILL
Sbjct  406  VLEYLPTGDLQRFLRDNHASMSWNKDLIRVAVGIGRALEYFHSRSPPLIHRDLKSRNILL  465

Query  486  TEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDT  545
            T  L+ KLIDFGVSR   +L+MTAGVGTPYWTAPE+LEG RY+EKADIYSF         
Sbjct  466  TASLEAKLIDFGVSRDCQELSMTAGVGTPYWTAPEILEGKRYTEKADIYSF---------  516

Query  546  GRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTA  605
                        G +  P QIL +VM G LRPSFS  CPPRI  IAA C   D   RPTA
Sbjct  517  ------------GQENKPIQILTDVMVGKLRPSFSDKCPPRILCIAAECCQLDAFKRPTA  564

Query  606  QELIQWLE  613
             E+++ L+
Sbjct  565  TEVVKMLQ  572

>PITG_17583
Length=550

 Score = 407 bits (1046),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 244/605 (40%), Positives = 340/605 (56%), Gaps = 104/605 (17%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G++SD++RQLY R ++ + S  V + SVP  V +RLD L++ ++ LPGL QLA+LWD+GF
Sbjct  12   GSSSDLSRQLYYRAKANE-SVLVRLNSVPDTVQNRLDDLRLDWSQLPGLAQLALLWDSGF  70

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             I+PN D VQ+WT GD TM+ +  + +  T                     +C+G Q+ N
Sbjct  71   AINPNYDAVQVWTLGDHTMSSLRTARNRTTR------------------PWHCNGAQMNN  112

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++CIV+ F   G+  +   MWS GG++   P +R+  H W +   G  Y + A+HTV+S
Sbjct  113  AAKCIVEDFASDGS--YHAAMWSIGGNSESAPTLRMIKHQWDD--QGAKYEIMALHTVTS  168

Query  227  ADDPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEF---A  280
             ++P W  CP   +N GY SL+ PC      +      +    GS+WV+ WL  ++   A
Sbjct  169  ENEPGWEACPTSTMNGGYGSLVFPCWTTDNITAENEKQMKNVTGSQWVSEWLVTDYKDAA  228

Query  281  VGDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQG-  339
              DSSGF++LLL+PI+L +      +    Y      ++AR    ATT+   + +++ G 
Sbjct  229  GTDSSGFNKLLLLPIILGALVIFALIGLMFYCKKKRQQKARSEYDATTTDLMATATYSGA  288

Query  340  ------------DYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQ  387
                        ++ S GSN T K+LL S++L+G RIP E LSF+  LSK ASGE W+C+
Sbjct  289  DQTIQFPAGYGAEFASGGSNTTLKVLLTSEYLIGKRIPPEHLSFENALSKGASGEVWVCE  348

Query  388  Y-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEF  429
            Y G+  A                 FA EIEL A L HP+I  FIGVAW SL NL+MV+E+
Sbjct  349  YAGQKVAAKRLLQTKENKAEDVHEFALEIELNAHLEHPNIGAFIGVAWGSLHNLTMVIEY  408

Query  430  VSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDL  489
               GDLQ +L +N+D+L+WA D+I++AV VA AL+                +N L +E  
Sbjct  409  FPLGDLQKYLKRNADLLTWARDKIHLAVGVARALD---------------QSNRLWSE--  451

Query  490  DPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIP  549
                         +D TMTAGVGT +WTAPE+LEG RYSE+ADIYSFGVVLSELDT +IP
Sbjct  452  -------------LDNTMTAGVGTLFWTAPEILEGKRYSEQADIYSFGVVLSELDTCKIP  498

Query  550  YFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
            + D    DG K  PF ILQEVMAGTLRP                C   DPS RP+  +L+
Sbjct  499  FHDCAGSDGKKPKPFHILQEVMAGTLRPIL--------------CCQHDPSRRPSGAQLV  544

Query  610  QWLEG  614
            + L+G
Sbjct  545  EMLQG  549

>PHYCA_533390
Length=483

 Score = 403 bits (1035),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 233/302 (77%), Gaps = 20/302 (7%)

Query  331  GPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG-  389
            G ++SS    YESAGSN+T KILL S+HL G RIPY+SL  +  +SK ASGE WICQY  
Sbjct  184  GSTLSSQH--YESAGSNKTLKILLDSKHLQGKRIPYDSLVLERAVSKGASGEVWICQYNG  241

Query  390  -----------------RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSE  432
                             +  AFA EIEL+ASL+HPHIV+FIGVAWNSL+NL+MVLEF   
Sbjct  242  QKVAAKRLLQTKEQTAEKVQAFAAEIELSASLVHPHIVEFIGVAWNSLNNLTMVLEFFPM  301

Query  433  GDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPK  492
            G+LQ +L KN+D+LSWA D+I+MA+ VA+ALEYLH R P +IHRDLKSNNILLT+ L+PK
Sbjct  302  GNLQDYLQKNADLLSWARDKIHMAIGVAQALEYLHGREPPLIHRDLKSNNILLTDKLEPK  361

Query  493  LIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD  552
            LIDFGVSR  +DLTMTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVL+ELDT  IPY D
Sbjct  362  LIDFGVSRDTVDLTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTCAIPYSD  421

Query  553  TVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
                +G K  PFQILQ+VM G LRP+FS DCPPRI++I  ACLS +P DRPTA+EL++ L
Sbjct  422  AATENGGKPKPFQILQDVMMGKLRPTFSQDCPPRIKKIGLACLSLNPMDRPTAKELVKEL  481

Query  613  EG  614
            +G
Sbjct  482  QG  483

 Score = 125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 119/246 (48%), Gaps = 67/246 (27%)

Query  18   QDYTITFRSLEEQDPEssslpsdfsfdfdGTNSDIARQLYTRHRSGDTSAAVSIKSVPTA  77
            Q  T+TFRSLEE    SS   S   + F+G++SDIA+QLY R+++GDT   V + +VP+A
Sbjct  19   QAQTVTFRSLEET--SSSLPSSSSDYVFNGSDSDIAKQLYIRYKAGDTDNQVQLTAVPSA  76

Query  78   VTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITN  137
            V++RLDS+ + F  LPGLVQ AVL                W TG       A++P     
Sbjct  77   VSNRLDSINVDFNSLPGLVQRAVL----------------WDTG------FAIAP-----  109

Query  138  VNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMT  197
                                              VD FEDSG   +LG MW+ GGD  + 
Sbjct  110  ----------------------------------VDVFEDSGDATYLGNMWANGGDPDVA  135

Query  198  PHIRLRDHTWTEPTT---GVS-YSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSE  253
            P I LRDH W+E      GV+ +SVY +HTV SA++  W QC    G  S +   H  S 
Sbjct  136  PQIELRDHAWSEDIEAFGGVTQFSVYVIHTVPSAEEAAWGQCLDGYGTGSTLSSQHYESA  195

Query  254  FSDAEM  259
             S+  +
Sbjct  196  GSNKTL  201

>PHYSO_337959
Length=642

 Score = 408 bits (1048),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 217/545 (40%), Positives = 311/545 (57%), Gaps = 55/545 (10%)

Query  55   QLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDP  114
            +LY R ++GDT+   S   +P  +  RLD L++ +  LPG+ Q A+LWD+GF +SP  + 
Sbjct  126  KLYFRAKAGDTARPFSSLQLPLRLQQRLDDLQLVWGDLPGIDQRALLWDSGFALSPTNEV  185

Query  115  VQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDT  174
            +QIW  G ++M D+AV   +   V C  + C Q ++T + S+ +C+G Q++N +RC V+ 
Sbjct  186  IQIWPLGGWSMVDLAVPLVEFQAVGCVEINCTQTDNTTSLSNLFCNGEQMVNAARCAVED  245

Query  175  FEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQ  234
            F D    D    MW TGG+  + P   +  H W +  + +SY V A+HTV   D+  + +
Sbjct  246  FIDKS--DTRSAMWKTGGNPEVVPTSLIMRHIWKDGGSNISYDVAAIHTVGKDDEAAYGE  303

Query  235  CPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDEll  291
            C     N G+ S  +PC    + S+     + +  GS+WV+ WL + +    S       
Sbjct  304  CTTKEQNKGFGSRTLPCLSVGKMSEEAKTQMQEVEGSDWVSRWLVEAYGTQAS-------  356

Query  292  lipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFK  351
                         D  S N    +           T   G   S  + D  +       +
Sbjct  357  -------------DASSSNGGNTIILVLLIPIIAGT---GGRSSQEELDLRTG---LQLR  397

Query  352  ILLHS------QHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------  393
            +  H+      +HL+  RIP+E++ F   +SK  +GE W+ +Y GR  A           
Sbjct  398  VQRHAKDAPVQEHLVEKRIPFENIRFDRAISKGVNGEVWVGEYSGRQVAIKRLLQARDNR  457

Query  394  ------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLS  447
                  F+ EIEL+ASL+HP+ V FIGVAWN+L+NL MVLE+   GDL  +L KN D+L+
Sbjct  458  AEDVEEFSIEIELSASLVHPNNVTFIGVAWNTLNNLVMVLEYFPAGDLLAYLVKNEDLLT  517

Query  448  WAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTM  507
            WA D++ +AV VA A+ YLHS+SP +IHRDLKS NI+LT  L+PKLIDFGVSRG  + +M
Sbjct  518  WAQDKLGIAVGVARAVRYLHSQSPPLIHRDLKSKNIMLTRKLEPKLIDFGVSRGRHEHSM  577

Query  508  TAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQIL  567
            TAGVGTPYW+APE+LE  RY+E+ DIYSFGVVLSELDTG++PY D +  DG K  PF IL
Sbjct  578  TAGVGTPYWSAPEILEEKRYTEQTDIYSFGVVLSELDTGKLPYHDALTPDGKKPKPFHIL  637

Query  568  QEVMA  572
             +V+A
Sbjct  638  SDVIA  642

>PHYRA_84557
Length=643

 Score = 381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/294 (63%), Positives = 222/294 (76%), Gaps = 18/294 (6%)

Query  339  GDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA----  393
            GDY S GSN T KILL S+HL+G RIP E+L+F+  LSK ASGE W+C+Y G+  A    
Sbjct  349  GDYVSGGSNTTLKILLTSEHLVGKRIPLENLTFEKALSKGASGEVWVCEYAGQKVAAKRL  408

Query  394  -------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH  440
                         FA+EIEL ASL HP++  FIGVAW+SL+NLSMV+E+   GDLQ +L 
Sbjct  409  LQTKEAKAEDVHEFAQEIELNASLDHPNVGAFIGVAWSSLNNLSMVIEYFPLGDLQRYLK  468

Query  441  KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR  500
            +N+D+LSWA D+I+MA+ VA ALEYLHSRSP IIHRDLKS NILLT  L+ K+IDFGVSR
Sbjct  469  RNADLLSWARDKIHMAIGVASALEYLHSRSPPIIHRDLKSKNILLTRQLEAKVIDFGVSR  528

Query  501  GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAK  560
            G +D TMTAGVGTP+WTAPE+LEG RYSE+ADIYSFGVVLSELDT +IP+ D +   G K
Sbjct  529  GRLDNTMTAGVGTPFWTAPEILEGKRYSEQADIYSFGVVLSELDTCKIPFHDCISSKGKK  588

Query  561  LMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
              PF IL+EVMAGTLRPSFS DCPPRI+R+  AC   DP+ RPTA  L+  L+G
Sbjct  589  AKPFHILKEVMAGTLRPSFSADCPPRIRRVGVACCQQDPARRPTAAVLVAMLQG  642

 Score = 184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 151/252 (60%), Gaps = 17/252 (7%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G++SD+ARQLY R ++ D    +++ ++P  +  RLD L++ +  LPG+ Q A+LWD+GF
Sbjct  12   GSSSDLARQLYYRAKAQDQVEQLALNAIPAGLQTRLDKLQLDWDKLPGIAQRALLWDSGF  71

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             +S +GD +QIWT GD TM+ +A++ D+     C    C +P+ T  + + +C+G Q+  
Sbjct  72   AVSADGDAIQIWTLGDHTMSTLALTADEYEAAGCVFGNCTEPDGTEIHINYHCNGAQMNR  131

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++C+   F+D  +  +   MW+ GG A+M P  R+  H W +   G  Y V AVHT+SS
Sbjct  132  AAKCLAQEFKDDVS--YNAAMWAIGGRASMVPKPRVAKHDWVD---GEHYVVMAVHTLSS  186

Query  227  -ADDPTWNQCPVNN----GYSSLIVPCHKRSEF-SDAEMAAVNKPRGSEWVTMWLKDEF-  279
              D+P ++ CP  +    GY S++ PC   + F SD E   V    GS+WV+ WL +++ 
Sbjct  187  DQDEPGYDSCPTTSSESAGYGSVVFPCQTTANFTSDLEKKTV---VGSDWVSNWLVEDYP  243

Query  280  --AVGDSSGFDE  289
              AV DS+GF++
Sbjct  244  DAAVEDSNGFNK  255

>PHYCA_543946
Length=314

 Score = 367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/293 (63%), Positives = 212/293 (72%), Gaps = 18/293 (6%)

Query  340  DYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----  393
            ++ES GSN T K+LL S+ L G RIP E L F   LSK ASGE WIC+Y G   A     
Sbjct  21   EFESVGSNTTLKVLLPSESLTGKRIPLEHLIFDKALSKGASGEVWICEYAGEKVAAKRLL  80

Query  394  ------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK  441
                        F  EIEL A L HP+I  FIGVAW SL+NL+MV+E+   GDLQ +L K
Sbjct  81   QTKENKAEDVHEFVLEIELNARLQHPNIGAFIGVAWGSLNNLAMVIEYFPLGDLQRYLKK  140

Query  442  NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG  501
            NSD+LSWA D+IYMA+ VA ALEYLH  SP IIHRDLKS NILLT  L+ K+IDFGVSRG
Sbjct  141  NSDLLSWARDKIYMALGVARALEYLHGYSPPIIHRDLKSKNILLTRQLEAKVIDFGVSRG  200

Query  502  VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKL  561
             +D TMTAGVGTPYWTAPEVLEG RYSE+ADIYSFGVVLSELDT +IP+ D +  +G K 
Sbjct  201  RLDNTMTAGVGTPYWTAPEVLEGKRYSEQADIYSFGVVLSELDTCKIPFHDCLSANGKKA  260

Query  562  MPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             PF ILQ VM+GTLRPSFS DCPPRI+RI  AC   DP+ RPTA +LIQ L+G
Sbjct  261  KPFHILQGVMSGTLRPSFSPDCPPRIRRIGVACCQHDPARRPTATQLIQLLQG  313

>PHYSO_519978
Length=644

 Score = 374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 228/631 (36%), Positives = 328/631 (52%), Gaps = 82/631 (13%)

Query  47   GTNSDIARQLYTRHR-SGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTG  105
            G NSD+ARQLY R + +GD +   S  S+P+AV  RL  L++ ++ L G+ Q A+LWD+G
Sbjct  31   GANSDLARQLYLRAKVAGDAATPFSNFSIPSAVEYRLKQLRLDWSRLLGIAQRALLWDSG  90

Query  106  FGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQIL  165
            F +SP  + VQIW   D ++ ++         V C    C QP+ TP+Y+SQ C+G QIL
Sbjct  91   FAVSPTNEAVQIWPLHDVSLVELRY-------VGCQEHACIQPDSTPSYTSQLCTGDQIL  143

Query  166  NVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVS  225
              +RC+V  F D+   D    +W T G +   P  R+R H WT      SY V+AVH + 
Sbjct  144  KAARCVVQDFSDTS--DAHTSIWVTRGKSDAIPTPRVRKHAWTSHFDNNSYGVFAVHMID  201

Query  226  SADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVG  282
               +P WN+C     N G+ SL++PC   +  S      + + +GS WV+ WL ++F   
Sbjct  202  QIYEPAWNECARADQNGGFGSLVLPCRTTANISLEIKTGMQQVQGSPWVSRWLAEDFGTT  261

Query  283  DSSGFDElllipillsssCC----------------------------------------  302
              +  D  L+ P  +++  C                                        
Sbjct  262  SGATNDSKLVSPAAVAAGICVLVGVVGLALFVNKKQYKKNDREAVVPTPKVHNGSSNAGP  321

Query  303  DFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAG-SNQTFKILLHSQHLLG  361
            + D  SP  L  V  E      V  +    +  + Q + E A  SN   + L +S  L+G
Sbjct  322  NNDTTSPEQLTDVPTEDTDTERVIESCPRVNTPARQMESECASDSNVVVETLFNSVSLIG  381

Query  362  NRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIELTAS  403
             RIPY+SL+F+  LS   + E W+  Y                    P  F +EIEL+AS
Sbjct  382  RRIPYDSLTFERSLSTRGAREVWLGTYRGQQVVIKKLLETDSPTSNDPDQFVKEIELSAS  441

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP+IV   GVAWN+ ++L MV+E+   G+LQ +L KN+  L  A D + +A+ +  A+
Sbjct  442  LTHPNIVSVFGVAWNNSNSLVMVVEYYPTGNLQAYLAKNTASL-LAKDVLRIAIGIGLAV  500

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLE  523
            EYLHSRSP ++HR ++S N+LLT+ L  KL+ FG+SR   +  + AG      T  EV+E
Sbjct  501  EYLHSRSPPLLHRGIRSRNVLLTKTLKAKLVGFGLSRSPQE-HLEAGA-----TKTEVVE  554

Query  524  GARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDC  583
            G RYSE+ADIYSFG VLS LD G     +     G K   FQI    M+  LRPSFS +C
Sbjct  555  GKRYSEQADIYSFGAVLSALDRGMA--INEAPTTGEK-NRFQIWANAMSRILRPSFSDEC  611

Query  584  PPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
              RI++I+AAC   DP  RPTA ++++ L+G
Sbjct  612  RQRIRQISAACCQIDPVQRPTAPQVVKMLKG  642

>PHYSO_337956
Length=563

 Score = 370 bits (950),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 190/329 (58%), Positives = 235/329 (71%), Gaps = 20/329 (6%)

Query  302  CDFD-VVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL  360
            CD D   SP Y GV       R     TS    + S  GDYE AGSN+T +ILL SQHL 
Sbjct  230  CDLDDGFSPPYCGVSQSIATTRHWTTPTS---PLWSLSGDYEGAGSNKTLRILLASQHLN  286

Query  361  GNRIPYESLSFQMELSKAASGEAWICQYGRPT---------------AFAEEIELTASLI  405
            G RIPY + +FQ  +SK  SGE W+C+Y +                 AFAEEIEL+ASLI
Sbjct  287  GKRIPYNNFAFQQAISKGGSGEVWVCEYNQRKVAAKRLQEQKAEKVHAFAEEIELSASLI  346

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HPHIV+FIGVAW+SLSNL M+LE+V  G L  FL+ N+++LSWA  +I +A+ +A+ALEY
Sbjct  347  HPHIVEFIGVAWSSLSNLVMILEYVPGGTLWSFLNTNAELLSWARCKIDIAIGIAQALEY  406

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGA  525
            LH R P +IHRDLKS+N+LLT+ L+PKLIDFGVSRG+ D+TMTAGVGTPYWTAPE+LEG 
Sbjct  407  LHDRPPPLIHRDLKSSNMLLTDKLEPKLIDFGVSRGIADITMTAGVGTPYWTAPEILEGK  466

Query  526  RYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPP  585
            RY+E+AD+YSFGVVLSELDTG  PY       G +L   QIL+ V+AGTLRP+FS +CP 
Sbjct  467  RYTEQADVYSFGVVLSELDTGIAPYSADEREGGGRLNHLQILKGVVAGTLRPTFSSECPL  526

Query  586  RIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            RIQR+  ACL+ +P +RPTAQ L++ LEG
Sbjct  527  RIQRV-EACLAHNPVNRPTAQHLLRELEG  554

 Score = 236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 136/186 (73%), Gaps = 4/186 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIA+QLY RH++GDT AA+ +  VP+AVT RL  L IAF  LPGLVQ AVLWD+GF
Sbjct  46   GTNSDIAQQLYIRHKAGDTGAALDLTFVPSAVTKRLSPLNIAFNDLPGLVQRAVLWDSGF  105

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             +SP+ DPVQIWT GD++M DIA+   D+ NV+CT L C QPN   AY ++ C+G QILN
Sbjct  106  AVSPDNDPVQIWTMGDYSMTDIAIPKADVANVDCTFLNCSQPNAETAYFTKTCTGYQILN  165

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWT----EPTTGVSYSVYAVH  222
             SRC+VD FED GA  FLG MWSTGG    TP +RLR+HTWT    E    +++SVY+VH
Sbjct  166  ASRCVVDLFEDPGAGSFLGTMWSTGGFPNRTPELRLREHTWTQDIDEFGGNITFSVYSVH  225

Query  223  TVSSAD  228
            TV + D
Sbjct  226  TVPTCD  231

>PHYSO_324311
Length=623

 Score = 370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 214/595 (36%), Positives = 320/595 (54%), Gaps = 38/595 (6%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+A+QLY R R+G ++  +S+  +P+AV  RL +L++ + +L G+ Q A+LWD+GF
Sbjct  31   GTNSDLAQQLYYRARAGGSAEKLSLTKLPSAVEGRLATLELDWDNLDGIAQRALLWDSGF  90

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G S  G+P+QI+T G  ++AD+A+   D     C    C Q + T +YS+  C G Q+L 
Sbjct  91   GFSLAGEPLQIFTDGTHSIADLAIPVSDFEGAGCVWNNCTQTDRTTSYSNLLCDGDQMLT  150

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+V+ F DS        MWSTGG     P   +  H+WT+ +T   ++V A+HTV +
Sbjct  151  ATRCLVEDFNDSSETH--TAMWSTGGSPESVPLPYIFKHSWTDASTNKPFNVLAIHTVPT  208

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
             D+  + QCP    N G+SSL++PC   +  SD   A +   +GS+WV+ WLK+ ++   
Sbjct  209  MDEVAYGQCPTGSENGGFSSLVIPCASTANLSDMPGAMMTTVKGSDWVSRWLKENYSTTA  268

Query  284  SSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYES  343
            +       +  ++           + N   + +   A             +         
Sbjct  269  TPAPAATSVTTVISED--------TNNGGAISSAAIAGIIAACIVVVLLILGVVIARRRH  320

Query  344  AGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA----------  393
             G+NQ    L     +  NRIP E +     +S+ A GE +   +               
Sbjct  321  TGANQGQTGLWDDDVITANRIPREKVRVNELVSRGAFGEVYTGVFNDQRVAIKMLLPSTR  380

Query  394  --------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKN  442
                    F  E +LTAS+ HP IV  IGVAW+SLS+L +V+EF+  GDL+  L    K 
Sbjct  381  RDIKLVNDFLAEAKLTASMDHPRIVTCIGVAWDSLSDLCVVMEFMEGGDLRTLLSNYEKT  440

Query  443  SDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV  502
               + +  +++ +A+ V  AL YLHS  P++IHRDLKS NILL +  + KL DFG+SR  
Sbjct  441  GHPVGFNREKVAIALHVCHALTYLHSLEPSVIHRDLKSRNILLNDANEAKLTDFGISRER  500

Query  503  MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDG  558
            +D TMTAGVGT  W APEV+ G RY EKAD++SFGVVLSELD+  +PY     +     G
Sbjct  501  LDRTMTAGVGTSLWMAPEVMTGERYDEKADMFSFGVVLSELDSHTLPYAQAKQEMQQSHG  560

Query  559  AKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             ++    +LQ+V  GT+   FS   P  +  +  AC+S DP+ RP+A E +  L+
Sbjct  561  RQMSDATLLQKVAMGTVSVEFSDAAPRSMVDLGCACVSVDPTLRPSAAEALFKLQ  615

>PHYRA_84554
Length=686

 Score = 363 bits (933),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 222/296 (75%), Gaps = 19/296 (6%)

Query  337  HQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA--  393
            +QG++ S+ SN T K LL S++L+  RIP++SL+F+  LSK A GE W+  Y G+  A  
Sbjct  391  YQGEF-SSESNATMKTLLSSEYLVDKRIPFDSLTFENALSKGAMGEVWLGMYQGQQVAVK  449

Query  394  ---------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGF  438
                           FA+EIEL+ASL+HP+IV F+GVAWN+L+NL MVLEF  EGDL  F
Sbjct  450  RLLQSNTHRAEEVEEFAKEIELSASLVHPNIVLFVGVAWNTLNNLVMVLEFFPEGDLLSF  509

Query  439  LHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGV  498
            L KN+D LSWA D+I++AV +  A+EYLHSR+P +IHRDLKSNN++LT +L+PKLIDFGV
Sbjct  510  LDKNADALSWAKDKIHIAVGIGRAMEYLHSRAPPLIHRDLKSNNVMLTNELEPKLIDFGV  569

Query  499  SRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG  558
            SRG  + TMTAGVGTPYWTAPE+LEG RY+E+ADIYSFGV+LSELDTG+ PY D +  DG
Sbjct  570  SRGTAESTMTAGVGTPYWTAPEILEGKRYTEQADIYSFGVILSELDTGKRPYHDALRSDG  629

Query  559  AKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             K  PFQI++ VMAG LRPS S DCPPRI+RI+ AC   D   RPTA +++Q LEG
Sbjct  630  TKPKPFQIMERVMAGVLRPSLSDDCPPRIRRISTACCQQDSRQRPTAAQVVQMLEG  685

 Score = 194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 141/239 (59%), Gaps = 7/239 (3%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++G ++   +   VP  V  RL+ L + +  LPG+ Q A+LWD+GF
Sbjct  31   GTNSDLARQLYLRDKAGGSAPQFTNFDVPDGVQKRLNDLNLEWDKLPGIAQRALLWDSGF  90

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GISP   PVQIWT    +MAD+AV      +V C  + C QP+ T + S+ YC+G Q+L 
Sbjct  91   GISPMNKPVQIWTLSGHSMADLAVPLAQFQDVGCVEMNCTQPDTTQSLSNLYCNGDQMLT  150

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVS--YSVYAVHTV  224
             +RC+   FED         MW TGG+  + P+   R H W + ++G    Y+V A+HTV
Sbjct  151  AARCVAQEFEDDAEIHL--AMWMTGGNPKVVPNPLFRKHQWVDGSSGTDQYYTVAAIHTV  208

Query  225  SSADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
            +  ++ T+  CP    N GY SL++PC+     +D  + ++ +  G+ WV+ WL ++++
Sbjct  209  NMDNEATYGVCPTDDQNGGYGSLVLPCYHLGNITDDVLESLEEVEGTPWVSRWLVEDYS  267

>PHYSO_563952
Length=667

 Score = 361 bits (927),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 219/296 (74%), Gaps = 20/296 (7%)

Query  339  GDYE--SAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY--------  388
            GD E  SAGSN T KILLHS+ L+G R+PY+S+ F+  LSK A+GE W+C++        
Sbjct  370  GDREDLSAGSNLTLKILLHSEFLVGKRVPYDSIFFKRALSKGANGEVWLCEFYEQQIAVK  429

Query  389  ----------GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGF  438
                           FA+EIEL A+L+HP+IV F+GVAWN+L+NL MVLEF   GDLQ +
Sbjct  430  RLLQNTTHLADEVEEFAKEIELNATLVHPNIVSFVGVAWNTLNNLLMVLEFFPLGDLQTY  489

Query  439  LHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGV  498
            L KN D++SWA D+I++AV VA ALEYLHSRSP +IHRDLKS NI+LT  L+ KLIDFGV
Sbjct  490  LAKNGDLMSWARDKIHIAVGVARALEYLHSRSPPLIHRDLKSKNIMLTRLLEAKLIDFGV  549

Query  499  SRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG  558
            SRG +D TMTAGVGTPYWTAPE+L+G+RY+E+ADIYSFGVVLSELDT ++PY D +  +G
Sbjct  550  SRGRLDNTMTAGVGTPYWTAPEILQGSRYTEQADIYSFGVVLSELDTTKLPYHDALTSNG  609

Query  559  AKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             K  P QIL +VMAG LRPSFS DCP RI+RI  AC   DP+ RP A ++ + LEG
Sbjct  610  KKPKPVQILADVMAGMLRPSFSEDCPRRIRRIGVACCQQDPARRPNAAQVGRMLEG  665

 Score = 204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 149/237 (63%), Gaps = 5/237 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQLY R ++G  ++     +VP+++  RLD L++ +  LPG+ Q A+LWD+G+
Sbjct  29   GTNSDIARQLYYRAKAGAAASPFEGFNVPSSLQTRLDELQLDWEKLPGIAQRALLWDSGY  88

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++P+ +PV+IWT G  +MAD+AV  D+   VNCT   CP+PN   + S+Q C+G  +L 
Sbjct  89   GLTPDDEPVKIWTLGGHSMADLAVPVDEFLGVNCTEHVCPEPNGGTSLSNQQCTGADMLK  148

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+V+ F  +   +    MW TGG+ T+ P  R+  H W +     SY V+A+H+V  
Sbjct  149  AARCVVEDFVQT--VEIHLAMWVTGGNPTVVPTPRIYKHAWNDSLDHNSYVVFAIHSVDL  206

Query  227  ADDPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
              +P WN C     N+GY SL+VPCH  +  S+    +  + +GS WV+ WL+++++
Sbjct  207  DAEPAWNACARADQNDGYGSLVVPCHNTANISNFIDDSKQEVQGSAWVSRWLREDYS  263

>PHYSO_483581
Length=667

 Score = 361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 219/296 (74%), Gaps = 20/296 (7%)

Query  339  GDYE--SAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY--------  388
            GD E  SAGSN T KILLHS+ L+G R+PY+S+ F+  LSK A+GE W+C++        
Sbjct  370  GDREDLSAGSNLTLKILLHSEFLVGKRVPYDSIFFKRALSKGANGEVWLCEFYEQQIAVK  429

Query  389  ----------GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGF  438
                           FA+EIEL A+L+HP+IV F+GVAWN+L+NL MVLEF   GDLQ +
Sbjct  430  RLLQNTTHLADEVEEFAKEIELNATLVHPNIVSFVGVAWNTLNNLFMVLEFFPLGDLQTY  489

Query  439  LHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGV  498
            L KN D++SWA D+I++AV VA ALEYLHSRSP +IHRDLKS NI+LT  L+ KLIDFGV
Sbjct  490  LAKNGDLMSWARDKIHIAVGVARALEYLHSRSPPLIHRDLKSKNIMLTRLLEAKLIDFGV  549

Query  499  SRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG  558
            SRG +D TMTAGVGTPYWTAPE+L+G+RY+E+ADIYSFGVVLSELDT ++PY D +  +G
Sbjct  550  SRGRLDNTMTAGVGTPYWTAPEILQGSRYTEQADIYSFGVVLSELDTTKLPYHDALTSNG  609

Query  559  AKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             K  P QIL +VMAG LRPSFS DCP RI+RI  AC   DP+ RP A ++ + LEG
Sbjct  610  KKPKPVQILADVMAGMLRPSFSEDCPRRIRRIGVACCQQDPARRPNAAQVGRMLEG  665

 Score = 204 bits (519),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 149/237 (63%), Gaps = 5/237 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSDIARQLY R ++G  ++     +VP+++  RLD L++ +  LPG+ Q A+LWD+G+
Sbjct  29   GTNSDIARQLYYRAKAGAAASPFEGFNVPSSLQTRLDELQLDWEKLPGIAQRALLWDSGY  88

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++P+ +PV+IWT G  +MAD+AV  D+   VNCT   CP+PN   + S+Q C+G  +L 
Sbjct  89   GLTPDDEPVKIWTLGGHSMADLAVPVDEFLGVNCTEHVCPEPNGGTSLSNQQCTGADMLK  148

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+V+ F  +   +    MW TGG+ T+ P  R+  H W +     SY V+A+H+V  
Sbjct  149  AARCVVEDFVQT--VEIHLAMWVTGGNPTVVPTPRIYKHAWNDSLDHNSYVVFAIHSVDL  206

Query  227  ADDPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
              +P WN C     N+GY SL+VPCH  +  S+    +  + +GS WV+ WL+++++
Sbjct  207  DAEPAWNACARADQNDGYGSLVVPCHNTANISNFIDDSKQEVQGSAWVSRWLREDYS  263

>PHYSO_520064
Length=669

 Score = 358 bits (918),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 221/307 (72%), Gaps = 18/307 (6%)

Query  326  ATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWI  385
            A T  G   +S  G+  S+ SN T K LL S++L+G RIPYE++ F+  LSK A GE W+
Sbjct  361  ANTWNGLRRTSTLGENLSSESNGTLKTLLGSEYLVGKRIPYEAIRFERALSKGAYGEVWV  420

Query  386  CQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVL  427
             +  G+  A                 FA+EIEL+ASL+HP+IV F+GVAWNSL+NL MVL
Sbjct  421  GELQGQQVAIKRLFQSKKNRAEDVEEFAKEIELSASLVHPNIVAFVGVAWNSLNNLVMVL  480

Query  428  EFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTE  487
            EF   GDLQG+L KN+D+L+WA D+I +A+ V  AL YLH+R P +IHRDLKS NILLT 
Sbjct  481  EFFPLGDLQGYLAKNADLLTWAKDKIDVAIGVGRALAYLHAREPPLIHRDLKSKNILLTR  540

Query  488  DLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGR  547
             L+PKLIDFGVSRG  + +MTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVLSELDT +
Sbjct  541  KLEPKLIDFGVSRGREEYSMTAGVGTPYWTAPEILEGRRYTEQADIYSFGVVLSELDTCK  600

Query  548  IPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQE  607
            +PY D +  DG K  PFQIL +VMAGTLRPSFS  CP RI+RI  AC   DP+ RPTA +
Sbjct  601  LPYHDALTQDGQKPKPFQILADVMAGTLRPSFSESCPRRIRRIGVACCQQDPARRPTAAQ  660

Query  608  LIQWLEG  614
            ++  LEG
Sbjct  661  VVVMLEG  667

 Score = 212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++GD++   +   VP  +  RL+ L I +  L G  QLA+LWDTGF
Sbjct  33   GTNSDLARQLYLRAKAGDSAKPFTNFQVPDKIQQRLNDLNIGWDGLSGNAQLALLWDTGF  92

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GI+ +  PVQ+WT G  +MAD+A+      +V CT + C QP++T +YS+ YC+G Q+LN
Sbjct  93   GITLDSKPVQMWTLGGHSMADLAIPLVQFQDVGCTEMNCTQPDNTTSYSNLYCNGEQMLN  152

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC++D F D       G MW TGG+    P  R+R H W E +T + Y+V AVHTV  
Sbjct  153  AARCVMDDFTDPVG--IHGAMWITGGNPKSIPVPRVRKHEWEEDSTKIPYTVLAVHTVDK  210

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
             D+P +  CP    N+GY SL++ C+   + SD   +A+ + +G+ WV+ WL ++++   
Sbjct  211  NDEPAYGVCPSKDENDGYGSLVLSCYSSLKVSDDVRSAMEEVQGTPWVSRWLVEDYSGAS  270

Query  284  SSGFD  288
            +S  D
Sbjct  271  TSSTD  275

>PHYSO_519624
Length=669

 Score = 358 bits (918),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 221/307 (72%), Gaps = 18/307 (6%)

Query  326  ATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWI  385
            A T  G   +S  G+  S+ SN T K LL S++L+G RIPYE++ F+  LSK A GE W+
Sbjct  361  ANTWNGLRRTSTLGENLSSESNGTLKTLLGSEYLVGKRIPYEAIRFERALSKGAYGEVWV  420

Query  386  CQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVL  427
             +  G+  A                 FA+EIEL+ASL+HP+IV F+GVAWNSL+NL MVL
Sbjct  421  GELQGQQVAIKRLFQSKKNRAEDVEEFAKEIELSASLVHPNIVAFVGVAWNSLNNLVMVL  480

Query  428  EFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTE  487
            EF   GDLQG+L KN+D+L+WA D+I +A+ V  AL YLH+R P +IHRDLKS NILLT 
Sbjct  481  EFFPLGDLQGYLAKNADLLTWAKDKIDVAIGVGRALAYLHAREPPLIHRDLKSKNILLTR  540

Query  488  DLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGR  547
             L+PKLIDFGVSRG  + +MTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVLSELDT +
Sbjct  541  KLEPKLIDFGVSRGREEYSMTAGVGTPYWTAPEILEGRRYTEQADIYSFGVVLSELDTCK  600

Query  548  IPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQE  607
            +PY D +  DG K  PFQIL +VMAGTLRPSFS  CP RI+RI  AC   DP+ RPTA +
Sbjct  601  LPYHDALTQDGQKPKPFQILADVMAGTLRPSFSESCPRRIRRIGVACCQQDPARRPTAAQ  660

Query  608  LIQWLEG  614
            ++  LEG
Sbjct  661  VVVMLEG  667

 Score = 212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++GD++   +   VP  +  RL+ L I +  L G  QLA+LWDTGF
Sbjct  33   GTNSDLARQLYLRAKAGDSAKPFTNFQVPDKIQQRLNDLNIGWDGLSGNAQLALLWDTGF  92

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GI+ +  PVQ+WT G  +MAD+A+      +V CT + C QP++T +YS+ YC+G Q+LN
Sbjct  93   GITLDSKPVQMWTLGGHSMADLAIPLVQFQDVGCTEMNCTQPDNTTSYSNLYCNGEQMLN  152

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC++D F D       G MW TGG+    P  R+R H W E +T + Y+V AVHTV  
Sbjct  153  AARCVMDDFTDPVG--IHGAMWITGGNPKSIPVPRVRKHEWEEDSTKIPYTVLAVHTVDK  210

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
             D+P +  CP    N+GY SL++ C+   + SD   +A+ + +G+ WV+ WL ++++   
Sbjct  211  NDEPAYGVCPSKDENDGYGSLVLSCYSSLKVSDDVRSAMEEVQGTPWVSRWLVEDYSGAS  270

Query  284  SSGFD  288
            +S  D
Sbjct  271  TSSTD  275

>PHYSO_485044
Length=669

 Score = 358 bits (918),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 221/307 (72%), Gaps = 18/307 (6%)

Query  326  ATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWI  385
            A T  G   +S  G+  S+ SN T K LL S++L+G RIPYE++ F+  LSK A GE W+
Sbjct  361  ANTWNGLRRTSTLGENLSSESNGTLKTLLGSEYLVGKRIPYEAIRFERALSKGAYGEVWV  420

Query  386  CQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVL  427
             +  G+  A                 FA+EIEL+ASL+HP+IV F+GVAWNSL+NL MVL
Sbjct  421  GELQGQQVAIKRLFQSKKNRAEDVEEFAKEIELSASLVHPNIVAFVGVAWNSLNNLVMVL  480

Query  428  EFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTE  487
            EF   GDLQG+L KN+D+L+WA D+I +A+ V  AL YLH+R P +IHRDLKS NILLT 
Sbjct  481  EFFPLGDLQGYLAKNADLLTWAKDKIDVAIGVGRALAYLHAREPPLIHRDLKSKNILLTR  540

Query  488  DLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGR  547
             L+PKLIDFGVSRG  + +MTAGVGTPYWTAPE+LEG RY+E+ADIYSFGVVLSELDT +
Sbjct  541  KLEPKLIDFGVSRGREEYSMTAGVGTPYWTAPEILEGRRYTEQADIYSFGVVLSELDTCK  600

Query  548  IPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQE  607
            +PY D +  DG K  PFQIL +VMAGTLRPSFS  CP RI+RI  AC   DP+ RPTA +
Sbjct  601  LPYHDALTQDGQKPKPFQILADVMAGTLRPSFSESCPRRIRRIGVACCQQDPARRPTAAQ  660

Query  608  LIQWLEG  614
            ++  LEG
Sbjct  661  VVVMLEG  667

 Score = 212 bits (540),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 152/245 (62%), Gaps = 5/245 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++GD++   +   VP  +  RL+ L I +  L G  QLA+LWDTGF
Sbjct  33   GTNSDLARQLYLRAKAGDSAKPFTNFQVPDKIQQRLNDLNIGWDGLSGNAQLALLWDTGF  92

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GI+ +  PVQ+WT G  +MAD+A+      +V CT + C QP++T +YS+ YC+G Q+LN
Sbjct  93   GITLDSKPVQMWTLGGHSMADLAIPLVQFQDVGCTEMNCTQPDNTTSYSNLYCNGEQMLN  152

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC++D F D       G MW TGG+    P  R+R H W E +T + Y+V AVHTV  
Sbjct  153  AARCVMDDFTDPVG--IHGAMWITGGNPKSIPVPRVRKHEWEEDSTKIPYTVLAVHTVDK  210

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
             D+P +  CP    N+GY SL++ C+   + SD   +A+ + +G+ WV+ WL ++++   
Sbjct  211  NDEPAYGVCPSKDENDGYGSLVLSCYSSLKVSDDVRSAMEEVQGTPWVSRWLVEDYSGAS  270

Query  284  SSGFD  288
            +S  D
Sbjct  271  TSSTD  275

>PPTG_09878
Length=612

 Score = 355 bits (912),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 211/597 (35%), Positives = 313/597 (52%), Gaps = 59/597 (10%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R  +GD++  +++ ++P+ + DRLD L + +  L G+ Q AVLWDTGF
Sbjct  37   GTNSDLARQLYYRSLAGDSADQLNLSTIPSKIQDRLDDLDVNWADLDGIAQRAVLWDTGF  96

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GIS + +PVQI+T G  ++A++AV         CT   C QP+ + +YS+  C+  Q+L+
Sbjct  97   GISSSDEPVQIFTDGSHSIANLAVPISHFAGAGCTWTNCSQPDGSISYSNLACNAEQMLS  156

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC  + FED      L   WSTGG   M P  R+   +WT+P    +Y+V+A+HT++ 
Sbjct  157  KARCFAEDFEDDTW--VLSPTWSTGGWPPMIPTPRVYMDSWTDPADNTTYTVFAIHTLAF  214

Query  227  ADDPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGD  283
              +P +++CP    N GY SL+VPC   +  S +  + +    GS WV+ W+ +E++   
Sbjct  215  DQEPFYSECPNTTRNGGYGSLVVPCAPTARVSASSSSEITPVEGSPWVSRWIAEEYSTKT  274

Query  284  SSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYES  343
            +          + + + C    +V   ++    H   +                      
Sbjct  275  TPLL--STSATVGIITGCIVVVLVILGFIIACKHRSKK----------------------  310

Query  344  AGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG-RPTA---------  393
               N+    L     +   RIP   +     LS+ A GE +   +  R  A         
Sbjct  311  ---NKGQTGLWDDDIITAKRIPRNRVQVNQLLSRGAFGEVYAGAFNDRQVAVKMLLPSTR  367

Query  394  --------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-----  440
                    F  E  LTA + HP IV  +GVAW++LS+L +VLEF+  GDL+  L+     
Sbjct  368  RDIRLVNEFLAEARLTACMEHPRIVTLVGVAWDTLSDLCIVLEFMEGGDLRSLLNNYEKA  427

Query  441  KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR  500
            K    + ++ +++ +A+ V  AL YLHS  P +IHRDLKS NILL E  + KL DFG+SR
Sbjct  428  KRKYPVGFSREKVTIALHVCHALTYLHSLEPPVIHRDLKSRNILLDEMHEAKLTDFGISR  487

Query  501  GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDH  556
              +D TMTAGVGT  W APEV+ G +Y +KADI+SFGVVLSELD   +PY     +    
Sbjct  488  ERLDRTMTAGVGTSLWMAPEVMMGEKYDDKADIFSFGVVLSELDFHTLPYAQIKREMERS  547

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             G ++    +LQ V  G     FS   P  +  +  AC+S DPS RP A E +  L+
Sbjct  548  HGRQMSDATLLQRVAMGATSVEFSDVGPQSMVDLGRACVSVDPSKRPCAAEALFKLQ  604

>PITG_17577
Length=510

 Score = 349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 217/313 (69%), Gaps = 20/313 (6%)

Query  320  ARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAA  379
            + +G   T  +  S SS   D+ S G N T +ILL+S+ L+G RIPY+SLSF+  LSK A
Sbjct  198  SHKGVDKTIKFKSSTSS-ASDFGS-GPNSTLQILLNSEGLIGKRIPYDSLSFKKSLSKGA  255

Query  380  SGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLS  421
             GE W+ +Y G+  A                 FA EIEL+ASL+HP+IV FIGVAWNSLS
Sbjct  256  CGEVWLGEYEGQQVAIKRLLQIKSHRADEVEEFAREIELSASLVHPNIVSFIGVAWNSLS  315

Query  422  NLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSN  481
            NL M LEF   GDLQ +L KN D+LSW  D+I +AV V  ALEYLH RSP +IHRDLKS 
Sbjct  316  NLVMALEFFPMGDLQEYLAKNGDLLSWPRDKIQIAVGVGRALEYLHCRSPPLIHRDLKSK  375

Query  482  NILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLS  541
            NILLT  L+ KLIDFGVSR   + +MTAGVGTPYWTAPEVLEG RY+E+ADIYSFGVVL+
Sbjct  376  NILLTSRLEAKLIDFGVSRDRQEYSMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLT  435

Query  542  ELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSD  601
            ELDT ++PY D +  +G K  PFQIL +VMAG LRPSFS +CP RI+RI  AC   DP  
Sbjct  436  ELDTSKVPYHDALTAEGKKPKPFQILTDVMAGMLRPSFSENCPLRIRRIGVACCQHDPIR  495

Query  602  RPTAQELIQWLEG  614
            RPTA ++   L+ 
Sbjct  496  RPTAAQVADMLQA  508

 Score = 100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 77/133 (58%), Gaps = 4/133 (3%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G+NSD+ARQLY R ++G +    S   +P A+  RL+ + + +  LPG+ Q A+LWD+GF
Sbjct  29   GSNSDLARQLYLRAKAGGSEQKYSGLVLPGAIQRRLEDVDLEWDDLPGIGQRALLWDSGF  88

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDT-PAYSSQYCSGTQIL  165
            G++ +   VQIWT G  +M+D+AV  D    V C    C QP  T  + S+ YCS  +  
Sbjct  89   GVTVDNRVVQIWTLGGHSMSDLAVPLDQFRAVECEETNCTQPGTTIVSRSNLYCSAKRQR  148

Query  166  NVSRCIVDTFEDS  178
            N+     D  EDS
Sbjct  149  NIEG---DALEDS  158

>PITG_17578
Length=481

 Score = 347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 216/296 (73%), Gaps = 19/296 (6%)

Query  335  SSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY------  388
            S +  DY S+GSN T KILL S+HL+G RIP++SLSF   LSK A GE WI +Y      
Sbjct  180  SGYSVDY-SSGSNLTMKILLDSEHLIGMRIPFDSLSFTRALSKGAYGEVWIGEYDGQQVA  238

Query  389  ------GRP------TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQ  436
                  GR        AFA+EIELTA L HP+IV F+GVAWN+L+NL M LEF+  GDL 
Sbjct  239  IKKLFSGRDHKAEEVEAFAKEIELTARLAHPNIVSFVGVAWNTLTNLIMALEFLPSGDLH  298

Query  437  GFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDF  496
            G+L K++DVLSW+ D++ +A+ VA ALE+LHS+ P +IHRDLKS NILLT  L+PKLIDF
Sbjct  299  GYLTKHADVLSWSKDKMGIAIGVARALEFLHSQVPPLIHRDLKSKNILLTRQLEPKLIDF  358

Query  497  GVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDH  556
            GVSRG  D +MTAGVGTPYWTAPE+LEG RY+E+ADIYS GVVL+E+DTG++PY D +  
Sbjct  359  GVSRGCEDFSMTAGVGTPYWTAPEILEGKRYTEQADIYSLGVVLTEIDTGKLPYHDALTP  418

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            +G    PF IL +V+AG LRPSF+ +CPP+I++I  AC   +P  RPTA E++  L
Sbjct  419  EGTIPKPFMILADVIAGILRPSFAEECPPKIRQIGVACCQHNPDSRPTATEVVTLL  474

 Score = 129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 0/122 (0%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GT+SDIARQLY R ++GD  +      VP+AV  RL+ L++A+  LPG+ Q A+LWD+GF
Sbjct  28   GTHSDIARQLYFRAKAGDAVSPYGNFKVPSAVQGRLEELRLAWDKLPGIAQRALLWDSGF  87

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G+SP  +PV++WT     MA++AV       VNCT   C QP+DTP+YS+Q C+G  IL 
Sbjct  88   GVSPTNEPVKLWTLNGHNMANLAVPLAQYQAVNCTERTCTQPDDTPSYSNQQCTGVDILK  147

Query  167  VS  168
             +
Sbjct  148  AA  149

>CCI41501
Length=680

 Score = 352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 227/635 (36%), Positives = 332/635 (52%), Gaps = 85/635 (13%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSI--KSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDT  104
            G  SD+A+Q Y R+ SG     +S   +S+P  +  RL S+ ++F +L G +Q AV+WD+
Sbjct  63   GATSDLAQQYYRRYASGSIIEPLSFTSESLPERIRTRLTSIGLSFENLNGYLQRAVIWDS  122

Query  105  GFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPA------YSSQY  158
            G+ +  +G   +I+T    +M  IA+   +  NVNCT + C   N  PA      Y S  
Sbjct  123  GYALG-SGALRKIYTRNGSSMDTIAIPAKNYRNVNCTTISCTVHN-VPASLVKTTYRSDL  180

Query  159  CSGTQILNVSRCIV-DTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYS  217
            C G  IL VS+C   D F  SG       +W+TGG     P   +  H W +P+T  SY 
Sbjct  181  CRGDDILKVSQCATEDVFGISGH----SALWATGGTEDFDPEPYIIRHAWFDPSTSKSYL  236

Query  218  VYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAA---VNKPRGSEWVTMW  274
            V  +HT   +++  + +CP      S+I+PC + +    +E+A+   +  P   +  T+W
Sbjct  237  VNGIHTTPESNEAAFGKCPATGQSGSIIIPCAQYT----SELASNWSLASPAFGQLTTLW  292

Query  275  LKDEFAVGDSSGFDElllipillsssCCDF--------------------------DVVS  308
            L+   A   +   D      ++++  C                             D+ S
Sbjct  293  LE---ATKSAKKKDLGTAYVVVITIICILLVGIIVFFIVQYRKRRLEFSITMKEPEDIAS  349

Query  309  PNYL-------GVVAHEQARRGTVATTSYGPS--ISSHQGDYESAGSNQTFKILLHSQHL  359
            P +        G +   Q+ +   + +       + S + D  S+  + T      +  +
Sbjct  350  PTWAIDVLTPRGNMTMLQSSKSPFSESELTSRTFMDSGKSDIPSSIRSNTMCTSFFNHPI  409

Query  360  LGNR-IPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            L +R I  E ++F   +SK A GE W CQY  R  A                 F  EI+L
Sbjct  410  LESRYISMEKIAFDQLISKGAYGEIWHCQYQNRSVAVKRLLQNKSHTLHEAQEFIAEIQL  469

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVA  460
            TASL HP+IV FIGVA+ +L  L MVLEF ++GD+Q +L  N  VL W   ++ MA+ VA
Sbjct  470  TASLQHPNIVTFIGVAYTTLEKLCMVLEFCAKGDVQTYLQTNETVL-WTRQKLEMAMGVA  528

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPE  520
            +ALEYLHS SP I+HRD+K+ N+LL++ +  K+IDFG+S+  M   MTAG+GTPYWTAPE
Sbjct  529  KALEYLHSFSPPILHRDIKAKNVLLSDQMQVKVIDFGISKH-MHNAMTAGIGTPYWTAPE  587

Query  521  VLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA-KLMPFQILQEVMAGTLRPSF  579
             L G  YSEK+D+YSFGV LSE+DT  +PY   VDH    +L P QIL  VM GTL+P+F
Sbjct  588  NLHGLEYSEKSDMYSFGVFLSEVDTCEMPY---VDHKSELELGPVQILNRVMNGTLQPTF  644

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            S   P RI+ IA  CL  D   RP+A+ +++ L+G
Sbjct  645  SAHIPRRIRDIAILCLHIDAGMRPSAKRVVEMLQG  679

>PHYSO_337967
Length=677

 Score = 351 bits (900),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/288 (59%), Positives = 210/288 (73%), Gaps = 18/288 (6%)

Query  344  AGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY---------------  388
            +GSNQT +ILL S+ L+  R+P+ESL F+  LSK A GE W+ +Y               
Sbjct  385  SGSNQTLQILLGSEFLVAKRLPFESLVFKRALSKGACGEVWLGEYQCQQLAIKRLLQAKA  444

Query  389  ---GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV  445
                    FA+EIEL+ASL+HP+IV FIGVAWNSL+NL M LEF   GDLQ +L K++D+
Sbjct  445  HQADEVEEFAQEIELSASLMHPNIVSFIGVAWNSLNNLVMALEFFPMGDLQAYLEKHADL  504

Query  446  LSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDL  505
            ++WA D+I++AV VA ALEYLHSR+P +IHRDLKS NILLT+ L+ KLIDFGVSR   + 
Sbjct  505  MTWAKDKIHIAVGVARALEYLHSRTPPLIHRDLKSKNILLTQKLEAKLIDFGVSRNRQEH  564

Query  506  TMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQ  565
            +MTAGVGTPYWTAPE+LEG RY E+ DIYSFGVVLSELDTG+IPY D +  +G K  PFQ
Sbjct  565  SMTAGVGTPYWTAPEILEGKRYMEQVDIYSFGVVLSELDTGKIPYHDALTSEGKKPKPFQ  624

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            IL +VMAG LRPSFS  CP RI+RI  AC   DP+ RPTA ++ + L+
Sbjct  625  ILSDVMAGMLRPSFSEQCPTRIRRIGVACCQHDPARRPTAAQVAKMLQ  672

 Score = 196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 143/239 (60%), Gaps = 5/239 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+A QLY R ++G  +  +   SVP AV +RLDSL + +  L G+ Q A+LWD+GF
Sbjct  30   GTNSDLATQLYLRAKAGGLTTKLPTISVPDAVQERLDSLGVEWDDLSGMAQRALLWDSGF  89

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            G++ +   V+IW     +M D+AV       V C    C QP+DT + S+ YC+G Q+L+
Sbjct  90   GVTLDNKAVRIWPLAGHSMTDLAVPLVQFEAVGCVATNCSQPDDTLSLSNLYCNGEQMLH  149

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
              RC+++ F ++      G MW TGG+  + P  R R H W + +T VSY+V A+HTV  
Sbjct  150  AVRCVMEDFTET--VQIHGAMWMTGGNPEVMPTPRARKHQWKDDSTNVSYTVLAIHTVDQ  207

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVG  282
             D+  +N CP    N GY SL++ CH R+  +D   +A+ + + + WV+ WL ++F+ G
Sbjct  208  EDEAAYNVCPTSKQNGGYGSLVLSCHSRTNITDEVKSAMLEAQPTPWVSRWLVEDFSNG  266

>PHYRA_84552
Length=704

 Score = 351 bits (900),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/286 (60%), Positives = 211/286 (74%), Gaps = 18/286 (6%)

Query  347  NQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA------------  393
            N T KILL S+ L G R+PYESLS++  LSK A GE W+ +Y G+  A            
Sbjct  417  NFTLKILLDSESLRGRRLPYESLSWKKSLSKGACGEVWLGEYQGQQVAIKRLLQIKTARA  476

Query  394  -----FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSW  448
                 FA+EIEL+ASL+HP+IV F+GVAWNSL+NL M LEF   GDLQ +L KN+D++SW
Sbjct  477  DDVEAFAQEIELSASLVHPNIVAFLGVAWNSLNNLVMALEFFPMGDLQAYLMKNADLMSW  536

Query  449  AGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMT  508
            + D+I++A  V  ALEYLHSRSP +IHRDLKS NILLT  L+ KLIDFGVSR   + +MT
Sbjct  537  SKDKIHIAAGVGRALEYLHSRSPPLIHRDLKSKNILLTRMLEAKLIDFGVSRDRQEHSMT  596

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQ  568
            AGVGTPYWTAPE+LEG RY+E+AD+YSFGVVLSELDTG+IPY D +  +G K  PFQIL 
Sbjct  597  AGVGTPYWTAPEILEGKRYTEQADMYSFGVVLSELDTGKIPYHDALTSNGKKPKPFQILT  656

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            +VMAG LRPSFS DCP RI+RI  AC   DP  RPTA ++++ LEG
Sbjct  657  DVMAGMLRPSFSEDCPSRIRRIGVACCQNDPIKRPTAAQVVRMLEG  702

 Score = 196 bits (499),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/239 (39%), Positives = 141/239 (59%), Gaps = 7/239 (3%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R ++G ++   +   VP  V  RL+ L + +  LPG+ Q A+LWD+GF
Sbjct  61   GTNSDLARQLYLRDKAGGSAPQFTNFDVPDGVQKRLNDLNLEWDKLPGIAQRALLWDSGF  120

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GISP   PVQIWT    +MAD+AV      +V C  + C QP+ T + S+ YC+G Q+L 
Sbjct  121  GISPMNKPVQIWTLSGHSMADLAVPLAQFQDVGCVEMNCTQPDTTQSLSNLYCNGDQMLT  180

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVS--YSVYAVHTV  224
             +RC+   FED         MW TGG+  + P+   R H W + ++G    Y+V A+HTV
Sbjct  181  AARCVAQEFEDDAEIHL--AMWMTGGNPKVVPNPLFRKHQWVDGSSGTDQYYTVAAIHTV  238

Query  225  SSADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
            +  ++ T+  CP    N GY SL++PC+     +D  + ++ +  G+ WV+ WLK+++ 
Sbjct  239  NMDNEATYGVCPTDDQNGGYGSLVLPCYHFGNITDDVLESLEEVEGTPWVSRWLKEDYG  297

>PITG_20766
Length=704

 Score = 348 bits (894),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 217/313 (69%), Gaps = 20/313 (6%)

Query  320  ARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAA  379
            + +G   T  +  S SS   D+ S G N T +ILL+S+ L+G RIPY+SLSF+  LSK A
Sbjct  392  SHKGVDKTIKFKSSTSS-ASDFGS-GPNSTLQILLNSEGLIGKRIPYDSLSFKKSLSKGA  449

Query  380  SGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLS  421
             GE W+ +Y G+  A                 FA EIEL+ASL+HP+IV FIGVAWNSLS
Sbjct  450  CGEVWLGEYEGQQVAIKRLLQIKSHRADEVEEFAREIELSASLVHPNIVSFIGVAWNSLS  509

Query  422  NLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSN  481
            NL M LEF   GDLQ +L KN D+LSW  D+I +AV V  ALEYLH RSP +IHRDLKS 
Sbjct  510  NLVMALEFFPMGDLQEYLAKNGDLLSWPRDKIQIAVGVGRALEYLHCRSPPLIHRDLKSK  569

Query  482  NILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLS  541
            NILLT  L+ KLIDFGVSR   + +MTAGVGTPYWTAPEVLEG RY+E+ADIYSFGVVL+
Sbjct  570  NILLTSRLEAKLIDFGVSRDRQEYSMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLT  629

Query  542  ELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSD  601
            ELDT ++PY D +  +G K  PFQIL +VMAG LRPSFS +CP RI+RI  AC   DP  
Sbjct  630  ELDTSKVPYHDALTAEGKKPKPFQILTDVMAGMLRPSFSENCPSRIRRIGVACCQHDPIR  689

Query  602  RPTAQELIQWLEG  614
            RPTA ++   L+ 
Sbjct  690  RPTAAQVADMLQA  702

 Score = 196 bits (498),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 147/238 (62%), Gaps = 7/238 (3%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G+NSD+ARQLY R ++G +    S   +P A+  RL+ + + +  LPG+ Q A+LWD+GF
Sbjct  60   GSNSDLARQLYLRAKAGGSEQKYSGLVLPGAIQRRLEDVDLEWDDLPGIAQRALLWDSGF  119

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDT-PAYSSQYCSGTQIL  165
            G++ +   VQIWT G  +M+D+AV  D    V C    C QP  T  + S+ YCSGTQ+L
Sbjct  120  GVTVDNRVVQIWTLGGHSMSDLAVPLDQFRAVECEETNCTQPGTTIVSRSNLYCSGTQML  179

Query  166  NVSRCIVDTFEDSGAKDFLGI-MWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTV  224
              +RC+V+ F++S   D L + MW TGG+ T+ P  ++R H+W +  + +SY V AVHTV
Sbjct  180  TAARCVVEDFDES---DRLHLAMWMTGGNPTVIPTPQVRKHSWKDDFSNISYVVMAVHTV  236

Query  225  SSADDPTWNQCPV--NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
               D+  + +CP   N GY SL++PCH     +D    A+ + +GS WVT W ++E++
Sbjct  237  VGDDEAAYGECPKEQNGGYGSLVLPCHTTKYLTDDVRDAMEEVQGSPWVTKWFREEYS  294

>PPTG_16200
Length=745

 Score = 349 bits (895),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 219/312 (70%), Gaps = 20/312 (6%)

Query  320  ARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAA  379
            + +G   T  +  S SS   D++S GSN T +ILL S+ L G R+PY+SLSF   LSK A
Sbjct  433  SHKGVDKTIKFKSSTSS-ASDFDS-GSNSTLQILLKSEFLRGKRLPYDSLSFTKPLSKGA  490

Query  380  SGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLS  421
             GE W+ +Y G+  A                 FA EIEL+A L+HP+IV FIGVAWNSL+
Sbjct  491  CGEVWLGEYEGQQVAIKRLLQVKAHRADEVEEFAREIELSACLVHPNIVSFIGVAWNSLN  550

Query  422  NLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSN  481
            NL M LEF   GDLQ +L KN D++SW  D+I++AV V  AL+YLHSRSP +IHRDLKS 
Sbjct  551  NLVMALEFFPMGDLQAYLAKNGDLMSWPRDKIHIAVDVGCALKYLHSRSPPLIHRDLKSK  610

Query  482  NILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLS  541
            NILLT  L+ KLIDFGVSR   + +MTAGVGTPYWTAPEVLEG RY+E+ADIYSFGVVL+
Sbjct  611  NILLTSRLEAKLIDFGVSRDRQEYSMTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLT  670

Query  542  ELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSD  601
            ELDTG++PY D +  +G K  PFQIL +VMAG LRPSFS DCP RI+RI  AC   DPS 
Sbjct  671  ELDTGKVPYHDALTAEGNKPKPFQILTDVMAGMLRPSFSKDCPSRIRRIGVACCQQDPSR  730

Query  602  RPTAQELIQWLE  613
            RPTA ++   L+
Sbjct  731  RPTAVQVAHMLQ  742

 Score = 188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 139/237 (59%), Gaps = 5/237 (2%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+ARQLY R + G + A  +  ++P A+  RLD   + +  L G+ Q A+LWD+GF
Sbjct  102  GTNSDLARQLYFRAKDGGSVAKYTNLALPKAIQTRLDDNYLTWDDLSGIAQRALLWDSGF  161

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDT-PAYSSQYCSGTQIL  165
            G++ +   VQIWT G  +M D+AV  D    V C  + C QP     +YS+ +CSG Q+L
Sbjct  162  GVTLDNKVVQIWTLGGHSMTDLAVPLDQFNAVGCKEMNCTQPGTVIKSYSNFHCSGEQML  221

Query  166  NVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVS  225
              +RC+V  FE+S +      MW TGG+  + P  ++R H+W +  + VSY V AVHTV 
Sbjct  222  KAARCVVQDFEESESLHL--AMWMTGGNPKVIPTPQIRKHSWKDDYSNVSYVVVAVHTVL  279

Query  226  SADDPTWNQCPV--NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
              D+  + +CP   N GY SL++PC+     ++    A+    GS WVT WL+ E++
Sbjct  280  GNDEAAYGECPKTGNGGYGSLVLPCYTTVNITEEVRDAMVTVEGSPWVTKWLRQEYS  336

>PPTG_01981
Length=367

 Score = 325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 225/342 (66%), Gaps = 66/342 (19%)

Query  270  WVTMWLKDEFAVGDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQA---RRGTVA  326
            WVT WLKDEFAV    GF+ELLLIP++L        VV+   +G    +++   +R   +
Sbjct  56   WVTTWLKDEFAV---EGFEELLLIPVILV-------VVAAMGIGWFCWKRSSLLKREQAS  105

Query  327  TTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWIC  386
            +  +   +   Q  + S  +N+ F      QHL GNRIPY+SL FQ ELSK A GE WIC
Sbjct  106  SCDFDVVL---QITWMSLLTNKLFD---GRQHLHGNRIPYDSLVFQTELSKGAPGEVWIC  159

Query  387  QYGRPTA------------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLE  428
            +YG                      FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLE
Sbjct  160  RYGGQEVAVKKLLHIRDQKAEDVQIFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLE  219

Query  429  FVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTED  488
            +V  G+L+ +LH NSD+LSWA DRI+MA+AVAEALE LHSR+PAII RDLKSN ILLT+ 
Sbjct  220  YVPRGNLRDYLHTNSDILSWARDRIFMAIAVAEALENLHSRTPAIIRRDLKSNYILLTKS  279

Query  489  LDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRI  548
            LDPKLIDFGVSRG+MDLTMTAGV                             SELDTGRI
Sbjct  280  LDPKLIDFGVSRGMMDLTMTAGV-----------------------------SELDTGRI  310

Query  549  PYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRI  590
            P+FD V+ DG +L+PFQILQE+M GTLRPSFSVDCPPRIQ +
Sbjct  311  PHFDAVEDDGTRLVPFQILQEIMTGTLRPSFSVDCPPRIQML  352

>PHYRA_84558
Length=415

 Score = 296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 184/280 (66%), Gaps = 18/280 (6%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRP------------------TAF  394
            LL    L+G R+P +SL F+  LS  ASGE W+ Q+G                    T F
Sbjct  127  LLECPELMGKRVPAQSLHFKATLSSGASGEVWLAQFGNQQVAVKQLLRTIEHTLKDVTEF  186

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIY  454
             +EI L+ASL HPHIV FIGVAW+SL N+ MV+E+   GDL+ FL ++  +LSW+ D+I 
Sbjct  187  VDEIVLSASLSHPHIVSFIGVAWSSLDNVGMVMEYCPMGDLRRFLAESGRLLSWSRDKIR  246

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTP  514
            M V +  AL+Y+HSR P IIHR LKS NILLTE L  K+IDFGVSR   D  MTAGVGTP
Sbjct  247  MTVGITRALQYMHSREPPIIHRALKSKNILLTETLQTKIIDFGVSRSRKDGFMTAGVGTP  306

Query  515  YWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGT  574
            YW APE+LEG RY+E+ADIYSFGVVLSELDT ++P+ D V  +G K  PFQ+L  V+ G+
Sbjct  307  YWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTDEGKKPKPFQVLHWVLDGS  366

Query  575  LRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            L PSFS +CP  I+ +   CL  DP  RPTA EL   L  
Sbjct  367  LSPSFSEECPRWIRSVGMQCLQHDPDLRPTAAELTHMLRA  406

>PHYSO_520398
Length=679

 Score = 298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 197/290 (68%), Gaps = 21/290 (7%)

Query  343  SAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG-------------  389
            SA  N  + +   S +L+G RI +E +     LS+ A GE W C+Y              
Sbjct  393  SAADNVQYTLTTDS-NLVGKRIAWERIELGRLLSRGAFGEVWACRYAGKKVAVKRLLQSK  451

Query  390  RPT-----AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSD  444
            +PT      F  EI+LTASL HP++V+FIGVAW+SL NL++V E++  GDLQ +LH+N D
Sbjct  452  KPTFHETEKFTNEIQLTASLNHPNVVRFIGVAWSSLENLALVEEYLPRGDLQQYLHRNGD  511

Query  445  VLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMD  504
            +++WA D+I+MAV +A+A++YLHSR   +IHRDLK+ N+LLT+ L PKLIDFG SR +  
Sbjct  512  LMTWACDKIHMAVGIAKAIQYLHSRE--VIHRDLKARNVLLTKRLQPKLIDFGASRLISP  569

Query  505  LTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPF  564
              M+AGVGTP+WTAPEVLE   Y+EKADIYSFGV+L+ELDT   P+   V  +G K+ PF
Sbjct  570  FDMSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLTELDTCEAPFHSVVGANGEKMKPF  629

Query  565  QILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             IL++V+ G LRPS +  CP RI++ A AC   DP  RP+A EL++ LEG
Sbjct  630  LILKQVVDGLLRPSLTDGCPQRIRKAADACFQHDPKLRPSASELVKLLEG  679

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 56/99 (57%), Gaps = 1/99 (1%)

Query  187  MWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIV  246
            MWS GGD  M PHIR   H W +     SY VYAVHT+S+  +P +  C   NGY SL++
Sbjct  14   MWSNGGDPDMVPHIRAVLHGWRDLDNNNSYLVYAVHTMSAKSEPAYGTC-NTNGYGSLVI  72

Query  247  PCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSS  285
            PC+  S  S   +A ++ P  S W+T W+K      D++
Sbjct  73   PCYPLSNTSADVVAVMSAPVTSPWLTTWIKQYRPATDTT  111

>PPTG_16191
Length=877

 Score = 301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 205/317 (65%), Gaps = 32/317 (10%)

Query  328  TSYGPSIS-SHQGDYESAGS-NQTFK----------ILLHSQHLLGNRIPYESLSFQMEL  375
            T + PSI  S Q D ES  +  +TF            L    +L+G RI +E +     L
Sbjct  563  TEFMPSIRDSIQADRESIPALRETFSRYSATDNVQYTLTTDSNLIGKRIAWERIELGRLL  622

Query  376  SKAASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAW  417
            S+ A GE W C+Y G+  A                 F  EI+LTASL HP+IV+FIGV W
Sbjct  623  SRGAFGEVWACRYAGKKVAVKRLLQTRTHTFLETEKFTNEIQLTASLNHPNIVRFIGVTW  682

Query  418  NSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRD  477
            +SL NL+MV E++  GDLQ +L +N D+++WA D+I MA+ +A A++YLHSR   +IHRD
Sbjct  683  SSLENLAMVEEYLPRGDLQNYLKRNGDLMTWARDKIDMAIGIARAIDYLHSRQ--VIHRD  740

Query  478  LKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            +K+ NILLT+ L PKLIDFG SR      MTAGVGTP+WTAPEVLE   Y+EKADIYSFG
Sbjct  741  IKARNILLTKRLQPKLIDFGASRLWEPNDMTAGVGTPFWTAPEVLESTEYTEKADIYSFG  800

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
            V+L+ELDT   PY +T+  +G K+ PF IL+EV+ GTLRPS S +CP RI + A AC   
Sbjct  801  VLLTELDTCEAPYHNTLGANGEKMKPFHILKEVVDGTLRPSLSCNCPQRISKAADACFQH  860

Query  598  DPSDRPTAQELIQWLEG  614
            DP+ RP+A EL++ LEG
Sbjct  861  DPNLRPSASELVRMLEG  877

 Score = 205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 148/239 (62%), Gaps = 3/239 (1%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GT+SDIARQLY RH +G++       ++P AVT RL  L ++F +LPGL+Q A+LWD+G+
Sbjct  57   GTSSDIARQLYLRHAAGESIDNCVPNTIPAAVTARLAPLNVSFDNLPGLLQRALLWDSGY  116

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP  D VQIWT G  +M+++A+S  +     CT L C QP+D+  Y++ +C+GTQ+L 
Sbjct  117  VISPENDAVQIWTLGGRSMSNLAISKVEFDTTGCTALNCSQPDDSTYYANNFCTGTQMLT  176

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++C++D F DS     L  MWS GGD  M P IR   H W + +T  SY +YAVHT++ 
Sbjct  177  AAKCLMDNF-DSDTSSHLA-MWSDGGDPDMVPEIRAVMHGWLDASTNDSYLLYAVHTMTV  234

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSS  285
              +P +  C    GY SL+VPC+  S  S   +A ++ P  + WVT W+K      D++
Sbjct  235  DAEPAYGTC-NKGGYGSLVVPCYPMSNTSADIVAVMSAPVATPWVTTWIKQYQPASDTT  292

>PITG_17582
Length=707

 Score = 296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 195/290 (67%), Gaps = 21/290 (7%)

Query  343  SAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA--------  393
            SA  N  + +   S +L+G RI +E +     LS+ A GE W C+Y G+  A        
Sbjct  421  SATDNVQYTLTTDS-NLIGKRIAWERIQLGRLLSRGAYGEVWACRYAGKKVAVKRLLQTR  479

Query  394  ---------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSD  444
                     F  EI+LTASL HP+IV+FIGV W+SL NL+MV E++  GDLQ +L +N D
Sbjct  480  THTFLETEKFTNEIQLTASLNHPNIVRFIGVTWSSLENLAMVEEYLPRGDLQNYLKRNGD  539

Query  445  VLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMD  504
            +++WA D+I MA+ +A A++YLH+R   +IHRDLK+ NILLT+ L PKLIDFG SR    
Sbjct  540  LMTWARDKIDMAIGIARAIDYLHTRQ--VIHRDLKARNILLTKRLQPKLIDFGTSRLWEP  597

Query  505  LTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPF  564
              M+AGVGTP+WTAPEVLE + Y+EKADIYSFGV+L+ELDT   PY DT+  +G K  PF
Sbjct  598  NDMSAGVGTPFWTAPEVLESSEYTEKADIYSFGVLLTELDTCEAPYHDTLGANGEKKKPF  657

Query  565  QILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             +L++V+ GTLRPS S  CP RI R A AC   DP+ RP+A EL++ LEG
Sbjct  658  HVLKDVVDGTLRPSLSTGCPQRICRAADACFQHDPTLRPSASELVRMLEG  707

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 62/114 (54%), Gaps = 3/114 (3%)

Query  172  VDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPT  231
            +D F DS     L  MWS GG++  TP IR   H W + +T  SY +YAVHT++   +P 
Sbjct  1    MDNF-DSDTSSHLA-MWSDGGNSDSTPEIRAVMHGWLDASTNDSYLLYAVHTMTVDSEPA  58

Query  232  WNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSS  285
            +  C    GY SL+VPC+  S  S   +A ++ P  + WVT W+K      D++
Sbjct  59   YGTC-NKGGYGSLVVPCYPLSNTSTDIVAVMSVPVATPWVTTWIKQYQPTSDTT  111

>PHYRA_84556
Length=817

 Score = 297 bits (761),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 193/290 (67%), Gaps = 21/290 (7%)

Query  343  SAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA--------  393
            SA  N  +  L+   +L G RI +E +     LS+ A GE W C+Y G+  A        
Sbjct  531  SAADNVQY-TLVSDSNLAGKRIAWERIELGRLLSRGAFGEVWACRYAGKRVAVKRLLQSK  589

Query  394  ---------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSD  444
                     F  EI+LTASL HP+IV+FIGVAW+SL NL+MV E++  GDLQ +L +N D
Sbjct  590  APTFHETEEFTNEIQLTASLNHPNIVRFIGVAWSSLENLAMVEEYLPRGDLQKYLKRNGD  649

Query  445  VLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMD  504
            +++WA D+IYMAV +A A+ YLHSR   +IHRD+K+ N+LLT+ L PKLIDFG SR    
Sbjct  650  LMTWARDKIYMAVGIARAIRYLHSRE--VIHRDIKARNVLLTKRLTPKLIDFGASRLWAP  707

Query  505  LTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPF  564
              M+AGVGTP+WTAPEVLE   YSEKADIYSFGV+LSELDT   PY  T+  +G K+ PF
Sbjct  708  SDMSAGVGTPFWTAPEVLESTEYSEKADIYSFGVLLSELDTCEAPYHSTLGPNGEKMKPF  767

Query  565  QILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             +L+ VM G+LRP  +  CP RI++ A AC   DP+ RP+A EL++ LEG
Sbjct  768  HVLKLVMDGSLRPGLTAGCPQRIRQAADACFQRDPTLRPSASELVKLLEG  817

 Score = 202 bits (514),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 146/239 (61%), Gaps = 3/239 (1%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G+ SDIARQLY RH +G++   V   S+P +VT RL  L +++  LPGL+Q A+LWD G+
Sbjct  57   GSTSDIARQLYLRHAAGESIDKVVPNSIPASVTARLSPLNVSYDDLPGLLQRALLWDAGY  116

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP  D VQ+WT G  +M+++AVS  +     CT L C QP+D+   ++ +C+GTQ+L 
Sbjct  117  VISPENDAVQVWTLGGRSMSNLAVSKVEFDTTGCTALSCSQPDDSTYNANNFCTGTQMLT  176

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++C++D F +S A   L  MWS GGD  + P IR   H W + TT  SY VYAVHT+ +
Sbjct  177  AAKCLMDDF-NSDASSHLA-MWSDGGDPDLVPEIRGMMHGWKDSTTNDSYLVYAVHTMGA  234

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSS  285
              +P +  C    GY SL+VPC+  S  S   +A + +P  + WVT W+K      D++
Sbjct  235  EAEPAYGTC-NQGGYGSLVVPCYPMSNTSADVVAVMAQPVATPWVTTWVKQYRPASDTT  292

>PPTG_01911
Length=246

 Score = 279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 167/247 (68%), Gaps = 41/247 (17%)

Query  262  VNKPRGSEWVTMWLKDEFAVGDSSGFDEl----------------------llipillss  299
            + +P GS W+T WLKDEF V D  GF+E+                        +     +
Sbjct  1    MTRPTGSAWLTTWLKDEFEVEDL-GFEEVLLIPVILVVVASMGIGWFCWKWSSLLKREQA  59

Query  300  sCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHL  359
            S CDFDVVSPNYL VV HEQA R TV TTSYGPSISSH  DYESAGSNQT KILLHSQHL
Sbjct  60   SSCDFDVVSPNYLDVVTHEQALRRTVTTTSYGPSISSHPDDYESAGSNQTLKILLHSQHL  119

Query  360  LGNRIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELT  401
             GNRIPY+SL FQ ELSK A GE WIC+YG                      FAEEIELT
Sbjct  120  HGNRIPYDSLVFQTELSKGAPGEVWICRYGGQEVAVKKLLHIRDQKAEDVQIFAEEIELT  179

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAE  461
            ASLIHPHIVKFIGVAWNSLSNLSMVLE+V  G+L+ +LH NSD+LSWA DRI+MA+AVAE
Sbjct  180  ASLIHPHIVKFIGVAWNSLSNLSMVLEYVPRGNLRDYLHTNSDILSWARDRIFMAIAVAE  239

Query  462  ALEYLHS  468
            ALE LHS
Sbjct  240  ALENLHS  246

>HYAP_14441
Length=832

 Score = 292 bits (747),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 189/275 (69%), Gaps = 20/275 (7%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQYG-------------RPT-----AFAEEIE  399
            +L+G RI +E +     LS  A GE W+C+Y              +PT     AF  EI+
Sbjct  560  NLIGKRIAWERIELDRLLSSGAFGEVWLCRYASKQVAVKRLLQSKKPTFRETEAFTSEIQ  619

Query  400  LTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAV  459
            LTASL HP+IV+FIGV W+SL NL+MV E++S GDLQ +L +NSD+++WA D+I MA+ V
Sbjct  620  LTASLDHPNIVRFIGVCWSSLENLAMVEEYLSRGDLQNYLQQNSDLMTWACDKIDMAIGV  679

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAP  519
            A A+  LH R   +IHRD+K+ N+LLT+ L PKLIDFG SR      M+AGVGTP+WTAP
Sbjct  680  ARAIACLHGRR--VIHRDIKARNVLLTKRLRPKLIDFGASRLWAPSDMSAGVGTPFWTAP  737

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EVLE   Y+EKADIYSFGV+LSELDTG+ PY + +  +G K  PF IL++V+ G+LRPS 
Sbjct  738  EVLESTEYTEKADIYSFGVLLSELDTGKAPYHNMLRANGEKAKPFLILKKVVDGSLRPSL  797

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             + CP RI++ A AC   DP  RP+A EL++ L+G
Sbjct  798  VMGCPQRIRKAAEACFQHDPKLRPSAAELVKLLDG  832

 Score = 207 bits (528),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 143/239 (60%), Gaps = 3/239 (1%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            G+ SDIARQLY RH++GD  A V   S+P AVT RL  L ++F +LPGL+Q A+LWD+G+
Sbjct  54   GSTSDIARQLYLRHQAGDRIAQVVPNSIPAAVTARLLLLNVSFKNLPGLLQRALLWDSGY  113

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ISP  D VQIWT G   MA +AVS  +     CT L C QP+ T  Y++++C+GTQ+L 
Sbjct  114  VISPVNDAVQIWTLGGRPMAHLAVSEVEFHTTGCTALNCSQPDGTMYYANEFCTGTQMLT  173

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             ++C++DTFE   +      MWS GGD  M P IR   H W + +T  SY + AVHT   
Sbjct  174  TAKCLMDTFESDSSSHL--AMWSDGGDMKMVPEIRAVMHGWLDASTNSSYLLAAVHTAKL  231

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSS  285
              +P +  C   +GY SL+VPC+     +   +A +  P  + W+T W+K      D+S
Sbjct  232  ESEPAYGACK-KDGYGSLVVPCYSLKHTAADIVAVMAVPVETPWITTWIKQYQVTSDTS  289

>PHYCA_543949
Length=195

 Score = 268 bits (685),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 154/190 (81%), Gaps = 0/190 (0%)

Query  425  MVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
            MVL+F+  GDLQ +L KN++++SWA D+I++A  +  A+EYLH R+P +IHRDLKS N+L
Sbjct  1    MVLDFLPTGDLQSYLKKNAEIMSWAKDKIHIATGIGRAVEYLHCRTPPLIHRDLKSKNVL  60

Query  485  LTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELD  544
            LT +L+ KLIDFGVSRG+ + TMTAGVGTPYWTAPE+L+G RY+E+ADIYSFGV+LSELD
Sbjct  61   LTTNLEAKLIDFGVSRGLAENTMTAGVGTPYWTAPEILQGGRYTEQADIYSFGVILSELD  120

Query  545  TGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPT  604
            TG+ PY D +  D  K  PFQI++EVMAG LRPSFS DCPPRI+RI+ AC   DP+ RPT
Sbjct  121  TGKFPYHDVLRPDRKKPRPFQIMEEVMAGKLRPSFSEDCPPRIRRISTACCQHDPTRRPT  180

Query  605  AQELIQWLEG  614
            A ++++ L G
Sbjct  181  AAQVVRILNG  190

>PPTG_16189
Length=437

 Score = 276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 156/327 (48%), Positives = 195/327 (60%), Gaps = 31/327 (9%)

Query  317  HEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKI-------------LLHSQHLLGNR  363
            +E   +   A +S G    S   + +  G +QTF++             LL S  L G R
Sbjct  100  YESNEQPKSAPSSEGWHTLSLDTNAKPFGLDQTFRVPPRSNEVDTCLPTLLESLDLAGKR  159

Query  364  IPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASLI  405
            IP  +L  +  LS  ASGE W+ QY GR  A                 F EEI L+ASL 
Sbjct  160  IPTRNLHIKATLSTGASGEVWLAQYKGRRVAVKQLLRTNERTAKDVKNFVEEIILSASLN  219

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            H H+V FIGVAW+S  NLSMV+E+   GDL+ FL ++  +LSW+ D+I MAV +A+AL Y
Sbjct  220  HLHVVSFIGVAWSSPENLSMVMEYCPMGDLRRFLVESGRLLSWSRDKIRMAVGIAQALRY  279

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGA  525
            +H R   IIHRDLK  NILLT+ L+ K+ DFG+SR   +  MTAGVGTPYW APE+LEG 
Sbjct  280  IHGRDSPIIHRDLKPKNILLTDTLEAKISDFGLSRTRREGFMTAGVGTPYWIAPEILEGK  339

Query  526  RYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPP  585
            RY+E ADIYSFGVVLSELDT + P+ D V  +G K  P QIL  V+ G L PSF+  CP 
Sbjct  340  RYTELADIYSFGVVLSELDTCKTPFSDVVTAEGKKPKPLQILHWVLDGRLSPSFTDKCPR  399

Query  586  RIQRIAAACLSFDPSDRPTAQELIQWL  612
             I+ +   CL  DP  RPTA EL Q L
Sbjct  400  WIRSVGMQCLQHDPGLRPTAAELTQVL  426

>PITG_17584
Length=404

 Score = 271 bits (692),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 184/291 (63%), Gaps = 35/291 (12%)

Query  345  GSNQTFKI-------------LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GR  390
            G +QTF++             LL S  L+G RIP +SL F+  LS  ASGE W+ Q  G+
Sbjct  114  GLDQTFRVPPRSDEMITPMPTLLESPPLMGKRIPIQSLVFKTTLSTGASGEVWLAQLKGQ  173

Query  391  PTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEG  433
              A                 F +EI L+ASL H H+V FIGVAW+ + N++MV+EF   G
Sbjct  174  RVAVKQLLQTNERTLKDVKDFVDEIRLSASLGHQHVVSFIGVAWSRVDNVAMVMEFCPMG  233

Query  434  DLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKL  493
            DL+ FL ++   LSW+ D+I MA+ +A+AL YLH R P IIHRDLKS NILLT+ L+ K+
Sbjct  234  DLRRFLAESGRWLSWSRDKIRMAIGIAQALRYLHEREPPIIHRDLKSKNILLTDTLEAKI  293

Query  494  IDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDT  553
             DFGVSR   D  MTAGVGTPYW APE+LEG RY+E+ADIYSFGVVLSELDT ++P+ D 
Sbjct  294  SDFGVSRSRKDGFMTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDV  353

Query  554  VDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQR----IAAACLSFDPS  600
            V  +G K  P QIL  V+ G L P+FS  CP R++R    +  +C    PS
Sbjct  354  VTAEGKKPKPVQILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  404

>PITG_17579
Length=472

 Score = 271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 159/451 (35%), Positives = 228/451 (51%), Gaps = 72/451 (16%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GTNSD+A+QLY R + GDT        VP  +  RLD LK+ +  LPG+ Q A+LWD+GF
Sbjct  28   GTNSDLAKQLYFRAKKGDTVGKFDNFQVPETLQTRLDKLKLDWDKLPGIAQRALLWDSGF  87

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
            GISP+   V+IWT  D++MA++AV   +   VNCT+  C QP+ + +YS+  C G+ +L 
Sbjct  88   GISPSNQFVRIWTLNDYSMAELAVPKSEYEAVNCTVNSCTQPSGSISYSNFKCLGSDMLR  147

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
             +RC+V  F+D  A      MW TGG+  + P  R+  H W +     SY V+AVHT+  
Sbjct  148  AARCVVQDFDD--ATGIHAAMWVTGGNPAVVPTPRVNKHEWKDVHDNKSYIVFAVHTIDV  205

Query  227  ADDPTWNQCPV---NNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA---  280
             D+P W++C     N+GY SL++PCH  +           +  GS+WV+ WL ++++   
Sbjct  206  KDEPGWDECATADRNSGYGSLVLPCHNIASIVPEIDREKQEVTGSDWVSRWLVEDYSSIA  265

Query  281  -VGDSSGFD-------------------------------ElllipillsssCCDFDVVS  308
             V D  G                                 +     +  S  C D    +
Sbjct  266  GVSDEDGKSSVLLVAPIAAGVLVVIGLVGLFVFLKRRRQTKDDRECLHQSPVCQDTYYQN  325

Query  309  PNYLGVVAHEQAR----------RGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQH  358
            P ++       AR          RG   T    PS     G    +GSN+T  IL +S++
Sbjct  326  PEFIADRDRSTARTIEDTETATYRGVDRTIQLRPSYPEEFG----SGSNRTLNILHNSEY  381

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIEL  400
            L+G R+PY+S+ F+  LSK A+GE W C+Y                       FA+EIEL
Sbjct  382  LVGKRLPYDSIVFKRALSKGANGEVWQCEYQNEQIAVKRLLQHHNHHAHEVEEFAKEIEL  441

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVS  431
            +ASL HP+IV F+GVAWNSL+NL M LE  +
Sbjct  442  SASLNHPNIVTFVGVAWNSLNNLVMALEMAT  472

>PHYCA_107365
Length=269

 Score = 261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 186/276 (67%), Gaps = 20/276 (7%)

Query  350  FKILLHSQHLLGNRIPYESLSFQMELSKAA---SGEAWICQYGRPT--------AFAEEI  398
             K+LL S++L G RIPYE L+  +    ++   +G+    +   P+        AFAEEI
Sbjct  1    MKLLLSSKNLRGKRIPYEKLTLPLSEEDSSCEYNGQKVTARKLPPSKHNAEGIQAFAEEI  60

Query  399  ELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVA  458
            +L ASL HP+IV+FIGVAW    +L++V EF+  G L  +L  N + LSW  ++  +A+ 
Sbjct  61   DLNASLAHPNIVQFIGVAWKYPCDLTLVCEFLPRGSLLAYLQGNVE-LSWTEEKTRIALG  119

Query  459  VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTA  518
            +A+ALEYLH   P +IH D+K NN+LLTEDL+PKLI+ G +        T+G    YWTA
Sbjct  120  IAQALEYLHGHRPPVIHGDIKVNNVLLTEDLEPKLIEIGRT--------TSGGEMSYWTA  171

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEVLEG + +++ADIYSFGV+LSELDTG+ PY+DT+   G KL P Q+LQ V  G LRP 
Sbjct  172  PEVLEGKQMTQQADIYSFGVLLSELDTGKAPYWDTMTKTGIKLQPSQVLQLVKTGKLRPH  231

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             S +CP R+QR+ AACL+ +P++RP+A++L++ LEG
Sbjct  232  LSKNCPLRLQRLGAACLAHNPANRPSARQLVRQLEG  267

>PHYCA_543955
Length=190

 Score = 257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 146/189 (77%), Gaps = 0/189 (0%)

Query  425  MVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
            MVLEF   GDLQ FL K  D+LSW+ D+I +A+ V  ALEYLHSRSP +IHRDLKS NIL
Sbjct  1    MVLEFFPTGDLQTFLAKKEDLLSWSRDKIRIALGVGRALEYLHSRSPPLIHRDLKSKNIL  60

Query  485  LTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELD  544
            LT+ L+ KLIDFGVSR   +  MTAGVGTPYWTAPE+LEG RY+E+AD+YSFGVVLSELD
Sbjct  61   LTDQLEAKLIDFGVSRIRQEHPMTAGVGTPYWTAPEILEGKRYTEQADLYSFGVVLSELD  120

Query  545  TGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPT  604
            TG++PY D +  +G KL PFQIL +VMAG LRPSFS  CP +I+RI  AC   D S RPT
Sbjct  121  TGKLPYHDALTSEGKKLKPFQILADVMAGMLRPSFSEGCPSKIRRIGVACCQHDQSRRPT  180

Query  605  AQELIQWLE  613
            A +++  L+
Sbjct  181  AAQVVAMLQ  189

>PHYSO_337953
Length=377

 Score = 262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 178/279 (64%), Gaps = 22/279 (8%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------F  394
            LL S  L   RIP++ L F+  LS  A G+ W+  Y G   A                 F
Sbjct  91   LLESPELASRRIPFQRLKFKATLSSGAHGKVWLRLYRGHQVAVKQLLRTNEHSRKDVQDF  150

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIY  454
            A+EI LTASL HPHIV F+GVA +++  L++VLEF   GDL+ FL ++  +LSW  D+I 
Sbjct  151  ADEILLTASLTHPHIVAFVGVAGSNVDTLALVLEFCPMGDLRRFLRESGRLLSWNRDKIR  210

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMD-LTMTAGVGT  513
            MAV VA+AL YLH + P IIHRDLKS N+L TE L+ K+ DFGVSR   +  T TAGVGT
Sbjct  211  MAVGVAKALRYLHDQEPPIIHRDLKSMNVLPTETLETKVGDFGVSRACSEGFTTTAGVGT  270

Query  514  PYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAG  573
            PYW APE L+G RYSE+ADIYSFGVVLSELDT R P+ D V  +G K  P QIL+ V+ G
Sbjct  271  PYWIAPESLQGKRYSEQADIYSFGVVLSELDTCRTPFTDGVTAEGKKPKPAQILRWVLDG  330

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
             L P+FS DCP  I+ +    L  DP  RPTA EL Q L
Sbjct  331  KLSPAFSQDCPRWIRSVG---LQHDPDMRPTATELTQML  366

>PHYKE_1813
Length=469

 Score = 258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/318 (44%), Positives = 189/318 (59%), Gaps = 19/318 (6%)

Query  315  VAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQME  374
            VA E+ R+   +  S G +  S   D     + +  +       L   RIPY SL F   
Sbjct  146  VAPEKVRQSGGSLNSSGNNRDSDITDKSREVAARVLQQFQSDPTLGRRRIPYSSLYFTRV  205

Query  375  LSKAASGEAWICQYGRPTA------------------FAEEIELTASLIHPHIVKFIGVA  416
            LSK A GE W+ Q                        F  EI+L AS  HP IV+F+GV+
Sbjct  206  LSKGAFGEVWLAQLENKQVAVKRILNEKKNDEKEIECFGAEIKLMASFSHPKIVEFMGVS  265

Query  417  WNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHR  476
            W+S+ ++  V E++S+GDL GFL +    L+W   +I++A  VA+AL YLH  SP +IHR
Sbjct  266  WSSMQDVCAVTEYMSKGDLYGFLKRRQGQLNWRDHKIFLAEDVADALGYLHGLSPKVIHR  325

Query  477  DLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYS  535
            DLKS NILL +    KL DFG+SR   ++ TMTAGVGT YWTAPEVL G +Y+EKADI+S
Sbjct  326  DLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVLMGKKYTEKADIFS  385

Query  536  FGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACL  595
            FG+V+SELDT  +PY D  D+ G KL   +I+Q V+   LRP+FS +CPP ++ +A  CL
Sbjct  386  FGIVMSELDTHAVPYSDKRDNSGKKLQGMKIVQMVIRRQLRPTFSSECPPLVKELADRCL  445

Query  596  SFDPSDRPTAQELIQWLE  613
              DP  RP+A EL++ ++
Sbjct  446  DADPDVRPSAMELLRIIQ  463

>PITG_07967
Length=474

 Score = 258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 176/274 (64%), Gaps = 19/274 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            L G RIPY SL F   LSK A GE W+ Q   R  A                 F  EI+L
Sbjct  195  LGGMRIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKL  254

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVA  460
             AS  HP IV+F+GV+W+S+ ++  V E++++GDL GFL +    L+W   +I++A  VA
Sbjct  255  MASFSHPKIVEFMGVSWSSMQDVCAVTEYMAKGDLYGFLKRRQGQLNWRDHKIFLAEDVA  314

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAP  519
            +AL YLH  SP +IHRDLKS NILL +    KL DFG+SR   ++ TMTAGVGT YWTAP
Sbjct  315  DALGYLHGLSPKVIHRDLKSKNILLDDSFRAKLSDFGISRERSVEDTMTAGVGTIYWTAP  374

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EVL G +Y+EKADI+SFG+V+SELDT  +PY D  D  G KL   +I+Q V+   LRP+F
Sbjct  375  EVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDASGKKLQGMKIVQMVIRRNLRPTF  434

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            S DCPP ++ +A  CL  DP  RP+A EL++ ++
Sbjct  435  SSDCPPLVKELADRCLDSDPDVRPSAMELLRIIQ  468

>PPTG_08473
Length=473

 Score = 256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/270 (49%), Positives = 174/270 (64%), Gaps = 19/270 (7%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASL  404
            RIPY SL F   LSK A GE W+ Q   R  A                 F  EI+L AS 
Sbjct  198  RIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKLMASF  257

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALE  464
             HP IV+F+GV+W+S+ ++  V E++++GDL GFL +    L+W   +I++A  VA+AL 
Sbjct  258  SHPKIVEFVGVSWSSMQDVCAVTEYMAKGDLYGFLKRRQGQLNWRDHKIFLAEDVADALG  317

Query  465  YLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLE  523
            YLH  SP +IHRDLKS NILL +    KL DFG+SR   ++ TMTAGVGT YWTAPEVL 
Sbjct  318  YLHGLSPKVIHRDLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVLM  377

Query  524  GARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDC  583
            G +Y+EKADI+SFG+V+SELDT  +PY D  D  G KL   +I+Q V+   LRP+FS DC
Sbjct  378  GKKYTEKADIFSFGIVMSELDTHAVPYSDKRDASGKKLQGMKIVQMVIRRNLRPTFSSDC  437

Query  584  PPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            PP ++ +A  CL  DP  RP+A EL++ ++
Sbjct  438  PPLVKELADRCLDSDPDVRPSAMELLRIIQ  467

>PHYCA_107158
Length=188

 Score = 246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 145/187 (78%), Gaps = 0/187 (0%)

Query  427  LEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLT  486
            +EFV  GDLQG+L K+ D+L W  D+I+MA+ +A ALEYLH++ P IIHRDLKS NIL++
Sbjct  1    MEFVPLGDLQGYLRKSFDLLLWRTDKIHMALGIALALEYLHTKCPPIIHRDLKSKNILIS  60

Query  487  EDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTG  546
            ++LDPKL DFGVSRG  D +MT GVGTPYW+APE+LEG RY+E+ADIYSFGVVLSELDTG
Sbjct  61   KNLDPKLSDFGVSRGRQDNSMTTGVGTPYWSAPEILEGNRYTEQADIYSFGVVLSELDTG  120

Query  547  RIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQ  606
            + PY D +  +G    P +IL EV+AG LRP+FS  CP  I+RI  AC   DP+ RPTA 
Sbjct  121  KNPYHDALTPEGKNEKPVKILAEVIAGNLRPTFSAHCPDNIRRIGEACCQHDPASRPTAS  180

Query  607  ELIQWLE  613
            ++++ L+
Sbjct  181  QIVKILQ  187

>PHYSO_565433
Length=472

 Score = 255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 176/271 (65%), Gaps = 19/271 (7%)

Query  362  NRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTAS  403
            +RIPY SL F   LSK A GE W+ Q   R  A                 F  EI+L AS
Sbjct  196  SRIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKLMAS  255

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
              HP IV+F+GV+W+S+ ++  V E++++GDL GFL +    L+W   +I++A  VA+AL
Sbjct  256  FSHPKIVEFVGVSWSSMQDVCAVTEYMAKGDLYGFLKRRQGQLNWRDHKIFLAEDVADAL  315

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVL  522
             YLH  SP +IHRDLKS NILL +    KL DFG+SR   ++ TMTAGVGT YWTAPEVL
Sbjct  316  GYLHGLSPKVIHRDLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVL  375

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G +Y+EKADI+SFG+V+SELDT  +PY D  D+ G KL   +I+Q V+   +RP+FS D
Sbjct  376  MGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKIVQMVIRRNMRPTFSED  435

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            CPP ++ +A  CL  +P  RP+A EL++ ++
Sbjct  436  CPPLVKELADRCLDSNPDVRPSATELLRIIQ  466

>PHYSO_523359
Length=662

 Score = 260 bits (664),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 188/597 (31%), Positives = 276/597 (46%), Gaps = 70/597 (12%)

Query  69   VSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADI  128
            V + +VP ++  RL    + +  L G +Q A+LWDTG  ++  G  VQ++   + +M+ I
Sbjct  64   VVLSNVPDSLLVRLAEKSVRWDSLSGYLQRALLWDTGLVMTSGGRLVQVYAPCNESMSVI  123

Query  129  AVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDF----L  184
                D     +C M  C        ++   CS T +   ++C +   E   A D      
Sbjct  124  LTPFDAYKGKDCRMETCDLTG--LYFAGSTCSRTTVWKAAQCGIAAVE-KNATDIENAEA  180

Query  185  GIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPT-------------  231
              +WS  GD    P IRL  H   +  +  S  V+ V    S DD T             
Sbjct  181  STLWSEDGDLAGVPDIRLYKHV--QDNSSGSAGVHEVIGSGSEDDYTIEADVLFTINQIA  238

Query  232  ---WN--QCPVNNGYSSLIVPCHKRSEFSDAEMAAVNK---PRGSEWVTMWLKDEFAVGD  283
               WN   CP   G S  + PC    EF   +    N    P    +V +WL+ E +  D
Sbjct  239  PLPWNIESCP---GDSFFVAPC---VEFGTPDEDPFNPWCLPSRGGFVDLWLESEISGED  292

Query  284  -----------SSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGP  332
                       +   D    I          F +++     ++A +  R+      S  P
Sbjct  293  MSTGSSATSASALSTDASSSISGDTVILVVLFILLAAAVGALIAVQVNRKKKDDDKSTVP  352

Query  333  SISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT  392
              S ++     +    TF I      +   RI Y+ L+F   +++ A+GE W    G   
Sbjct  353  RNSLNESRRRRSIELATFCI---DARITSKRIAYDCLTFDKLIARGANGEVWKGTCGSQI  409

Query  393  A------------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGD  434
                               FA E+ L ++L HP+IV+F+G++WN + +L +V EF+ +GD
Sbjct  410  VAIKQLLPEKRHDEDNVMLFANEVRLASTLEHPNIVRFVGLSWNRVCDLCIVSEFMEQGD  469

Query  435  LQGFLH-KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKL  493
            L   L+ K  D LSW  +++ +A  +AEAL YLH R P IIHRDLKS N+LL   L  KL
Sbjct  470  LSMLLNSKRKDELSWCKEKLGIATDIAEALAYLHGRQPIIIHRDLKSLNVLLDSRLRAKL  529

Query  494  IDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD  552
             DFG+SR    D TMT GVGT  WTAPE+L G  YSEKAD+YS+ +VLSELDT   P+  
Sbjct  530  SDFGLSRERSSDDTMTNGVGTLLWTAPEILRGEAYSEKADVYSYAIVLSELDTCLPPFTL  589

Query  553  TVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
              +     L   Q++    +G ++P    DCP  +Q++  AC SF+PS RP A E++
Sbjct  590  NAEVSERHLTTMQLMHLATSGQVQPQLREDCPAPLQQLTTACASFEPSHRPNALEIV  646

>PHYCA_511282
Length=465

 Score = 254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 131/270 (49%), Positives = 174/270 (64%), Gaps = 19/270 (7%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASL  404
            RIPY SL F   LSK A GE W+ Q   R  A                 F  EI+L AS 
Sbjct  190  RIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKLMASF  249

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALE  464
             HP IV+F+GV+W+S+ ++  V E++++GDL GFL +    L+W   +I++A  VA+AL 
Sbjct  250  SHPKIVEFLGVSWSSMQDVCAVTEYMAKGDLYGFLKRRQGQLNWRDHKIFLAEDVADALG  309

Query  465  YLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLE  523
            YLH  SP +IHRDLKS NILL +    KL DFG+SR   ++ TMTAGVGT YWTAPEVL 
Sbjct  310  YLHGLSPKVIHRDLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVLM  369

Query  524  GARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDC  583
            G +Y+EKADI+SFG+V+SELDT  +PY D  D+ G KL   +I+Q V+   LRP+FS DC
Sbjct  370  GKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKIVQMVIRRNLRPTFSSDC  429

Query  584  PPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            P  ++ +A  CL  DP  RP+A EL++ ++
Sbjct  430  PALVKELADRCLDSDPDVRPSATELLRIIQ  459

>PHALS_03626
Length=495

 Score = 254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/280 (48%), Positives = 178/280 (64%), Gaps = 20/280 (7%)

Query  354  LHSQHLLGN-RIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------F  394
              S  +LG  RIPY SL F   LSK A GE W+ Q   R  A                 F
Sbjct  210  FQSDPILGKMRIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECF  269

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIY  454
              EI+L AS  HP IV+F+GV+W+S+ ++  V E++ +GDL GFL +    L+W   +I+
Sbjct  270  GAEIKLMASFSHPKIVEFLGVSWSSMQDVCAVTEYMGKGDLYGFLKRRQGQLNWRDHKIF  329

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGT  513
            +A  VA+AL YLHS SP +IHRDLKS NILL +    KL DFG+SR   ++ TMTAGVGT
Sbjct  330  LAEDVADALGYLHSLSPKVIHRDLKSKNILLDDSFRAKLSDFGISRERSVEDTMTAGVGT  389

Query  514  PYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAG  573
             YWTAPEVL G +Y+EKADI+SFG+V+SEL+T  +PY D  D+ G KL   +I+Q V+  
Sbjct  390  IYWTAPEVLMGKKYTEKADIFSFGIVMSELETHAVPYSDKRDNAGKKLQGMKIVQMVIRR  449

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             LRP+FS +CP  ++ +A  CL  DP  RP+A EL++ ++
Sbjct  450  NLRPTFSTECPKLVKELADRCLDSDPDARPSALELLRLIQ  489

>SDRG_05104
Length=632

 Score = 256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 201/623 (32%), Positives = 286/623 (46%), Gaps = 75/623 (12%)

Query  49   NSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGI  108
            N+D+  +      +G    A+   S P   T RLDS  + +  L  L + A+LWD GF  
Sbjct  8    NADLVARFRALDSAGVVGNALVPSSPPPPATARLDSYGLVWPDLTALAKEALLWDMGFVR  67

Query  109  SPN--GDPVQIWTTGD------FTMADIAVSPDDI--TNVNCTMLECPQPNDTPAYSSQ-  157
            +     D  Q++T  D       +MA IAVS      +  N T+  C   N    Y+ Q 
Sbjct  68   ASTFPDDVAQVYTACDGNTNSGSSMASIAVSEAAFLASQANATVRTCAGANGN--YTRQE  125

Query  158  YCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGV-SY  216
               G  +  V +C V    D+    +  +    G DAT  P  RL  H W   + G  S+
Sbjct  126  NAHGMFLGKVVKCAVPLLPDTTPNSYASMWAQDGLDATTVPDPRLWRHEWH--SIGFPSF  183

Query  217  SVYAVHTVSSA-DDPTWNQCPVNNGYSSLIVPC--HKRSEFSDAEMAAVNK----PRGSE  269
             ++A+HTV +   +  W +CP      SLIVPC  +K   FS    +  N     PR S 
Sbjct  184  LLFAIHTVPAQFTETAWGKCPATTAPGSLIVPCTVYKPGNFSSLVFSPPNTEWCLPRPSS  243

Query  270  WVTMWLKDEFAVGDS-SGFDElllipillsssCCDFDVVSPNYLGVVAHEQARR------  322
             +  WL    A+ D+ +  DE+      L+       V++   LGV+A+   RR      
Sbjct  244  AMDKWLT---AIHDAKTNRDEVKPAVSTLTIVL--IAVLAFLLLGVIAYVCLRRPRRPRG  298

Query  323  --------------GTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYES  368
                           T  T   G    S Q       S++         +L   R+PY S
Sbjct  299  DHDGSQSPTSSYYHATRPTLGTGSGHGSSQAKQTITTSSKALNAFQEDPYLCSKRLPYSS  358

Query  369  LSFQMELSKAASGEAWICQYG----RPTA-----------------FAEEIELTASLIHP  407
            +++   LSK A GE W+        RP A                 FA+EI L A   HP
Sbjct  359  ITYSRMLSKGAFGEVWLGTLTDTSPRPVAIKRILDAKRADAAELECFADEIRLMALFSHP  418

Query  408  HIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGD-RIYMAVAVAEALEYL  466
            +IV F+G  WN+L N+  V E+++ GD+ G+L  +  V   A D +I + + V  A++YL
Sbjct  419  NIVHFLGFGWNTLQNMCAVTEYLANGDVSGYLAVHRAV---AYDVKIAIGLGVLNAVQYL  475

Query  467  HSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGA  525
            H+  P +IHRDLK  N+LL++ L  KL DFG+SR  + D TMT GVGT +WTAPEVL G 
Sbjct  476  HTLDPPVIHRDLKGRNVLLSDALVAKLSDFGISRQRIADETMTVGVGTAFWTAPEVLLGL  535

Query  526  RYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPP  585
            +Y    D+YSFGV+++ELDT   PY D        ++     Q+     LRP+ + D P 
Sbjct  536  KYDASVDVYSFGVIMTELDTQHAPYADIKGVPSMHIVQKVTGQDGAPAPLRPTLTRDAPA  595

Query  586  RIQRIAAACLSFDPSDRPTAQEL  608
                 A AC+  DP+ RPT  EL
Sbjct  596  WFVATANACMERDPTRRPTISEL  618

>PYVX_17951
Length=675

 Score = 256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 190/637 (30%), Positives = 311/637 (49%), Gaps = 90/637 (14%)

Query  51   DIARQLYTRHRSGDTS----AAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            D+  QLY      D S    + + + + P  +  RL++  +A+  L G +Q A+LWD G 
Sbjct  38   DVVEQLYKLRTETDASEDDDSRIVLDNAPDLLVQRLEASGLAWDELSGSLQRALLWDLGL  97

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             ++     VQ+      +M  + +S   +    C      QP+ +   ++  CS + + +
Sbjct  98   VLTDQSKLVQVLVPCGESMNAVFLSRSSLEAAPCPT----QPDCSARAATTNCSFSGLGS  153

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRL---RDHTWTEPTTGVSYSVYAVHT  223
            +++C V     +       I+WS  G     P IR+   + +  T  +     S   +  
Sbjct  154  IAQCAVRNGIRAIEPASAAIIWSEDGALASVPDIRVYKSQVNASTSSSNSSVTSSSPLII  213

Query  224  VSSA--DDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAV  281
            +S A  D  + N CP    +   ++PC + +    ++     +P G+ ++ +W++ E  V
Sbjct  214  ISQAPMDLLSANDCPTTPLF---VMPCIELT----SDTGDWCQPLGNSFIDLWIEKEMPV  266

Query  282  -----GDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGP----  332
                 G S+G   L+ I  +L+   C   + +  YL     ++  R T+  ++  P    
Sbjct  267  TEQSTGLSTGTIALITIAAVLTVFFCSM-LGAYTYLSQCRRKRWTRRTLYNSADTPTASR  325

Query  333  ------SISSHQGDYESAGSNQTFKILL-------------------------HSQHL--  359
                  S+S+ + ++++   + T ++ L                         HS  L  
Sbjct  326  GVESRDSLSALEQEFKAPSKSITSRVALLGDAATPAGAVRLSDTDHVSEAVLRHSVELQP  385

Query  360  -------LGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------F  394
                   +  R+P++SL F   +++ A+GE W  ++ GR  A                 F
Sbjct  386  ICTDAQIMARRVPFDSLRFSRLIARGANGEVWQGEFRGRVVAIKSLLPEKRHDKTAVQTF  445

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-KNSDVLSWAGDRI  453
            A EI + ++L+HP+IV+F+G++W  LS L +V EF+  GDL   L  + S  LSW+ D++
Sbjct  446  AHEIRIASALVHPNIVRFLGLSWRQLSELCVVSEFMDGGDLSELLSSERSKQLSWSSDKL  505

Query  454  YMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVG  512
             +A  +AEAL YLHSRSP IIHRDLKS N+LL   L  KL DFG+SR   M+ TMT+GVG
Sbjct  506  SIATDIAEALAYLHSRSPVIIHRDLKSLNVLLNARLRAKLSDFGLSRERSMEETMTSGVG  565

Query  513  TPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMA  572
            T  WTAPE+L G  YSEKAD+YS+G+VLSELDT   P+    +    +L   Q++  V  
Sbjct  566  TLLWTAPEILRGEPYSEKADVYSYGIVLSELDTCLPPFSLNDEVSRQRLTTMQLIHLVTC  625

Query  573  GTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
              L P F  DCP  I ++A +C + D SDRP+A +++
Sbjct  626  SKLAPEFRSDCPSAITKLALSCAAPDASDRPSALQIV  662

>PHYRA_81273
Length=445

 Score = 250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 173/271 (64%), Gaps = 19/271 (7%)

Query  362  NRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTAS  403
             RIPY SL F   LSK A GE W+ Q   R  A                 F  EI+L AS
Sbjct  169  KRIPYSSLYFTRVLSKGAFGEVWLAQLENRQVAVKRILNEKKNDEKEIECFGAEIKLMAS  228

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
              HP IV+F+GV+W+S  ++  V E++ +GDL GFL +    L+W   +I++A  VA+AL
Sbjct  229  FSHPKIVEFLGVSWSSHQDVCAVTEYMGKGDLYGFLKRRQGQLNWRDHKIFLAEDVADAL  288

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVL  522
             YLH  SP +IHRDLKS NILL +    KL DFG+SR   ++ TMTAGVGT YWTAPEVL
Sbjct  289  GYLHGLSPKVIHRDLKSKNILLDDAFRAKLSDFGISRERSVEDTMTAGVGTIYWTAPEVL  348

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G +Y+EKADI+SFG+V+SELDT  +PY D  D+ G KL   +I+Q V+  +LRP+F+ D
Sbjct  349  MGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKIVQMVIRRSLRPTFTSD  408

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            CP  ++ +A  CL  DP  RP+A EL++ ++
Sbjct  409  CPALVKELADRCLDADPDVRPSATELLRIIQ  439

>PPTG_08474
Length=531

 Score = 252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 168/269 (62%), Gaps = 19/269 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPY+SL F   +SK A GE W+ Q                        F  EI+L A L 
Sbjct  256  IPYDSLYFTRSISKGAFGEVWLAQLENTQVAVKKILDEKKHDTKEIECFGAEIKLMALLK  315

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV FIGV+W+   +L  V EF+++GDL G+L +  + L+W   ++++A  +AEAL Y
Sbjct  316  HPKIVGFIGVSWSDKQDLCAVTEFMAKGDLYGYLERRKNKLNWPDHKVWLAEDIAEALVY  375

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS +P +IHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  376  LHSLNPKVIHRDLKSKNILLDNKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  435

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+DT  +PY D  D+ G KL   +I+Q V+   LRPSF  DCP
Sbjct  436  KKYTEKADIYSFGIVMSEMDTCEVPYSDKRDNSGKKLQGMKIIQMVIRMALRPSFREDCP  495

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +I+ +AA CL  DP  RP A EL+  L 
Sbjct  496  EQIKALAARCLDADPDARPDAPELLDILR  524

>PHYCA_511287
Length=515

 Score = 251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 167/269 (62%), Gaps = 19/269 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPY+SL F   +SK A GE W+ Q                        F  EI+L A L 
Sbjct  240  IPYDSLYFTRSISKGAFGEVWLAQLENTQVAVKKILDEKKHDTKEIECFGAEIKLMALLK  299

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV FIGV+W+   +L  V EF+++GDL G+L +    L+W   ++++A  +AEAL Y
Sbjct  300  HPKIVGFIGVSWSDNQDLCAVTEFMAKGDLYGYLERRKGKLNWPDHKVWLAEDIAEALVY  359

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS +P +IHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  360  LHSLNPKVIHRDLKSKNILLDNKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  419

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+DT  +PY D  D+ G KL   +I+Q V+   LRPSF  DCP
Sbjct  420  KKYTEKADIYSFGIVMSEMDTCEVPYSDKRDNAGKKLQGMKIIQMVIRMALRPSFRDDCP  479

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +++ +AA CL  DP  RP A EL+  L 
Sbjct  480  EQVKALAARCLDADPDTRPDAPELLDILR  508

>HYAP_03658
Length=522

 Score = 250 bits (639),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 168/268 (63%), Gaps = 19/268 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPY+SL F   +SK A GE W+ Q                        F  EI+L A L 
Sbjct  246  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDVKEIECFGAEIKLMALLK  305

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV+FIG++ +   +L  V EF+++GDL G+L +    ++W  D+I++A  +AEAL Y
Sbjct  306  HPKIVRFIGLSCSDKQDLCAVTEFMAKGDLHGYLERRKAKITWPADKIWLAEDIAEALGY  365

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS SP +IHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  366  LHSLSPKVIHRDLKSKNILLDSKYRAKLSDFGISRKRSLESTMTAGVGTIYWTAPEVLMG  425

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+DT  +PY D  D DG KL   +I+Q V+   LRP+F   CP
Sbjct  426  KKYTEKADIYSFGIVMSEMDTCEVPYSDKRDSDGKKLQSMKIIQLVIRQALRPTFLGTCP  485

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWL  612
             +I+ +A  CL  DP  RP A EL+++L
Sbjct  486  EQIKTLAGRCLDADPDARPDASELLKFL  513

>PHYKE_9428
Length=503

 Score = 249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/270 (48%), Positives = 166/270 (61%), Gaps = 19/270 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPY+SL F   +SK A GE W+ Q                        F  EI+L A   
Sbjct  228  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDDKKHDLKEIECFGAEIKLMAQFK  287

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV+F+GV+W++  +L  V EF+++GDL G+L +    L+W   + Y+A  +AEAL Y
Sbjct  288  HPKIVEFVGVSWSTEHDLCAVTEFMAKGDLYGYLERRQKHLNWRDHKTYLAEDIAEALVY  347

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS SP IIHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  348  LHSLSPKIIHRDLKSKNILLDSKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  407

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+DT  +P+ D  D  G KL   ++LQ V+  +LRPSF  DCP
Sbjct  408  KKYTEKADIYSFGIVMSEMDTCAVPFSDKRDDAGKKLQGMKVLQMVIRMSLRPSFKPDCP  467

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
              I+ +A  CL  DP  RP A EL+  L G
Sbjct  468  VPIKALADRCLDADPDTRPDAPELVSILRG  497

>SDRG_05099
Length=620

 Score = 252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 204/616 (33%), Positives = 300/616 (49%), Gaps = 97/616 (16%)

Query  66   SAAVSIKS-VPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGD--  122
            ++ VS+ S  PT+V  RL  + +++  L  L + A+LWD G   +      Q++T+ +  
Sbjct  26   ASTVSVPSTAPTSVATRLTRVGLSWNALSTLQKQALLWDHGLVQTDATTYTQVYTSCESD  85

Query  123  ---FTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIV---DTFE  176
                 MA I ++  ++      +  CP    T  Y+ Q   G+  L +++C V     F 
Sbjct  86   GVGRAMASIGLTKAEVAAAGVALATCPA--STGNYARQDI-GSFPLKLTKCAVPLKSAFT  142

Query  177  DSGAKDFLGIMWSTGGDATMTPH-IRLRDHTWTEPTTGVSYSVYAVHTVSS--ADDPT--  231
             + +      +WS        P  +R+  HT T      S ++ A+H  S+  AD  T  
Sbjct  143  SNAS------VWSQDALGATRPFDLRVYQHTAT------SGAIMAIHATSAGGADTSTTT  190

Query  232  -WNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNK---------PRGSEWVTMWLKDEFAV  281
                CP   G   L +PC   + +S A +A+ +          P  S+ +T WL +  A 
Sbjct  191  SIGSCPSTPG--GLAIPC---AIYSTAVVASGSGSGTAPKWCVPPTSDAMTSWLLEVRAA  245

Query  282  ------GDSSGFDElllipillsssCCD-----FDVV------------SPNYLG--VVA  316
                  G SS     +++ +LL           F  V            +P +LG   + 
Sbjct  246  IKTAAPGASSSSTAAIVLGVLLGLVLLAGGGYWFFFVRKPRKKKRRTNDAPGFLGNAFLR  305

Query  317  HEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELS  376
            H+  R       SY   +   + +  +A ++       H   L   R+PY +++    LS
Sbjct  306  HKNQRPEPEEEDSYERQL--QEMNVGTAAASLKLNAFEHDPFLFSRRLPYGAVTCHRILS  363

Query  377  KAASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWN  418
            K A GE WI  + G+  A                 F EEI + A+L HPHIV  IG AW+
Sbjct  364  KGAYGEVWIGSFRGKEVAIKKILHAKRHDTFELECFTEEIRIMAALDHPHIVHLIGFAWD  423

Query  419  SLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
            +L+NL  V E++++GD+ G+L  N D L+W   ++ +AV  A AL YLH RSPAIIHRDL
Sbjct  424  TLTNLCAVTEYLAKGDVTGYLVANMD-LNWDA-KLRLAVGTARALAYLHGRSPAIIHRDL  481

Query  479  KSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            KS NIL+++  + KL DFG+SR  V D TMT GVGT YWTAPEVL G +Y+E+ DIYSFG
Sbjct  482  KSKNILVSDTGEAKLSDFGISRTRVADETMTVGVGTVYWTAPEVLLGQKYTEQVDIYSFG  541

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
            VVL ELDT R PY D  +     +    I Q V     RP FS  CP  ++ +A  C++ 
Sbjct  542  VVLCELDTHRAPYADMQE-----VAQMAIAQRVATHQFRPPFSAKCPKLVKDLADRCMAQ  596

Query  598  DPSDRPTAQELIQWLE  613
            DPS RP AQE++  +E
Sbjct  597  DPSARPNAQEIVDLIE  612

>PITG_07968
Length=526

 Score = 249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 166/269 (62%), Gaps = 19/269 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPY+SL F   +SK A GE W+ Q                        F  EI+L A L 
Sbjct  251  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDTKEIECFGAEIKLMALLK  310

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV FIGV+W+   +L  V EF+++GDL G+L +  + L+W   ++++A  +AEAL Y
Sbjct  311  HPKIVGFIGVSWSDKQDLCAVTEFMAKGDLYGYLERRKNKLNWPDHKMWLAEDIAEALVY  370

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS +P +IHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  371  LHSLNPKVIHRDLKSKNILLDNKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  430

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+DT  +P+ D  D  G KL   +I+Q V+   LRPSF  DCP
Sbjct  431  KKYTEKADIYSFGIVMSEMDTCEVPFSDKRDSSGKKLQSMKIIQMVIRSALRPSFREDCP  490

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +I+ +A  CL  DP  RP A EL+  L 
Sbjct  491  EQIKALADRCLDADPDARPDAPELLDILR  519

>H310_07620
Length=628

 Score = 251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 206/607 (34%), Positives = 286/607 (47%), Gaps = 86/607 (14%)

Query  73   SVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPV--QIWT-------TGDF  123
            +VP+ V  RL + K+ F  L  L Q A+LWD G     +G     Q++T       T   
Sbjct  37   AVPSTVVARLSATKLTFDELSPLAQRALLWDMGLVRVNDGSFTLQQVYTRCTNENSTTGA  96

Query  124  TMADIAVSPDDI--TNVNCTMLECPQPNDTPAYS---SQYCSGTQILNVSRCIVDTFEDS  178
            TM ++ V  +    T+ + +++EC        YS    Q  +G  +   + C V     S
Sbjct  97   TMENLMVPKEKFLATDQSASIIEC----SGFGYSFVRQQVSNGVNLDVAANCAVSKANPS  152

Query  179  GAKDFLGIMWSTGG-DATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSA--DDPTWNQC  235
               +    MW+  G  +T  P  ++  H W   T G  +  ++VHT+     D+  W  C
Sbjct  153  --TNSHSSMWAQDGVPSTDVPFPKIHRHQWNS-TDGPPFLFFSVHTLPEKYDDEWPWGSC  209

Query  236  PVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGFDElllipi  295
            P  N   SL  PC    E     +     P  S  +  WL        +S       +P 
Sbjct  210  P-ENKPGSLTFPCRVYEESKGMCL-----PSPSTAMNNWLNAIARAKTTSPPATTTPVPS  263

Query  296  llsssCCDFDVVSPNYLGVVA------------HEQARR-------GTVATTS--YGPSI  334
               +       V     G VA              +AR        GT  TT+  Y  S+
Sbjct  264  PTQAPSLSTGAVVGIVAGAVAFVACGLLCFILRRRKARADAINDNDGTPTTTTAMYNSSL  323

Query  335  SSHQGD----YESAGSNQTFKILLHS----QHLLGNRIPYESLSFQMELSKAASGEAWIC  386
             +  G     + +A   QT    L+S     +L   R+PY S+     LSK A GE WI 
Sbjct  324  QNSSGQPRSHHAAAQPIQTNSSKLNSFQVDAYLCTRRLPYSSVVQTRMLSKGAFGEVWIG  383

Query  387  QYGRPT------------------AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLE  428
             Y   T                   FAEEI L ASL HP+IV FIG AWN+L N+  V+E
Sbjct  384  SYDGMTVAIKKILDAKRNDETELECFAEEIRLMASLSHPNIVTFIGFAWNTLQNMCCVVE  443

Query  429  FVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSP-AIIHRDLKSNNILLTE  487
            ++  GDL  +L  +    +W  +++ +AV +A AL YLH+  P  IIHRDLK+ N+L+++
Sbjct  444  YMQHGDLGSYLVAHPKT-NW-NEKLVLAVGIARALAYLHALVPNKIIHRDLKAKNVLVSD  501

Query  488  DLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTG  546
             L+ KL DFG+S+    D TMTAGVGT YWTAPEVL G RYSE AD+YSFG VL+ELDT 
Sbjct  502  QLEAKLSDFGISKERTTDDTMTAGVGTSYWTAPEVLSGHRYSELADVYSFGCVLNELDTH  561

Query  547  RIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQ  606
             IPY    +  G   M   I+Q V    LRP+F+  CP  ++ +A  CLS  P DRPTA 
Sbjct  562  NIPY---ANLKGVPAM--TIVQRVTTQGLRPTFNDSCPKLVKDLAMQCLSTSPRDRPTAA  616

Query  607  ELIQWLE  613
            E+++ +E
Sbjct  617  EIVRLIE  623

>PHYSO_529022
Length=517

 Score = 248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 165/268 (62%), Gaps = 19/268 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPYESL F   +SK A GE W+ Q                        F  EI+L A L 
Sbjct  241  IPYESLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDVKEIECFGAEIKLMALLK  300

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV FIGV+W++  +L  V EF+++GDL G+L +    L+W   ++++A  VAEAL Y
Sbjct  301  HPKIVGFIGVSWSNTQDLCAVTEFMAKGDLYGYLERRKGKLNWPDHKMWLAADVAEALVY  360

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS SP +IHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  361  LHSLSPKVIHRDLKSKNILLDSKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  420

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+DT  +PY D  D  G  L   +I+Q V+   LRPSF  DCP
Sbjct  421  KKYTEKADIYSFGIVMSEMDTCAVPYSDKRDDSGKVLQGMKIIQMVIRMALRPSFRKDCP  480

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWL  612
             +++ +A  CL  +P  RP A EL+  L
Sbjct  481  EQVKALADRCLDANPDARPDAPELLNIL  508

>PHYRA_81274
Length=518

 Score = 247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 166/269 (62%), Gaps = 19/269 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            IPY+SL F   +SK A GE W+ Q                        F  EI+L A L 
Sbjct  243  IPYDSLYFTRAISKGAFGEVWLAQLENTQVAVKKILDEKKHDVKEIECFGAEIKLMALLK  302

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV FIGV+W++  +L  V EF+++GDL G+L +    L+W   ++++A  +AEAL Y
Sbjct  303  HPKIVGFIGVSWSTTQDLCAVTEFMAKGDLYGYLERRKGKLNWRDHKMWLAEDIAEALGY  362

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEG  524
            LHS SP +IHRDLKS NILL      KL DFG+SR   ++ TMTAGVGT YWTAPEVL G
Sbjct  363  LHSLSPKVIHRDLKSKNILLDSKYRAKLSDFGISRKRSVEETMTAGVGTIYWTAPEVLMG  422

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFG+V+SE+D   +PY D  D+ G  L   +I+Q V+   LRPSF  DCP
Sbjct  423  KKYTEKADIYSFGIVMSEMDMCAVPYSDKRDNSGKPLQGMKIIQMVIRSALRPSFQEDCP  482

Query  585  PRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +I+ +A  CL  DP  RP A EL+  L+
Sbjct  483  EQIRALADRCLDADPDVRPDAPELLDILQ  511

>PYVX_17944
Length=704

 Score = 249 bits (637),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 204/633 (32%), Positives = 298/633 (47%), Gaps = 117/633 (18%)

Query  81   RLDSLKIAFTHLPGLVQLAVLWDTGFGISPN--GDPVQIWTTGDFTMADIAVSPD-----  133
            RLD+ ++ +  L GL Q A+LWD+G+    +     VQ++T    TM D+   PD     
Sbjct  50   RLDAKELTWDSLSGLQQRALLWDSGYVARADDASTLVQVYTACGRTMGDLL--PDVAVLD  107

Query  134  ----DITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA-KDFLGIMW  188
                + T  +C +  C   N    Y S  C+   +++ + C V   + + A  +  G++W
Sbjct  108  ELYGNSTTASCAIDNCGSINH---YVSSACATDPLVSATLCAVAASDMTNADAETAGVVW  164

Query  189  STGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPC  248
            +  G +   P   LR H+    T    Y++YA+H  SS        C  N  +   IVPC
Sbjct  165  AEDGQSIDVPSPVLRRHSQANAT----YNLYAIHVTSSIFTGQ-ATCETNGNF---IVPC  216

Query  249  HKRSEFSDAEMAAVNK-------------PRGSEWVT---MWLKDEFAV--GDSSGF---  287
              +   SDA++ AV               P  S + T   + +  EFAV  G SS     
Sbjct  217  RDKGATSDADLCAVTTGAAMDVWLEYLAVPEPSSFSTAAVVMMVLEFAVILGLSSAIWYL  276

Query  288  --------DElllipillsssCCDFDV-------VSPNYLGVVAHEQARR---------G  323
                    D+ +L     +      DV       ++P  +   A  ++RR          
Sbjct  277  VRHRKLLRDKQMLDAAEGAGLLTPADVHLLPDERLTPMEVFFGARPRSRRVPGVDGSAGA  336

Query  324  TVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEA  383
             VATT    S+S+ Q   +S+      +  +    ++  RI +  L+F   ++K   GE 
Sbjct  337  IVATTRAEISLSNDQLCRKSS----ILRKFVAEPTIVTKRISFAQLTFLRLMAKGGMGEV  392

Query  384  WICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSM  425
            W+ QY  R  A                 F++EI + + L HP IV FIGVAW SL +L  
Sbjct  393  WLGQYEARYVAMKCLLPSKREDVPSLEQFSDEIRMASVLEHPRIVGFIGVAWQSLLHLCA  452

Query  426  VLEFVSEGDLQGFLHKN--SDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNI  483
            + E++   DL+  L     S +LSW  ++I +A+ VAEAL YLHS  P +IHRDLKS N+
Sbjct  453  ITEYMERSDLEALLALPAASSILSWPKEKISIALDVAEALVYLHSLVPVVIHRDLKSKNV  512

Query  484  LLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            LL   L  KL DFG+SR   ++ TMT GVGT  W+APEVLEG +Y EKADI+SFG+VLSE
Sbjct  513  LLDRHLRAKLSDFGLSRARSVEDTMTNGVGTILWSAPEVLEGNQYDEKADIFSFGIVLSE  572

Query  543  LDTGRIPYFDTVDH---------------------DGAKLMPFQILQEVMAGTLRPSFSV  581
            +DT  +PY  T D                         K+   QI+  V  G L P+F  
Sbjct  573  IDTCALPYGFTKDRGAGGGGGNGAGGGLAGPLAGPAAGKMKSMQIVHLVSEGKLLPTFRD  632

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELI-QWLE  613
            DCPP +  +A  CL  D ++RPTA E++ +W+ 
Sbjct  633  DCPPALVSLAQRCLRLDSAERPTAMEVVCRWMR  665

>SPRG_08302
Length=647

 Score = 247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 195/620 (31%), Positives = 283/620 (46%), Gaps = 84/620 (14%)

Query  64   DTSAAVSIKSVPT----AVTDRLDSLKIAFTHLPGLVQLAVLWDTGF-GISPNGDP---V  115
            + + A SI + PT    AV  RL  + + +  LP L +LA+LWD GF   +P  D     
Sbjct  23   NATTATSIGAAPTKPDAAVIVRLTKMNLVWDDLPPLAKLAILWDMGFVQNNPTVDVNALS  82

Query  116  QIWT----TGDFTMADIAVSPDDI--TNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSR  169
            +I+T    +   +MA IA+   D   +  + T   C           +  +G ++   +R
Sbjct  83   RIYTRCVGSVGASMASIALPKTDFLASQSDATTRPCDSATTGVYLRQENSNGGRLRPYTR  142

Query  170  CIVDTFEDSGAKDFLGIMWSTGGDATMT-PHIRLRDHTWTEPTTGVSYSVYAVHTVSSAD  228
            C          KD    MW+  G    T P   L+ H W +      + ++++HT   A 
Sbjct  143  CATANVTMGNIKDSHSSMWAQDGQGLSTYPLPNLQRHAWNDKEF---WLIFSIHTQELAT  199

Query  229  DPTWNQCP---VNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLK---------  276
            +P W  CP   +  G ++   PC         +   V  P  S+ +  WLK         
Sbjct  200  EPQWGTCPDKTMTPGGATF--PCQVFDGSVPPQGWCV--PSNSQAMDAWLKTIANQKISA  255

Query  277  ------DEFAVGDSS-------------GFDElllipillsssCC---DFDVVSPNYLGV  314
                  +  A   S+             G      + + L   CC        +P+  G 
Sbjct  256  TPLPSSNTPAASSSTTPASTGLSTIAILGIGIGAGVLLALGIWCCVARRRRQATPDAPGY  315

Query  315  VAHEQARRGTVATTSYGPSISSHQGDYES-AGSNQTFKILLHSQHLLGNRIPYESLSFQM  373
            V   + R G  + T+      +  G Y+    ++ T         L   R+PY S+    
Sbjct  316  V-ELRPRDGRYSVTTSTQPTQTRTGSYQPITTASHTLNEFQRDPSLSQKRLPYSSVVCSR  374

Query  374  ELSKAASGEAWICQY------------------GRPTAFAEEIELTASLIHPHIVKFIGV  415
             LSK A GE W+  +                      AFA+EI L AS  HP+IV+F+G 
Sbjct  375  LLSKGAFGEVWLGSFNGQVVAVKRLLDSKRTSEAEIEAFADEIRLMASFTHPNIVRFVGF  434

Query  416  AWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIH  475
            AW+SL NL  V E++ +GDL  +L  +  +     ++I +A+ +A AL YLHS SP IIH
Sbjct  435  AWDSLQNLCAVTEYMPQGDLHTYLQSHLQLQWRRHEKIKIALGIAHALAYLHSLSPTIIH  494

Query  476  RDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIY  534
            RDLKS N+L+    + KL DFG+SR   +D TMTAGVGT +WTAPEVL G  YSE ADIY
Sbjct  495  RDLKSKNVLMAAGCEAKLSDFGISRERTLDETMTAGVGTIFWTAPEVLLGEHYSEMADIY  554

Query  535  SFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSVDCPPRIQRIAAA  593
            SFGVVL E+DT   P  D       K +P   ++  +    LRPS +  CP  +Q +AA 
Sbjct  555  SFGVVLCEMDTHGPPLAD------CKGLPQATMIHRITNEGLRPSLTPTCPQHVQALAAR  608

Query  594  CLSFDPSDRPTAQELIQWLE  613
            C++ DP +RP + ELI  L+
Sbjct  609  CMARDPKNRPASYELIAILQ  628

>SDRG_05105
Length=610

 Score = 244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 194/592 (33%), Positives = 280/592 (47%), Gaps = 74/592 (13%)

Query  72   KSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF---GISPNGDPVQIWT------TGD  122
            +S P  V  RL +L + +  L    + A+LWD GF     + N    Q++T      +GD
Sbjct  32   ESPPPTVAARLAALSLTWADLGNADKQALLWDMGFVRTTTADNNQVTQVYTKCSNSGSGD  91

Query  123  FTMADIAVSPDDI--TNVNCTMLECPQPNDTPAYSSQYCS-GTQILNVSRCIVDTFEDSG  179
             +MA IA+S      +  + T+  C        Y  Q  S G ++  +++C+V     +G
Sbjct  92   -SMATIALSKAAFLQSQADATVRTCTSSAINTTYVRQENSNGGKLAPLTKCMVANV--TG  148

Query  180  AKDFLGIMWSTGGDATMT-PHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVN  238
              D    MW+  G    T P   +  H W+       + +YA+HT ++ D+  +  C  +
Sbjct  149  VADSHSSMWAQDGQGLSTYPLPNIMRHAWS---INEFWLIYAIHTQTAGDEIGFGFCGPS  205

Query  239  NGYSSLIVPCHKRSEFSDAEMAAVN--KPRGSEWVTMWLKDEFAVGDSSGFDEl------  290
            +    L +PC       D  M       P  S  +T  L  + A+   S           
Sbjct  206  STPGGLTIPC----RVFDGSMPPTGWCLPTPSATMTQSLA-QIALAKKSTPAPTPAPTIG  260

Query  291  -llipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSY------------GPSISSH  337
                   +   C    VV    LG+ A    RR    TT++            G + S  
Sbjct  261  SSSSNHTVLIVCL---VVGAVLLGLGAWCYIRRRRKQTTAHSDFTTYRSNAPRGATGSPP  317

Query  338  QGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA---  393
                  A ++ T         L   R+PY +++    LSK A GE W+  + G+  A   
Sbjct  318  TSYQPIATASHTLNEFQRDPSLSQKRVPYSAVTCSRLLSKGAFGEVWLGSFNGQVVAIKR  377

Query  394  --------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL  439
                          FA+EI L AS  HP+IV+F+G AW+SL NL  V E++ +GDL  +L
Sbjct  378  LLDSKRTSEAEIEGFADEIRLMASFTHPNIVRFVGFAWDSLQNLCAVTEYMPQGDLHTYL  437

Query  440  HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVS  499
              +  +     ++I +A+ +A AL YLHS SP IIHRDLKS N+L+    + KL DFG+S
Sbjct  438  QSHLQLQWRRHEKIKIALGIAHALAYLHSLSPTIIHRDLKSKNVLMAAGCEAKLSDFGIS  497

Query  500  R-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG  558
            R    D TMTAGVGT +WTAPEVL G  YSE ADIYSFGVVL E+DT   PY +      
Sbjct  498  RERTQDETMTAGVGTIFWTAPEVLLGEHYSEMADIYSFGVVLCEIDTREAPYPNM-----  552

Query  559  AKLMP-FQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
             K +P   ++  +    LRP+FS  CP ++Q IAA CL  DP+ RP+A+EL+
Sbjct  553  -KAVPQVAMVHRITNEGLRPAFSESCPAQLQVIAARCLDADPAMRPSARELV  603

>CCA21936
Length=435

 Score = 239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 167/285 (59%), Gaps = 22/285 (8%)

Query  351  KILLHSQH---LLGNRIPYESLSFQMELSKAASGEAWICQY------------------G  389
            ++L   QH   L    IPY SL F   +SK A GE W+ Q                    
Sbjct  145  RVLAEFQHDGTLKQRYIPYSSLYFTRLVSKGAFGEVWLAQLEDHQVAVKRMLAERKNDEK  204

Query  390  RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWA  449
                FA EI+L AS  HP IV+F+G++W ++ +L  V E++  GDL  +L K    L W 
Sbjct  205  EIECFAAEIKLMASFSHPKIVEFVGLSWINVQDLCAVTEYMPRGDLFDYLKKKQGQLRWY  264

Query  450  GDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDLTMT  508
              ++++A  +AEAL YLHS  P +IHRDLKS N+LL      KL DFG+SR   ++ TMT
Sbjct  265  DQKLHLAEDIAEALSYLHSLQPQVIHRDLKSKNVLLDHQFRAKLSDFGISRERELEETMT  324

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQ  568
            AGVGT YW APEVL G +Y+EKADIYSFGVV+SELDT  +PY D  D  G K+ P +I +
Sbjct  325  AGVGTVYWIAPEVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRKVTPVKIAR  384

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             V    LRP+FS  CPP+++ +A  CL  +P  RP A EL+  L 
Sbjct  385  AVAQLGLRPTFSRTCPPQVRILAMRCLDANPDQRPHAHELVHLLR  429

>CCA24786
Length=435

 Score = 239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 167/285 (59%), Gaps = 22/285 (8%)

Query  351  KILLHSQH---LLGNRIPYESLSFQMELSKAASGEAWICQY------------------G  389
            ++L   QH   L    IPY SL F   +SK A GE W+ Q                    
Sbjct  145  RVLAEFQHDGTLKQRYIPYSSLYFTRLVSKGAFGEVWLAQLEDHQVAVKRMLAERKNDEK  204

Query  390  RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWA  449
                FA EI+L AS  HP IV+F+G++W ++ +L  V E++  GDL  +L K    L W 
Sbjct  205  EIECFAAEIKLMASFSHPKIVEFVGLSWINVQDLCAVTEYMPRGDLFDYLKKKQGQLRWY  264

Query  450  GDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDLTMT  508
              ++++A  +AEAL YLHS  P +IHRDLKS N+LL      KL DFG+SR   ++ TMT
Sbjct  265  DQKLHLAEDIAEALSYLHSLQPQVIHRDLKSKNVLLDHQFRAKLSDFGISRERELEETMT  324

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQ  568
            AGVGT YW APEVL G +Y+EKADIYSFGVV+SELDT  +PY D  D  G K+ P +I +
Sbjct  325  AGVGTVYWIAPEVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRKVTPVKIAR  384

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             V    LRP+FS  CPP+++ +A  CL  +P  RP A EL+  L 
Sbjct  385  AVAQLGLRPTFSRTCPPQVRILAMRCLDANPDQRPHAHELVHLLR  429

>CCA19358
Length=682

 Score = 243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 171/274 (62%), Gaps = 22/274 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            L   +I  E+++F   +S+ A GE W CQY                       F  EI+L
Sbjct  413  LQSRQISMENIAFVQLISRGAYGEIWQCQYQNQYIAVKRLLQNKTHTLQEAQEFIAEIQL  472

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVA  460
            TASL HP+IV FIGVA+ +L  L MVLEF + GD+Q +L  +    +W   +  MA+ VA
Sbjct  473  TASLHHPNIVTFIGVAYTTLEKLCMVLEFCARGDVQTYLQAHESP-NWTSHKREMALGVA  531

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPE  520
            +ALEYLHS SP I+HRD+K+ N+LL++ +  K+IDFG+S+  M   MTAG+GTPYWTAPE
Sbjct  532  KALEYLHSFSPPILHRDIKAKNVLLSDQMHVKVIDFGISKH-MHNAMTAGIGTPYWTAPE  590

Query  521  VLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFS  580
             L+G+ YSE +D+YSFGV LSE+DT R PY D       +L P QIL  VM GTL+PSFS
Sbjct  591  NLQGSEYSESSDMYSFGVFLSEVDTCRTPYVDL--KSDMELGPVQILHRVMNGTLQPSFS  648

Query  581  VDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
               P ++++IA  CL  D   RP A+ +++ L G
Sbjct  649  CHIPSQLEKIAKLCLHRDAKLRPAAKSVVEMLTG  682

 Score = 114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/244 (30%), Positives = 117/244 (48%), Gaps = 26/244 (11%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSI--KSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDT  104
            G+ SD+A+Q Y R+ SG     +S   +S+P  +  RL+S+ + F +L G +Q AV+WD+
Sbjct  66   GSTSDLAQQYYRRYASGSIIEPLSFTSQSLPERIRTRLNSIGLDFENLNGYLQRAVIWDS  125

Query  105  GFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLEC-----PQPNDTPAYSSQYC  159
            G+ +  +G   +I+T    +M +IA+      +VNCT + C     P       Y S  C
Sbjct  126  GYALG-SGALRKIYTRNGSSMENIAIPAKHYRSVNCTTISCTVHNVPTSLVKTTYRSDLC  184

Query  160  SGTQILNVSRCIVDTFEDSGAKDFLGI-----MWSTGGDATMTPHIRLRDHTWTEPTTGV  214
             G  IL VS C          +D  GI     +W+TGG     P   +  H W + +   
Sbjct  185  RGNDILKVSLC--------ATEDVFGISAHSALWATGGTDDFDPEPHIIRHAWYDTSNSQ  236

Query  215  SYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPC--HKRSEFSDAEMAAVNKPRGSEWVT  272
            SY V  +HT     +  + +CP      S+I+PC  + R   S+  +A+   P   +  T
Sbjct  237  SYLVNGIHTTLDTFEAAYGKCPSTGQSGSIIIPCAQYTRELASNWSLAS---PSFGQLTT  293

Query  273  MWLK  276
            +WL+
Sbjct  294  LWLE  297

>PPTG_17293
Length=417

 Score = 234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 132/307 (43%), Positives = 180/307 (59%), Gaps = 30/307 (10%)

Query  329  SYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY  388
            S G ++SS  G    A S+   + L   + ++  RIP E +  Q  +S+   GE ++  +
Sbjct  112  SQGRTVSSQPG----ASSDFNTEGLWTDEAIIAARIPREKVILQQRISRGGYGEVYVGTF  167

Query  389  GRPTA------------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFV  430
                                   F  E++L ASL HP IV+FIGVAW+SL++L +V EF+
Sbjct  168  NDQRVAIKMLLPETRKRIQSVNEFLAEVKLMASLEHPRIVEFIGVAWDSLTDLCVVSEFM  227

Query  431  SEGDLQGFLHK--NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTED  488
              GD++  L++  N   + +   ++ +A+ VA AL Y+HS  P +IHRDLKS NILLTED
Sbjct  228  EGGDVRALLNRYQNERNIGFDYTKVKIALHVAHALTYMHSFDPPLIHRDLKSKNILLTED  287

Query  489  LDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRI  548
             D KL DFG SR  +D TMTAG+GT  W APE++ G +Y EKADI+SFGVVLSELD+  +
Sbjct  288  YDAKLTDFGASRARVDRTMTAGIGTSLWMAPEMMTGEKYDEKADIFSFGVVLSELDSNAL  347

Query  549  PYFDTVDHDGAKLMP--FQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQ  606
            PY +T    G    P    ILQ VM G LR SFS  CPP I  +  AC++ DP+ RPTA 
Sbjct  348  PYANT----GKNRQPSDLAILQLVMQGKLRVSFSETCPPAILELGMACVAVDPTARPTAA  403

Query  607  ELIQWLE  613
            E +  L+
Sbjct  404  EALYRLQ  410

>SDRG_05454
Length=704

 Score = 239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 181/316 (57%), Gaps = 32/316 (10%)

Query  323  GTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGE  382
            GT  T+++  S  SH  D  S G       LL    LL  RI Y+ +     +S+   GE
Sbjct  381  GTGGTSNHYVSADSHYRDTTSLG-------LLSDPELLAVRIDYQEVQEIQLISRGGFGE  433

Query  383  AWICQY-GRPTA----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSM  425
             W   Y GRP A                FA EI++   L HP IV+FIG AW++  ++  
Sbjct  434  VWSGIYLGRPVAIKRLLPEKRTWDDAMNFAMEIKMMTRLNHPKIVEFIGAAWSNALSIQA  493

Query  426  VLEFVSEGDLQGFLHK-------NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
            + E+++ GDL+  L +       N  VL+WA  ++++A+ VA+AL YLHS +P  IHRDL
Sbjct  494  ICEYMNCGDLKSLLDRSSTKNDANGTVLTWANIKLHLAIDVADALVYLHSLNPKFIHRDL  553

Query  479  KSNNILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            KS NIL+  +   KL DFG+SR   ++ TMTAGVGT  W APEV++GA Y E  DIYSFG
Sbjct  554  KSRNILIDAENGAKLSDFGISRNRNLEDTMTAGVGTCRWMAPEVIQGAHYDEAVDIYSFG  613

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
             VLSE+DT  +PYFD    +G+KL    I+  V+ GTL+PSF+ DCP  I  IA ACL  
Sbjct  614  CVLSEMDTCNVPYFDATHTNGSKLQDHAIMAGVVQGTLKPSFTKDCPKEIVAIAVACLET  673

Query  598  DPSDRPTAQELIQWLE  613
            DP  RPT+ +L   L 
Sbjct  674  DPKKRPTSTQLSYLLR  689

>CCI41041
Length=413

 Score = 231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/263 (47%), Positives = 158/263 (60%), Gaps = 19/263 (7%)

Query  364  IPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASLI  405
            IPY SL F   +SK A GE W+ Q   R  A                 FA EI+L AS  
Sbjct  138  IPYSSLYFTRVVSKGAFGEVWLAQLEDRQVAVKRMLAERKNDEKEIECFAAEIKLMASFS  197

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEY  465
            HP IV+F+G++W ++ +L  V E++  GDL   L K    L W   ++Y+A  +AEAL Y
Sbjct  198  HPKIVEFVGLSWINVQDLCAVTEYMPRGDLFDHLKKKQGQLRWYDQKLYLAEDIAEALSY  257

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVLEG  524
            LHS  P +IHRDLKS N+LL      KL DFG+SR   ++ TMTAGVGT YW APEVL G
Sbjct  258  LHSLQPKVIHRDLKSKNVLLDHQFRAKLSDFGISRERELEETMTAGVGTVYWIAPEVLLG  317

Query  525  ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCP  584
             +Y+EKADIYSFGVV+SELDT  +PY D  D  G ++ P +I + V    LRP+FS  CP
Sbjct  318  RKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRRVTPVKIARAVAQLGLRPTFSRACP  377

Query  585  PRIQRIAAACLSFDPSDRPTAQE  607
             +++ +A  CL  +P  RP A E
Sbjct  378  QKVRLLAMRCLDANPDRRPPADE  400

>PHYRA_72889
Length=365

 Score = 229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 165/272 (61%), Gaps = 22/272 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            ++ NR+ Y+ +     +S+   G  +   Y  RP A                 F  EI L
Sbjct  66   IVTNRLAYDEVKLGRCISRGGFGLVFTGTYRSRPVAIKKIRVNKDAEADQIEQFIREIAL  125

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVA  460
             A L HP IV+FIGVAW ++ +LS V E ++ GDL   L  N   L+W   +  +A+ + 
Sbjct  126  MAILRHPRIVEFIGVAWEAVVDLSAVTELMTRGDLSTVLRANQ--LTWGDHKATIALHIV  183

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV--MDLTMTAGVGTPYWTA  518
            EAL YLHS +P +IHRDLKSNN+LL E+++ KLIDFG+SR     +  MTAG+GT +W A
Sbjct  184  EALAYLHSLNPKVIHRDLKSNNVLLNEEMEAKLIDFGISRERHGTETHMTAGMGTSFWIA  243

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEVL G  Y+EKAD++SFGVVLSELDT   PY++  +  G KL   +IL  V AG +RPS
Sbjct  244  PEVLRGQDYNEKADVFSFGVVLSELDTNDYPYWNATNPPGGKLQEGEILLLVAAGQMRPS  303

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQ  610
            FS +CP  I  +A+ CL   P DRP+A EL+Q
Sbjct  304  FSTECPAPILGVASHCLQVRPEDRPSAAELLQ  335

>SPRG_05981
Length=710

 Score = 238 bits (606),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/316 (43%), Positives = 181/316 (57%), Gaps = 32/316 (10%)

Query  323  GTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGE  382
            GT  T+++  S  SH  D  S G       LL    LL  RI ++ +     +S+   GE
Sbjct  387  GTGGTSNHYVSADSHYRDTTSLG-------LLSDPELLAVRIDFQEVQEIQLISRGGFGE  439

Query  383  AWICQY-GRPTA----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSM  425
             W   Y GRP A                FA EI++   L HP IV+FIG AW++  ++  
Sbjct  440  VWSGIYLGRPVAIKRLLPEKRTWDDAMNFAMEIKMMTRLNHPKIVEFIGAAWSNALSIQA  499

Query  426  VLEFVSEGDLQGFLHK-------NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
            + E+++ GDL+  L +       N  VL+WA  ++++A+ VA+AL YLHS +P  IHRDL
Sbjct  500  ICEYMNCGDLKSLLDRSSTKNDSNGTVLTWANIKLHLAIDVADALVYLHSLNPKFIHRDL  559

Query  479  KSNNILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            KS NIL+  +   KL DFG+SR   ++ TMTAGVGT  W APEV++GA Y E  DIYSFG
Sbjct  560  KSRNILIDAENGAKLSDFGISRNRNLEETMTAGVGTCRWMAPEVIQGAHYDEAVDIYSFG  619

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
             VLSE+DT  +PYFD    +G+KL    I+  V+ GTL+PSF+ DCP  I  IA ACL  
Sbjct  620  CVLSEMDTCNVPYFDATHTNGSKLQDHAIMAGVVQGTLKPSFTKDCPKEIVAIAVACLET  679

Query  598  DPSDRPTAQELIQWLE  613
            DP  RPT+ +L   L 
Sbjct  680  DPKKRPTSTQLSYLLR  695

>PYAR_13094
Length=478

 Score = 231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 154/464 (33%), Positives = 231/464 (50%), Gaps = 48/464 (10%)

Query  185  GIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSL  244
            G++W+        P   +R H       G + ++YA+H +S A       C +   +   
Sbjct  3    GVVWAEDAQNPSVPDPVIRVHQ--RKGNGTAMNLYAIH-LSDAVFSGTESCRMRGDF---  56

Query  245  IVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSG-----FDElllipillss  299
            IVPC  + + SD ++ A N   GS      L     VG  +G     F  +  +     +
Sbjct  57   IVPCRDKLD-SDIDLCAAN--FGSTQKVFSLTAIICVGIMAGVLLGLFGLVFYMHKNRQN  113

Query  300  sCCDFD--VVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTF-------  350
                ++    + N + +    Q+  G  A  +      +H       G + T        
Sbjct  114  FKTSYESHAATTNLISLGGKHQSSAGGAAALNSMDIFEAHARAEGGGGDDDTLSNDALCH  173

Query  351  -----KILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGR---------PTA---  393
                 K  +    ++  R+ +  L+F   LSK A+GE W+ Q+           PT    
Sbjct  174  RSGVLKRFVSDPTIITKRLAFSQLNFLRVLSKGANGEVWLGQFESRYVAIKCLLPTKRRE  233

Query  394  ------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK-NSDVL  446
                  F+EEI L + L HP IV F G+AW+SL NLS+V E++ +GDL+  L +  ++ L
Sbjct  234  VRALEQFSEEIRLASMLEHPRIVAFCGIAWHSLVNLSIVTEYMEKGDLESVLSQPMAESL  293

Query  447  SWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDL  505
            +W  +++ +A  +A+AL YLHS  P +IHRDLKS N+L+   L  KL DFG+SR    + 
Sbjct  294  TWQKEKLTLAKDIADALVYLHSLMPVVIHRDLKSKNVLMDNQLRAKLSDFGLSRETSTEE  353

Query  506  TMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQ  565
            TMT GVGT  W+APEVLEG RY EKADI+S+G+VLSE+DT  +PY    D    K+   Q
Sbjct  354  TMTNGVGTILWSAPEVLEGKRYDEKADIFSYGIVLSEIDTCALPYGFNKDKTRNKMKSMQ  413

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
            I+  V  G L P+F  DCP  +  +A +CL  DPS RP+A +++
Sbjct  414  IVHLVAEGKLLPTFRDDCPEELVELARSCLDLDPSKRPSAMQVV  457

>PHYRA_74873
Length=363

 Score = 228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 179/321 (56%), Gaps = 22/321 (7%)

Query  308  SPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYE  367
            S NY G  AH+  R    A  + G           SAGS    +I      L+  R+   
Sbjct  38   SANYNGNGAHQNRRPPAPALRNGG----RKDLGASSAGSRTDSEICF--PDLVKFRLDES  91

Query  368  SLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTASLIHPHIVKFI  413
             +    ++S  A G  W+  Y G+P A             F+ EIE  + L HP IV+FI
Sbjct  92   EVLLTRKVSSGAFGVVWLGHYHGQPVAVKRMIDGEDEAVSFSREIETMSRLSHPKIVRFI  151

Query  414  GVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAI  473
            G  W +  +L  V E++  GD++  L      LSW  ++I +AV +AE L Y+HSRSP I
Sbjct  152  GCTWTNKKDLGGVSEYMDGGDVRTLLETRKIELSWKKEKISIAVDIAEGLAYMHSRSPKI  211

Query  474  IHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGARYSEKAD  532
            IHRDLKS N+LL   +  KL DFG+SR    + T+TAGVGT  WTAPEV+ G  YSE+AD
Sbjct  212  IHRDLKSRNVLLKSSMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVMLGDNYSEQAD  271

Query  533  IYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSVDCPPRIQRIA  591
            +YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ DCP  I RIA
Sbjct  272  VYSFGVVLSELDTREIPFEEKSSKTGAAGAPDMAIVIKVAKGELRPSFAPDCPDVILRIA  331

Query  592  AACLSFDPSDRPTAQELIQWL  612
             ACL FDP+ RP ++ ++Q L
Sbjct  332  RACLQFDPALRPDSESVVQML  352

>PPTG_06851
Length=278

 Score = 225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 150/225 (67%), Gaps = 5/225 (2%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAG  450
            F  E++L ASL H  IV+F+GVAW++LS++  ++EF+  GDL+G L   H +   + +  
Sbjct  42   FLAEVKLMASLDHSRIVQFVGVAWDALSDVCAIIEFMDGGDLRGLLTSYHNHHHPVGFDC  101

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
            D++ +A+ VA AL YLHS SP +IHRDLKS NILLT DLD KL DFGVSR  +D TMTAG
Sbjct  102  DKVKIALHVAHALTYLHSLSPVVIHRDLKSRNILLTSDLDAKLTDFGVSRERVDHTMTAG  161

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQ  568
            VGT  W APEVL G RY +KADI+SFGVVLSELD   +PY    D DG+  ++    ILQ
Sbjct  162  VGTSLWMAPEVLMGERYDDKADIFSFGVVLSELDLQVLPYSHATDSDGSGHRMRDLAILQ  221

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +  G LR  FS D    +  +  AC+S  P DRPTA E++  L+
Sbjct  222  RMAMGKLRVQFSCDALASMVDLGNACVSLAPKDRPTAAEVLYRLQ  266

>PHYCA_122066
Length=344

 Score = 227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/286 (41%), Positives = 160/286 (56%), Gaps = 19/286 (7%)

Query  342  ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWI----------------  385
            E    ++     +    +   RI ++ L+F   LSK A GE W+                
Sbjct  17   EYCNESEILTDFMQDPEVFTKRIAFDELTFLRMLSKGAYGEVWLGQLETRHVAIKRLLPE  76

Query  386  -CQY-GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
             CQ+      FA EI+L  +L H +IV F+GV+WN L NL  V+E++  GDL   L KN 
Sbjct  77   KCQFTASLEQFAGEIQLMCTLQHRNIVSFVGVSWNRLQNLCAVVEYMEAGDLDDVLKKNR  136

Query  444  DVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-  502
            +  +W  ++I +A+ V E L YLH   P ++HRDLKS N+LL      KL DFGVSR   
Sbjct  137  EKFTWQREKISIAMDVTEGLVYLHCLRPVVVHRDLKSKNVLLNRKYHAKLSDFGVSRKTH  196

Query  503  MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLM  562
            ++ TMT+GVGT  WTAPE++EG +YSEKADIYS GVVLSE+DT   P+ D     G +L 
Sbjct  197  VNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCDAPFSDVTSDKGERLP  256

Query  563  PFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
              QI Q V  G +R +   DCPP + ++   C   DP  RP++ ++
Sbjct  257  GMQIAQLVRLGKIRVTLRKDCPPNLHKLVMDCTQLDPDARPSSMQV  302

>HYAP_09438
Length=357

 Score = 228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/272 (45%), Positives = 163/272 (60%), Gaps = 16/272 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  R+    +    ++S  A G  W+  Y G P A             FA EIE  + 
Sbjct  76   ELVKFRLEESEVLLTRKVSSGAFGVVWLGHYHGHPVAVKRMIDGEDEAISFAREIETMSR  135

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP IV+FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ +AEAL
Sbjct  136  LTHPKIVRFIGCTWTNKKDLGGVSEYMDGGDVRTLLEARKIELSWEREKISIAIDIAEAL  195

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             Y+HSRSP +IHRDLKS N+LL  ++  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  196  AYMHSRSPKVIHRDLKSRNVLLNSNMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVM  255

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSV  581
             G  YSE+AD+YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ 
Sbjct  256  LGDNYSEQADVYSFGVVLSELDTREIPFEEKSSRTGASGAPDMAIVIKVAKGELRPSFAP  315

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            DCP  I RIA ACL FDP+ RP ++  +Q L+
Sbjct  316  DCPDVILRIARACLQFDPALRPDSESAVQMLK  347

>PPTG_02066
Length=305

 Score = 226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 159/266 (60%), Gaps = 19/266 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIELT  401
            LL  RI +  +     LS+   GE W+  Y                     AFA EI+  
Sbjct  25   LLAARIEHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDALAFATEIKTM  84

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVA  460
            A L HP IV FIGV+W +   +  V EF+  GDL+  L  + +  L+WA  +  +A+ +A
Sbjct  85   ARLDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDIA  144

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
            +AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT  W AP
Sbjct  145  DALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRNRSFDETMTAGVGTARWIAP  204

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EV+ G  Y+E ADIYSFGVVLSELDT + P++D  + +G K+    ILQ V AG L+PSF
Sbjct  205  EVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSF  264

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTA  605
            S  CPP I ++A ACLSFDP+ RP+A
Sbjct  265  SDSCPPSIVKLARACLSFDPAQRPSA  290

>PHYCA_570506
Length=351

 Score = 227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/311 (42%), Positives = 179/311 (58%), Gaps = 27/311 (9%)

Query  327  TTSYGPSISSHQGDYESAGSNQTFKILLHSQHLL-GNRIPYESLSFQMELSKAASGEAWI  385
            T+S  P  S    D+E    ++T +  L +  L+  NR+ Y+ +     +++   G  +I
Sbjct  41   TSSRDPLYSLFNPDFED---HETMRERLAADPLIVTNRLNYDEVKLGRCINRGGFGLIFI  97

Query  386  CQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVL  427
              Y GR  A                 F  E+ L A L HP +V+FIG+AW+++ +LS V 
Sbjct  98   GTYRGRQVAVKKIRVNKETEGSQIEQFIREVTLMAILRHPRVVEFIGIAWDAVVDLSAVT  157

Query  428  EFVSEGDLQGFLH---KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
            E +  GDL   L    +N   L+W   +  +A+ + EAL YLHS SP +IHRDLKS N+L
Sbjct  158  ELMVRGDLMTVLQNCQENGIQLTWCDHKATIALHIVEALAYLHSLSPKVIHRDLKSKNVL  217

Query  485  LTEDLDPKLIDFGVSRGVMDL--TMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            L ++++ KL DFG+SR   D   +MTAG+GT +W APEVL G  Y EKAD++SFGVVLSE
Sbjct  218  LNDEMEAKLSDFGISRERFDTETSMTAGMGTSFWIAPEVLRGRDYDEKADVFSFGVVLSE  277

Query  543  LDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDR  602
            LDT   PY+   +  G+KL   +ILQ V AG LRP+FS  CP  I R+A  CL   P DR
Sbjct  278  LDTDDYPYWSAANSPGSKLQEGEILQLVAAGKLRPAFSRSCPASILRVADRCLQVRPEDR  337

Query  603  PTAQELIQWLE  613
            P A EL+Q  +
Sbjct  338  PNAVELVQMFQ  348

>PPTG_11181
Length=359

 Score = 227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 163/271 (60%), Gaps = 16/271 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  R+    +    ++S  A G  W+  Y G+P A             F+ EIE  + 
Sbjct  78   ELVKFRLDESEVLLTRKVSSGAFGVVWLGHYHGQPVAVKRMIDGEDEAISFSREIETMSR  137

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP IV+FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ +AEAL
Sbjct  138  LSHPKIVRFIGCTWTNKKDLGGVSEYMDGGDVRTLLETRKIELSWKKEKISIAIDIAEAL  197

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             Y+HSRSP IIHRDLKS N+LL   +  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  198  AYMHSRSPKIIHRDLKSRNVLLNSSMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVM  257

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSV  581
             G  YSE+AD+YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ 
Sbjct  258  LGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAGGAPDMAIVIKVAKGELRPSFAP  317

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            DCP  I RIA ACL FDP+ RP ++ ++Q L
Sbjct  318  DCPDVILRIARACLQFDPALRPDSESVVQML  348

>PITG_04611
Length=359

 Score = 226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 163/271 (60%), Gaps = 16/271 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  R+    +    ++S  A G  W+  Y G+P A             F+ EIE  + 
Sbjct  78   ELVKFRLDESEVLLTRKVSSGAFGVVWLGHYHGQPVAVKRMIDGEDEAVSFSREIETMSR  137

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP IV+FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ +AEAL
Sbjct  138  LSHPKIVRFIGCTWTNKKDLGGVSEYMDGGDVRTLLETRKIELSWKKEKISIAIDIAEAL  197

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             Y+HSRSP IIHRDLKS N+LL   +  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  198  AYMHSRSPKIIHRDLKSRNVLLNSSMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVM  257

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSV  581
             G  YSE+AD+YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ 
Sbjct  258  LGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAGGAPDMAIVIKVAKGELRPSFAP  317

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            DCP  I RIA ACL FDP+ RP ++ ++Q L
Sbjct  318  DCPDVILRIARACLQFDPALRPDSESVVQML  348

>PHYSO_292762
Length=358

 Score = 226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 163/270 (60%), Gaps = 16/270 (6%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTASL  404
            L+  R+    +    ++S  A G  W+  Y G+P A             F+ EIE  + L
Sbjct  78   LVKFRLDESEVLLTRKVSSGAFGVVWLGHYHGQPVAVKRMIDGEDEAVSFSREIETMSRL  137

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALE  464
             HP IV+FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ +AEAL 
Sbjct  138  SHPKIVRFIGCTWTNKKDLGGVSEYMDGGDVRTLLETRKIELSWKKEKISIAIDIAEALA  197

Query  465  YLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLE  523
            Y+HSRSP IIHRDLKS N+LL   +  KL DFG+SR    + T+TAGVGT  WTAPEV+ 
Sbjct  198  YMHSRSPKIIHRDLKSRNVLLNTSMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVML  257

Query  524  GARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSVD  582
            G  YSE+AD+YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ D
Sbjct  258  GDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAGGAPDMAIVIKVAKGELRPSFAPD  317

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            CP  I RIA ACL FDP+ RP ++ ++Q L
Sbjct  318  CPDVILRIARACLQFDPALRPDSESVVQML  347

>PHYCA_504366
Length=359

 Score = 226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 163/271 (60%), Gaps = 16/271 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  R+    +    ++S  A G  W+  Y G+P A             F+ EIE  + 
Sbjct  78   ELVKFRLDESEVLLTRKVSSGAFGVVWLGHYHGQPVAVKRMIDGEDEAVSFSREIETMSR  137

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP IV+FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ +AEAL
Sbjct  138  LSHPKIVRFIGCTWTNKKDLGGVSEYMDGGDVRTLLETRKIDLSWKKEKISIAIDIAEAL  197

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             Y+HSRSP IIHRDLKS N+LL   +  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  198  AYMHSRSPKIIHRDLKSRNVLLNSSMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVM  257

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSV  581
             G  YSE+AD+YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ 
Sbjct  258  LGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAGGAPDMAIVIKVAKGELRPSFAP  317

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            DCP  I RIA ACL FDP+ RP ++ ++Q L
Sbjct  318  DCPDVILRIARACLQFDPALRPDSESVVQML  348

>PPTG_09853
Length=761

 Score = 236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 172/308 (56%), Gaps = 20/308 (6%)

Query  320  ARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAA  379
             RR ++A T  G + +  +   E    ++     +    +   RI ++ L+F   LSK A
Sbjct  400  GRRSSMAGTWVGAA-AGGKTVSEYCDESEILTDFMQDPEIFTKRIAFDELTFLRMLSKGA  458

Query  380  SGEAWI-----------------CQY-GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLS  421
             GE W+                 CQ+      FA EI+L  +L H +IV F+GV+WN L 
Sbjct  459  YGEVWLGQLETRHVAIKRLLPEKCQFTASLEQFAGEIQLMCTLQHRNIVSFVGVSWNRLQ  518

Query  422  NLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSN  481
            NL  V+E++  GDL   L KN D  SW  ++I +A+ +AE L YLH   P ++HRDLKS 
Sbjct  519  NLCAVVEYMEAGDLDEVLKKNRDKFSWQREKISIAMDIAEGLVYLHCLRPVVVHRDLKSK  578

Query  482  NILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVL  540
            N+LL      KL DFGVSR   ++ TMT+GVGT  WTAPE++EG +YSEKADIYS GVVL
Sbjct  579  NVLLNRKFHAKLSDFGVSRKTHVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVL  638

Query  541  SELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPS  600
            SE+DT   P+ D     G +L   Q+ Q V  G +R S   DCPP ++++   C   DP 
Sbjct  639  SEMDTCEAPFADVTSDKGERLPGMQLAQLVRLGKIRVSLRKDCPPNLRKLVMECTQLDPD  698

Query  601  DRPTAQEL  608
             RP++ ++
Sbjct  699  ARPSSMQV  706

>PITG_14156
Length=747

 Score = 235 bits (599),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 171/307 (56%), Gaps = 20/307 (7%)

Query  321  RRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAAS  380
            RR ++A T  G + +  +   E    ++     +    +   RI ++ L+F   LSK A 
Sbjct  399  RRSSMAGTWVGAA-AGGKTVSEYCDESEVLTDFMQDPEIFTKRIAFDELTFLRMLSKGAY  457

Query  381  GEAWI-----------------CQY-GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSN  422
            GE W+                 CQ+      FA EI+L  +L H +IV F+GV+WN L N
Sbjct  458  GEVWLGQLETRHVAIKRLLPEKCQFTANLEQFAGEIQLMCTLQHRNIVSFVGVSWNQLQN  517

Query  423  LSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNN  482
            L  V+E++  GDL   L KN D  SW  ++I +A+ +AE L YLH   P ++HRDLKS N
Sbjct  518  LCAVVEYMEAGDLDEVLKKNRDKFSWQREKIQIAMDIAEGLVYLHCLRPVVVHRDLKSKN  577

Query  483  ILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLS  541
            +LL      KL DFGVSR   ++ TMT+GVGT  WTAPE++EG +YSEKADIYS GVVLS
Sbjct  578  VLLNRKYHAKLSDFGVSRKTHVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLS  637

Query  542  ELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSD  601
            E+DT   P+ D     G +L   Q+ Q V  G +R S   DCPP ++ +   C   DP  
Sbjct  638  EMDTCEAPFSDVTSDKGERLPGMQLAQLVRLGKIRVSLRKDCPPNLRNLVLDCTQLDPDA  697

Query  602  RPTAQEL  608
            RP++ ++
Sbjct  698  RPSSMQV  704

>PHYCA_119381
Length=291

 Score = 222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 171/279 (61%), Gaps = 21/279 (8%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------F  394
            L + + ++  RIP E +  +  +S+   GE ++  + G+  A                 F
Sbjct  6    LWNDEAIIAARIPREKVLLEQRISRGGYGEVFVGTFNGQRVAVKMLLPETRKRIQSVNEF  65

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIY  454
              E++L ASL HP IV+FIGVAW+SL++L +V +F+  GDL+  L++    L +   ++ 
Sbjct  66   LAEVKLMASLEHPRIVEFIGVAWDSLTDLCVVSQFMEGGDLRALLNRYPS-LGFDYTKVK  124

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTP  514
            +A+ VA AL Y+HS  P +IHRDLKS NILLTEDLD KL DFG SR  +D TMTAG+GT 
Sbjct  125  IALHVAHALTYMHSLEPPLIHRDLKSKNILLTEDLDAKLTDFGASRERVDRTMTAGIGTS  184

Query  515  YWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGT  574
             W APE++ G +Y EKAD++SFGVVLSE+D+  +PY ++  +  A      ILQ VM G 
Sbjct  185  LWMAPEMMTGEKYDEKADMFSFGVVLSEMDSNALPYANSGKNRQAS--DLAILQLVMQGN  242

Query  575  LRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            L   FS  CPP I  +  AC+S DP+ RPTA + +  L+
Sbjct  243  LCVEFSETCPPAIVELGLACVSKDPAARPTAAQALYQLQ  281

>PHYKE_2247
Length=526

 Score = 229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 184/332 (55%), Gaps = 37/332 (11%)

Query  301  CCDFDVVSPNYLGVVAHEQARR---GTVAT----TSYGPSISSHQGD-YESAGSNQTFKI  352
            CC   V     L ++A    RR   G  +T    T +G  I S   D Y + GS+     
Sbjct  190  CCGILV-----LAIIAFVLWRRKHGGQFSTKGGSTIFGTDIGSSLTDGYTTGGSS-----  239

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFA  395
            +     LL  RI +  +     LS+   GE W+  Y                     AFA
Sbjct  240  IWDDPDLLAARIEHRDVEAIKLLSRGGFGEVWLGLYMNENVAIKRLLGDKKTMSDALAFA  299

Query  396  EEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIY  454
             EI++ A L HP IV F+GV+W +   +  V EF+  GDL+  L  + +  L+WA  +  
Sbjct  300  TEIKVMARLEHPKIVHFVGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQ  359

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGT  513
            +A+ VA+AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT
Sbjct  360  IAIDVADALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGT  419

Query  514  PYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAG  573
              W APEV+ G  Y+E ADIYSFGVVLSELDT + P++D  + +G K+    ILQ V AG
Sbjct  420  ARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAG  479

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTA  605
             L+PSF+  CPP I ++A ACLSFDP+ RP+A
Sbjct  480  KLQPSFNESCPPSIVKLARACLSFDPAHRPSA  511

>PHYKE_5057
Length=357

 Score = 224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 162/271 (60%), Gaps = 16/271 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  R+    +    ++S  A G  W+  Y G+P A             F+ EIE  + 
Sbjct  76   ELVKFRLDESEVLLTRKVSSGAFGVVWLGHYHGQPVAVKRMIDGEDEAVSFSREIETMSK  135

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP IV FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ ++EAL
Sbjct  136  LSHPKIVHFIGCTWTNKKDLGGVSEYMDGGDVRTLLETRKIDLSWKKEKISIAIDISEAL  195

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             Y+HSRSP IIHRDLKS N+LL   +  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  196  AYMHSRSPKIIHRDLKSRNVLLNASMVAKLSDFGLSRNRTYEETLTAGVGTVRWTAPEVM  255

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSV  581
             G  YSE+AD+YSFGVVLSELDT  IP+ +     GA   P   I+ +V  G LRPSF+ 
Sbjct  256  LGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAAGAPDMAIVIKVAKGELRPSFAP  315

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            DCP  I RIA ACL FDP+ RP ++ ++Q L
Sbjct  316  DCPDVILRIARACLQFDPALRPDSESVVQML  346

>PHYRA_76010
Length=647

 Score = 231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/354 (40%), Positives = 191/354 (54%), Gaps = 48/354 (14%)

Query  305  DVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDY--------------ESAG-----  345
            DV +    G        R  VA+++ G    + +GD+               SAG     
Sbjct  264  DVAATCLTGTWQTAHNSRFCVASSTVGTPARTRRGDFSPSPVSSPSSYYLDRSAGDSINL  323

Query  346  ---SNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG---------RP--  391
               S  T + LL    ++ NRI Y+ +     LS+   G  ++ +Y          RP  
Sbjct  324  DESSRDTAEALLEDPIIVANRINYKDVKIGKCLSRGGFGLVFVGEYKGRQVAVKRIRPDR  383

Query  392  -------TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---K  441
                    AF +EI L A L HP IV+F+GVAW++L ++S V EF+  GDL+  L    +
Sbjct  384  NQDPKDVKAFIKEIALMAELHHPRIVEFVGVAWDNLRHISAVSEFMESGDLRHVLRGFKR  443

Query  442  NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG  501
              + LSW   +  +++ +AEA+EYLH+ SP +IHRDLKS N+LL   L+ KL DFGVSR 
Sbjct  444  QGNPLSWRNHKTSISLHIAEAMEYLHAHSPKVIHRDLKSKNVLLNMHLEAKLTDFGVSRT  503

Query  502  ---VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG  558
               V    MTAG+GT +W APEVL G  Y E+ADIYSFGVVLSE+DT   PY++  + D 
Sbjct  504  QYTVQTHAMTAGIGTSFWIAPEVLLGRDYDEQADIYSFGVVLSEIDTDDYPYWNDANRDA  563

Query  559  A--KLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQ  610
            A  KL    IL++V +GT RP FS  CP  I  +A  CL   P DRPTA E+++
Sbjct  564  ARGKLQEADILRQVASGTKRPQFSSTCPAGILLLAEKCLQKKPDDRPTASEIVE  617

>PPTG_02132
Length=665

 Score = 231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 172/287 (60%), Gaps = 35/287 (12%)

Query  363  RIPYESLSFQMELSKAASGEAWIC------------------QYGRPTAFAEEIELTASL  404
            R+P+  +S   ++S  A G+ W+                   Q      FA EI+L ASL
Sbjct  379  RVPFVDISLIRQISSGAYGDVWLGRLRGDIVAVKRLIRERRRQVHELEVFAAEIQLMASL  438

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-----------KNS-DVLSWAGDR  452
             HP+++   GVAWN+L NL +++E++  GDLQ  L             NS D  SWA  +
Sbjct  439  DHPNVLGLTGVAWNTLENLLLIMEYMERGDLQHVLQCQNGAKDASSGNNSIDEFSWASHK  498

Query  453  IYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVM-DLTMTAGV  511
              +A  ++  L+YLHS  P ++HRDLKS N+L+ +  + KL DFGVSR    D TMT+GV
Sbjct  499  AKIARDISCGLQYLHSLKPIVVHRDLKSKNVLIGDKYEAKLSDFGVSRMRRGDETMTSGV  558

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GT YW APEVL G +YSEKADIYS GVVL+ELDTG +P+FD    DG K+    IL  V+
Sbjct  559  GTAYWIAPEVLAGHKYSEKADIYSLGVVLAELDTGELPFFDARTSDGDKMEAIHILSLVV  618

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQ----ELIQWLEG  614
            +G L+PSF++DCP  ++++A  CL+ +P  RP+A+    EL + LEG
Sbjct  619  SGELQPSFTLDCPEDVRKLALVCLNPNPDSRPSAKMVLDELNRLLEG  665

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 96/202 (48%), Gaps = 23/202 (11%)

Query  95   LVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAY  154
            ++Q AV+WD G+  + +   V+++T     M+++ +S     +  CT   C  PN    Y
Sbjct  1    MLQQAVVWDMGYVAAADLGYVKVYTKCGMHMSELQLSRSAYRSAGCTEQRCSSPNGELFY  60

Query  155  SSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGV  214
             S +C+  Q+ NVS C       +G     G MW+ GG   + P   ++ H WT+   G+
Sbjct  61   QSMFCTDYQMGNVSLCAA----TNGITPVHGAMWADGGADDVIPVSEMQRHQWTD--AGI  114

Query  215  SYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVN---KPRGSEWV  271
            +Y++ A+H   S D  ++ +C V     S++VPC       DA  A  N    P   E V
Sbjct  115  NYTILAIHL--SGDINSYGKCVV----PSMVVPC----VLYDANTADENDWCSPEHGEIV  164

Query  272  TMWLKDE----FAVGDSSGFDE  289
              WL+ E      V +SSG+ +
Sbjct  165  PQWLELERTGGILVTESSGWQK  186

>PHYSO_289074
Length=532

 Score = 228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 173/307 (56%), Gaps = 20/307 (7%)

Query  319  QARRGTVATTSYGPSISSHQGDYESAGSNQTF-KILLHSQHLLGNRIPYESLSFQMELSK  377
            + + G   TT  G +I          G + TF   +     LL  RI +  +     LS+
Sbjct  211  RKKNGGQFTTKNGSTIFGTDIGSSLTGGDTTFGSSIWDDPDLLAARIDHRDVEAVKLLSR  270

Query  378  AASGEAWICQYGRPT-----------------AFAEEIELTASLIHPHIVKFIGVAWNSL  420
               GE W+  Y                     AFA EI+  A L HP IV+FIGV+W++ 
Sbjct  271  GGFGEVWLGLYMNENVAIKRLLGDKKTMQDALAFATEIKTMARLEHPKIVRFIGVSWSNA  330

Query  421  SNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLK  479
              +  V EF+  GDL+  L  + +  L+WA  +  +A+ +A+AL YLH+ +P +IHRDLK
Sbjct  331  LTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDIADALVYLHTLNPKLIHRDLK  390

Query  480  SNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGV  538
            S N+L+      KL DFG+SR    D TMTAGVGT  W APEV+ G  Y+E ADIYSFGV
Sbjct  391  SRNVLIDAQTGAKLSDFGISRNRSFDETMTAGVGTARWIAPEVILGGHYTEFADIYSFGV  450

Query  539  VLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFD  598
            VLSELDT + P++D  + +G K+    ILQ V AG L+PSF   CPP I ++A ACLSFD
Sbjct  451  VLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFEESCPPSIVKLARACLSFD  510

Query  599  PSDRPTA  605
            P+ RP+A
Sbjct  511  PAQRPSA  517

>PHYSO_515605
Length=773

 Score = 233 bits (595),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/291 (45%), Positives = 172/291 (59%), Gaps = 26/291 (9%)

Query  349  TFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG---------RP--------  391
            T + LL    ++ NRI Y+ +     LS+   G  ++ QY          RP        
Sbjct  453  TTEALLEDPIIVTNRINYKEVKLGKCLSRGGFGLVFVGQYKGRQVAVKKIRPDRSLDPKD  512

Query  392  -TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVLS  447
              AF +EI L A L HP IV+F+GVAW++L +LS V EF+  GDL+  L    +    LS
Sbjct  513  VKAFLKEIILMAELHHPRIVEFVGVAWDNLKHLSAVSEFMEGGDLRHVLRSFKRQGSPLS  572

Query  448  WAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG---VMD  504
            W   +  +A+ +AEA+ YLHS SP +IHRDLKS N+LL   L+ KL DFGVSR    V  
Sbjct  573  WRSHKAVIALHIAEAMHYLHSHSPKVIHRDLKSKNVLLNRHLEAKLTDFGVSRAQYSVQT  632

Query  505  LTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLM  562
              MTAG+GT +W APEVL G  Y+E+ADIYSFGVVLSE+DT   PY++  + DGA  KL 
Sbjct  633  HAMTAGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPYWNDANRDGARGKLE  692

Query  563  PFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               IL++V  G  RP FS +CP  I  +A +CL  DP DRPTA  ++  L+
Sbjct  693  EADILRQVAKGNKRPQFSPNCPAAIVLLAESCLQKDPKDRPTAANIVDTLQ  743

>PHYCA_541730
Length=318

 Score = 221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 159/270 (59%), Gaps = 15/270 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  R+    +    ++S  A G  W+  Y G+P A             F+ EIE  + 
Sbjct  39   ELVKFRMDKSEVLLTRKVSSGAFGVVWLGHYHGQPVAVKMMIDDEDEAVSFSREIETMSR  98

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L HP IV+FIG  W +  +L  V E++  GD++  L      LSW  ++I +A+ +AEAL
Sbjct  99   LSHPKIVRFIGCTWTNKKDLGGVSEYMERGDVRTLLETRKIDLSWKKEKISIAIDIAEAL  158

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             Y+HSRSP IIHRDLKS N+LL   +  KL DFG+ R    + T+T GVGT  WTAPEV+
Sbjct  159  AYMHSRSPKIIHRDLKSRNVLLNSSMVAKLSDFGLCRNRTYEETLTTGVGTVRWTAPEVM  218

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G  YSE+AD+YSFGVVLSELDT  IP+ +     G+      I+ +V  G LRPSF+ D
Sbjct  219  LGNDYSEQADVYSFGVVLSELDTREIPFEEKSSKTGSGTPDMAIVLKVAKGELRPSFAPD  278

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            CP  I RIA ACL FDP+ RP ++  +Q L
Sbjct  279  CPDVILRIAHACLQFDPALRPDSESAVQML  308

>PPTG_18534
Length=516

 Score = 227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 162/274 (59%), Gaps = 23/274 (8%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIELTASL  404
            RIP E +  +  +S+   GE +   +                       F  E++L ASL
Sbjct  233  RIPKEKIEVENLISQGGYGEVYKGTFNGLSVAVKMMLPAHRKSVAHVNNFLMEVKLIASL  292

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAVAVAE  461
             HP IV+F+GVAW+SLS++  V+EF+  GDL+G L   H     + +   ++ +A+ +A 
Sbjct  293  DHPRIVQFVGVAWDSLSDVCAVIEFMDGGDLRGLLTSYHNQHHPVGFNCAKVKIALHIAH  352

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEV  521
            AL YLHS SP +IHRDLKS NILLT DLD KL DFGVSR   D TMTAGVGT  W APEV
Sbjct  353  ALTYLHSLSPVVIHRDLKSRNILLTTDLDAKLTDFGVSRERADHTMTAGVGTSLWMAPEV  412

Query  522  LEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQEVMAGTLRPSF  579
            L G RY +KADI+SFGVVLSELD   +PY    + DG+  ++    ILQ +  G LR  F
Sbjct  413  LMGERYDDKADIFSFGVVLSELDLQVLPYAHATESDGSCHRMRDLAILQRMAMGKLRVQF  472

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            S +    +  +  AC+S DP DRPTA E++  L+
Sbjct  473  SRNALASMVDVGVACVSLDPKDRPTAAEVLYRLQ  506

>PHYRA_83716
Length=960

 Score = 236 bits (601),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/303 (40%), Positives = 168/303 (55%), Gaps = 25/303 (8%)

Query  325  VATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAW  384
            V  T  G ++S      E    ++     +    +   RI ++ L+F   LSK A GE W
Sbjct  425  VGATGGGKTVS------EYCNESEILTTFMQDPEVFTKRIAFDELTFLRMLSKGAYGEVW  478

Query  385  I-----------------CQY-GRPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMV  426
            +                 CQ+      FA EI+L  +L H ++V F+GV+WN L NL  V
Sbjct  479  LGQLETGHVAIKRLLPEKCQFTASLEQFAGEIQLMCTLQHRNVVSFVGVSWNRLQNLCAV  538

Query  427  LEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLT  486
            +E++  GDL   L KN D  SW  ++I +A+ VAE L YLH   P ++HRDLKS N+LL 
Sbjct  539  VEYMEAGDLDEVLKKNRDKFSWQREKISIAMDVAEGLVYLHCLRPVVVHRDLKSKNVLLN  598

Query  487  EDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDT  545
                 KL DFGVSR   ++ TMT+GVGT  WTAPE++EG +YSEKADIYS GVVLSE+DT
Sbjct  599  RKFHAKLSDFGVSRKTHVNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDT  658

Query  546  GRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTA  605
               P+ D     G +L   Q+ Q V  G +R S   DCPP ++++   C   DP  RP++
Sbjct  659  CEPPFSDVTSDKGERLPGMQLAQLVRLGKIRVSLRQDCPPNLRKLVMDCTQLDPDARPSS  718

Query  606  QEL  608
             ++
Sbjct  719  MQV  721

>SPRG_07855
Length=420

 Score = 224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 166/276 (60%), Gaps = 19/276 (7%)

Query  357  QHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEI  398
            Q LL  ++ Y  + +  +LSK A GE W+ QY GR  A                 F  EI
Sbjct  133  QDLLDAKVDYSMIQYTRKLSKGAFGEVWLGQYQGRYVAIKQILEERKTDAKEIECFVAEI  192

Query  399  ELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVA  458
            +L A+  HP+IV F+G++WN  +NL  + E++  GDL  +L K    L+W  D++ +A+ 
Sbjct  193  KLMANFKHPNIVDFLGLSWNQDANLCALTEYMKNGDLFVYLQKRKATLTWKKDKLAIALD  252

Query  459  VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWT  517
            +A+AL YLH+ +P +IHRDLKS N+LL E+   KL DFG+SR   ++ TMTAGVGT  W 
Sbjct  253  IAQALVYLHALTPKVIHRDLKSKNVLLDENCTAKLSDFGISRLRQLEETMTAGVGTALWA  312

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRP  577
            APEV    +Y+++AD+YS GVVLSELDT  IPY D       KL    +++ V     +P
Sbjct  313  APEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAVIKLVTQQKAKP  372

Query  578  SFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            +FS  CP  ++ +A  CL ++P +RP+A E++  L+
Sbjct  373  TFSPSCPDVVRDLAFRCLDYEPENRPSAAEVVVLLK  408

>PITG_05112
Length=699

 Score = 231 bits (588),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 133/325 (41%), Positives = 179/325 (55%), Gaps = 22/325 (7%)

Query  301  CCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTF-KILLHSQHL  359
            CC   V++   +  V + +   G   +T  G +I          G + TF   +     L
Sbjct  362  CCGVLVLA--IIAFVWYRKKHGGQFGSTKGGSTIFGTDIGSSLTGGDTTFGSSIWDDPDL  419

Query  360  LGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIELTA  402
            L  RI +  +     LS+   GE W+  Y                     AFA EI+  A
Sbjct  420  LAARIEHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDALAFATEIKTMA  479

Query  403  SLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVAE  461
             L HP IV FIGV+W +   +  V EF+  GDL+  L  + +  L+WA  +  +A+ +A+
Sbjct  480  RLDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDIAD  539

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPE  520
            AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT  W APE
Sbjct  540  ALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRNRSFDETMTAGVGTARWIAPE  599

Query  521  VLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFS  580
            V+ G  Y+E ADIYSFGVVLSELDT + P++D  + +G K+    ILQ V AG L+PSFS
Sbjct  600  VILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSFS  659

Query  581  VDCPPRIQRIAAACLSFDPSDRPTA  605
              CPP I ++A ACLSFDP+ RP+A
Sbjct  660  DSCPPSIVKLARACLSFDPAQRPSA  684

>PHYCA_543324
Length=296

 Score = 219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 165/278 (59%), Gaps = 23/278 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            ++  RIP + +  +  +S+ A GE +   Y                      AF  E+++
Sbjct  12   IVAARIPRDKVILESLVSRGAFGEVYKGTYNGQLIAAKILLVDTRRSIPHVNAFMAEVKM  71

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV---LSWAGDRIYMAV  457
            +A + HPHI KFIGVAW+SLS+L  V EF+  GDL+  L K  +    L +   ++ +A+
Sbjct  72   SAVMDHPHIAKFIGVAWDSLSDLCSVTEFMEGGDLKALLVKYEEEGHPLGFNYSKVKIAL  131

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P +IHRDLKS NILL+++L+ KL DFG+SR  +D TMTAGVGT  W 
Sbjct  132  HVAHALTYLHSLDPPVIHRDLKSRNILLSKELEAKLTDFGISRERIDATMTAGVGTSLWM  191

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVD--HDGAKLMPFQILQEVMAGTL  575
            APEV+ G RY +KAD++SFG+VLSELD   +PY    +  H G +L    ILQ V AG L
Sbjct  192  APEVMLGERYDDKADMFSFGIVLSELDQHTLPYSHAKNNSHSGQRLTDTAILQMVAAGKL  251

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            R  FS   P  + ++  AC+S DP  RP+A E +  L+
Sbjct  252  RVQFSQAAPESLVQLGIACVSTDPKQRPSAAEALYRLQ  289

>SDRG_17342
Length=630

 Score = 229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 169/284 (60%), Gaps = 26/284 (9%)

Query  346  SNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------  393
            ++ T       Q L+  R+PY ++ +   LSK A GE W+  + G+  A           
Sbjct  345  ASHTLNEFQRDQELIKKRVPYSAVVYSRLLSKGAFGEVWLGSFNGQVVAIKRLLDSKRTS  404

Query  394  ------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLS  447
                  FA+EI L AS  HP+IV+ IG AWNSL NL  V E+++ GDL G+LH +   L 
Sbjct  405  EAEIEGFADEIRLMASFTHPNIVRLIGFAWNSLQNLCAVTEYMANGDLYGYLHSHQQ-LQ  463

Query  448  WAGD-RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDL  505
            W  D +I +A+ +A AL YLHS SP IIHRDLKS N+L+ +D + +L DFG+SR    D 
Sbjct  464  WQRDEKIKIALGIAHALAYLHSLSPKIIHRDLKSKNVLIGDDGEAELSDFGISRKRTQDE  523

Query  506  TMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQ  565
            TMTAGVGT +WTAPEVL G  YSE ADIYSFGVVL E+DT   P     ++ G  L    
Sbjct  524  TMTAGVGTIFWTAPEVLLGEHYSEMADIYSFGVVLCEMDTHASPL---AEYKG--LPQAT  578

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
            ++  +    LRPS    CP  +Q +AA C++ DP DRP+A E++
Sbjct  579  MIHRITNEGLRPSLLPTCPEHVQSLAARCMARDPKDRPSAHEVV  622

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 86/204 (42%), Gaps = 20/204 (10%)

Query  62   SGDTSAAVSIKSVPT----AVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGIS-PNGDP--  114
            SG  ++ + + + PT    A+T RL+ + + +  LP L +LA+LWD GF  S P  D   
Sbjct  20   SGLNTSTIGVSATPTKPDAAITVRLNKVNLTWDDLPPLAKLAILWDMGFVPSNPTVDVNA  79

Query  115  -VQIWT-----TGDFTMADIAVSPDDI--TNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
              +I+T      G+ +MA IA+   D   +  + T   C           +  +G ++  
Sbjct  80   LSRIYTRCVGSVGE-SMASIALPKTDFLASQSDATTRPCNSATSGVYLRQENSNGGRLRP  138

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDAT-MTPHIRLRDHTWTEPTTGVSYSVYAVHTVS  225
             +RC          KD    MW+  G      P+  L+ H W +      + ++A+HT  
Sbjct  139  YTRCATANITMGNIKDSHSSMWAQDGQGLGAAPYPNLQRHAWNDKEF---WLIFAIHTQE  195

Query  226  SADDPTWNQCPVNNGYSSLIVPCH  249
               +P W  CP     +    PC 
Sbjct  196  LVSEPQWGTCPDKTTPAGATFPCQ  219

>PHYSO_260691
Length=486

 Score = 225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/298 (43%), Positives = 172/298 (58%), Gaps = 27/298 (9%)

Query  340  DYESAGSNQTFKILLHSQHLL-GNRIPYESLSFQMELSKAASGEAWICQY-GRPTA----  393
            D+E+   ++T ++ L +  ++  NRI Y  +     +S+   G  ++  Y GR  A    
Sbjct  167  DFEA---HETMRVRLAADPIIVTNRIDYGEVKLGRCISRGGFGLVYVGTYRGRRVAVKKI  223

Query  394  -------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH  440
                         F  EI L A L HP IV+FIGVAW +L +LS V E +  GDL   L 
Sbjct  224  RVNRDAEASQIEQFIREITLMAMLRHPRIVEFIGVAWEALVDLSAVTELMERGDLSTVLR  283

Query  441  KNSDV---LSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFG  497
               +    L+W+  +  +A+ + EAL YLHS SP +IHRDLKS N+LL E++  KL DFG
Sbjct  284  NCREKGYRLTWSDHKATIALHIVEALAYLHSLSPKVIHRDLKSKNVLLNEEMQAKLSDFG  343

Query  498  VSRGVMDLT--MTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVD  555
            +SR   D+   MTAG+GT +W APEVL G  Y E+AD++SFGVVLSELDT   PY+D  +
Sbjct  344  ISREHHDVETHMTAGMGTSFWIAPEVLNGQDYDERADVFSFGVVLSELDTDDYPYWDAAN  403

Query  556  HDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               +KL   +ILQ V  G LRPSFS  CP  I  +A  CL   P DRP+A EL++  +
Sbjct  404  QPRSKLQEGEILQLVATGQLRPSFSSSCPAAILEVATRCLQVRPEDRPSATELVRIFQ  461

>H257_07477
Length=626

 Score = 228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 178/302 (59%), Gaps = 32/302 (11%)

Query  333  SISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT  392
            S + HQ    ++     F+I     +L   R+PY S+     +SK A GE W+      T
Sbjct  331  SAAQHQPIQTNSSKLNNFQI---DPYLCSRRLPYSSVVQTRMVSKGAFGEVWVGSLDGVT  387

Query  393  ------------------AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGD  434
                               FAEEI L ASL HP+IV FIG AWN+L NL  V+E++  GD
Sbjct  388  VAIKKVLDAKRNDVEELECFAEEIRLLASLSHPNIVTFIGFAWNTLQNLCCVVEYMQHGD  447

Query  435  LQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSP-AIIHRDLKSNNILLTEDLDPKL  493
            L  +L  + +   W  D++ +AV +A AL YLH+ +P  IIHRDLK+ N+L+++ LD KL
Sbjct  448  LGSYLAAHQEA-KW-DDKLVLAVGIARALAYLHALTPNKIIHRDLKAKNVLVSDQLDAKL  505

Query  494  IDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD  552
             DFG+S+    D TMTAGVGT YWTAPEVL G RYSE AD+YSFG VL+ELDT  IPY +
Sbjct  506  SDFGISKERTTDETMTAGVGTTYWTAPEVLSGHRYSELADVYSFGCVLNELDTHNIPYAN  565

Query  553  TVDHDGAKLMP-FQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQW  611
                   K +P   I+Q V    LRP+F+  CP  I+ +A  CL+ +P DRPTA E+++ 
Sbjct  566  M------KGVPALTIVQRVTTMGLRPTFNDTCPKLIKDLAERCLATNPRDRPTAIEIVRL  619

Query  612  LE  613
            +E
Sbjct  620  IE  621

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 92/211 (44%), Gaps = 26/211 (12%)

Query  58   TRHRSGDTSAAVSIKSV----PTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGD  113
            +R R  + +   S+ +V    P +V +RL +L + +  L  L Q A+LWD GF    +G 
Sbjct  18   SRFRLLEAANLTSVPAVRSPAPASVVERLTALTLKWEDLSSLAQRALLWDMGFVRLNDGS  77

Query  114  PV--QIWTTGDF--------TMADIAVSPDDI--TNVNCTMLECPQPNDTPAYSSQYCSG  161
                Q++T            TM ++ VS D    T+ + T+++C   + +  Y  Q  S 
Sbjct  78   TTLQQVYTRCSLGTSTPAGATMENLMVSKDAFLATDQSTTVIKC--SSGSALYVRQNISN  135

Query  162  TQILNV-SRCIVDTFEDSGAKDFLGIMWSTGG-DATMTPHIRLRDHTWTEPTTGVSYSVY  219
               L+V + C V     S  K     MW+  G   T  P   +  H W   T G  + ++
Sbjct  136  GVNLDVAANCAVAPTNPS--KSSHSSMWAQDGLPPTDVPFPVIMRHQWNS-TDGPPFLIF  192

Query  220  AVHTVSSADDPT--WNQCPVNNGYSSLIVPC  248
            AVHTV    D    W  CP      SL++PC
Sbjct  193  AVHTVPEKYDGEWPWGTCPTKQP-GSLVLPC  222

>PHYSO_341117
Length=900

 Score = 233 bits (595),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/286 (41%), Positives = 164/286 (57%), Gaps = 19/286 (7%)

Query  342  ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWI----------------  385
            E    ++T    +    +   RI ++ L+F   LSK A GE W+                
Sbjct  434  EYCNESETLTEFMQDPEVFTKRIAFDELTFLRMLSKGAYGEVWLGQLETRHVAIKRLLPE  493

Query  386  -CQYGRP-TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
             CQ+      FA EI+L  +L H +IV F+GV+WN L NL  V+E++  GDL+  L KN 
Sbjct  494  KCQFTTSLEQFAGEIQLMCTLQHRNIVSFVGVSWNRLQNLCAVVEYMDAGDLEEVLKKNR  553

Query  444  DVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-  502
            +  +W  ++I +A+ +AE L YLH   P ++HRDLKS N+LL      KL DFGVSR   
Sbjct  554  EKFTWQREKISIAMDIAEGLVYLHCLRPIVVHRDLKSKNVLLNRKFHAKLSDFGVSRKTH  613

Query  503  MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLM  562
            ++ TMT+GVGT  WTAPE++EG +YSEKADIYS GVVLSE+DT   P+ D     G +L 
Sbjct  614  VNETMTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEQPFSDVTSDKGERLP  673

Query  563  PFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
              Q+ Q V  G +R S   DCPP ++++   C   DP  RP++ ++
Sbjct  674  GMQLAQLVRLGKIRVSLREDCPPNLRKLVMDCTQLDPDARPSSMQV  719

>PHYCA_504276
Length=696

 Score = 230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 161/266 (61%), Gaps = 19/266 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIELT  401
            LL  RI +  +     LS+   GE W+  Y                     AFA EI++ 
Sbjct  416  LLAARIEHRDVEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDALAFATEIKVM  475

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVA  460
            A L HP IV+FIGV+W +   +  V EF+  GDL+  L  + +  L+WA  +  +A+ +A
Sbjct  476  ARLDHPKIVRFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDIA  535

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
            +AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT  W AP
Sbjct  536  DALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTARWIAP  595

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EV+ G  Y+E ADIYSFGVVLSELDT + P++D  + +G K+    ILQ V AG L+PSF
Sbjct  596  EVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSF  655

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTA  605
            +  CPP I ++A ACLSFDP+ RP+A
Sbjct  656  TDSCPPSIVKLARACLSFDPAQRPSA  681

>PHYCA_10859
Length=731

 Score = 229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 193/347 (56%), Gaps = 41/347 (12%)

Query  305  DVVS--PNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSNQTFKI---------L  353
            DVVS  P     +AH    +  VA  +    +SS    Y +   N+T  +         L
Sbjct  361  DVVSTCPGGTWQIAHNS--KFCVANETVVIPVSSPSTYYLARSGNETINLGSEKSSAEEL  418

Query  354  LHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG---------RP---------TAFA  395
            L    ++ NRI Y+ +     LSK   G  ++ +Y          RP          AF 
Sbjct  419  LEDPIIVTNRIDYKEIKLGKCLSKGGFGLVFVGEYKGRQVAVKKIRPDRSHDPRDVKAFL  478

Query  396  EEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQ----GFLHKNSDVLSWAGD  451
            +EI L   L HP IV+FIGVAW++L ++S V EF+  GDL+     F H+ S  LSW   
Sbjct  479  KEIILMGELHHPRIVEFIGVAWDNLKHISAVSEFMPGGDLRHVLRSFKHQGSP-LSWRNH  537

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR---GVMDLTMT  508
            ++ +++ +AEA+EYLHS SP +IHRDLKS N+LL   L+ KL DFGVSR    V    MT
Sbjct  538  KLTISLHIAEAMEYLHSHSPKVIHRDLKSKNVLLNMHLEAKLTDFGVSRTQYTVQTHAMT  597

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG--AKLMPFQI  566
            AG+GT +W APEVL G  Y+E+ADIYSFGVVLSE+DT   P+++  + D    KL    I
Sbjct  598  AGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPFWNDANRDKPRGKLQEADI  657

Query  567  LQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            L++V AG  RP FS +CP  I  +A +CL   P DRPTA  ++Q L+
Sbjct  658  LRQVAAGNKRPQFSANCPAGIMLLAESCLEKKPEDRPTAAAIVQTLQ  704

>SDRG_05329
Length=375

 Score = 220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/265 (45%), Positives = 158/265 (60%), Gaps = 15/265 (6%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTASLIHPH  408
            RI +  +     +S+ A G  W+  Y G+P A             F++EI+    L HP 
Sbjct  99   RIDHNEVLLTRAISRGAFGVVWLGHYHGQPVAIKRMIEGDEEAVLFSKEIQTMGRLSHPK  158

Query  409  IVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHS  468
            IV+FIG  W S  +LS + EF+  GD++  L      L+W   +I +A+  AEAL YLHS
Sbjct  159  IVEFIGSTWTSGYDLSAITEFMDGGDVRTLLENTKINLTWKKQKIGIAIDTAEALAYLHS  218

Query  469  RSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGARY  527
             +P +IHRDLKS N+LLT ++  KL DFG+SR    + T+TAGVGT  WTAPEV+ G  Y
Sbjct  219  LTPKLIHRDLKSKNVLLTSNMVAKLSDFGLSRNRSYEETLTAGVGTVRWTAPEVMLGDIY  278

Query  528  SEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRI  587
            SE AD+YSFGVVLSELDT  IP+ D             I+ +V  G LRP+FS  CPP I
Sbjct  279  SEMADVYSFGVVLSELDTREIPFEDQKSSKAGGAPDMSIVVKVARGELRPTFSPTCPPSI  338

Query  588  QRIAAACLSFDPSDRPTAQELIQWL  612
             ++A ACL FDP+ RP++  L++ L
Sbjct  339  LQVAKACLQFDPALRPSSARLVEML  363

>PPTG_06854
Length=486

 Score = 223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 163/270 (60%), Gaps = 23/270 (9%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASL  404
            RIP + +  +  +S+   GE +   + G   A                 F  E++L ASL
Sbjct  201  RIPKDKIIMENLISQGGYGEVYKGTFNGLSVAVKRMLPAHRKSVAHVNNFLAEVKLMASL  260

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAVAVAE  461
             H  IV+F+GVAW++LS++  V+EF+  GDL+G L   H +   + +  D++ +A+ VA 
Sbjct  261  EHSCIVEFVGVAWDALSDVCAVIEFMDGGDLRGLLTSYHNHHHPVGFDCDKVKIALHVAH  320

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEV  521
            AL YLHS SP +IHRDLKS NILLT DLD KL DFGVSR  +D TMTAGVGT  W APEV
Sbjct  321  ALTYLHSLSPVVIHRDLKSRNILLTSDLDAKLTDFGVSRERVDHTMTAGVGTSLWMAPEV  380

Query  522  LEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQEVMAGTLRPSF  579
            L G RY +KADI+SFGVVLSELD   +PY    D DG+  ++    ILQ +  G LR  F
Sbjct  381  LMGERYDDKADIFSFGVVLSELDLQVLPYSHATDSDGSGHRMRDLAILQRMAMGKLRVQF  440

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
            S D    +  +  AC+S  P DRPTA E++
Sbjct  441  SCDALASMVDLGNACVSLAPKDRPTAAEVL  470

>H310_10437
Length=384

 Score = 220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 163/271 (60%), Gaps = 15/271 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             LL  RI +  +     +S+ A G  W+  Y G+P A             F++EI++   
Sbjct  103  ELLPFRIDHNEVLLTRAISRGAFGVVWLGHYHGQPVAIKRMIEGDDQAVLFSKEIQIMGR  162

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L  P+IV+F+G  W S  +LS V EF+  GD++  L      LSW   ++ +A+ VA+AL
Sbjct  163  LKSPNIVEFLGATWTSGMDLSAVTEFMDGGDVRTLLENPKIQLSWPQQKVNIAIDVAQAL  222

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             YLH  +P +IHRDLKS N+LLT ++  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  223  AYLHGLTPKLIHRDLKSKNVLLTSNMIAKLSDFGLSRNRSYEETLTAGVGTVRWTAPEVM  282

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G  YSE +D+YSFGVVLSELDT  IP+ D             I+ +V  G LRP+FS D
Sbjct  283  LGDIYSEISDVYSFGVVLSELDTREIPFDDQKSSKAGGAPDMSIVVKVARGELRPTFSPD  342

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            CPP I +IA ACL FDP+ RPT+  +++ L+
Sbjct  343  CPPSILQIAKACLQFDPALRPTSARVVEMLQ  373

>PHYCA_505050
Length=382

 Score = 220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 176/306 (58%), Gaps = 30/306 (10%)

Query  325  VATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAW  384
            VATT    ++S+ Q   +S+      +  +    ++  RI +  L F   L+K  SGE W
Sbjct  24   VATTRAEITLSNDQLCRKSS----ILRAFVADPAIVTKRISFAQLHFLRLLAKGGSGEVW  79

Query  385  ICQYGR---------PTA---------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMV  426
            + QY           PT          FAEEI + + L HP IV F GVAW SL +L  V
Sbjct  80   LGQYEARYVAMKCLLPTKREDPEALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAV  139

Query  427  LEFVSEGDLQGFLHK--NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
             E+++ GDL+  L        LSW+ +++ ++  + EAL YLHS  P +IHRDLKS N+L
Sbjct  140  TEYMARGDLESLLANPVAQKELSWSREKLMLSSDIVEALVYLHSLVPVVIHRDLKSKNVL  199

Query  485  LTEDLDPKLIDFGVSR--GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            L   L  KL DFG+SR   V D TMT G+GT  W+APE+LEG RY EK+D++SFGVVLSE
Sbjct  200  LDRRLRAKLSDFGLSRERSVED-TMTNGIGTILWSAPEILEGKRYDEKSDLFSFGVVLSE  258

Query  543  LDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDR  602
            +DT  +PY  +     AK+   QI+  V  G L P+F  DCPP I+ +A  CL+ DP+ R
Sbjct  259  IDTCALPYGFS---RHAKMRSMQIVHLVSEGKLLPNFRDDCPPAIRDLAQRCLNLDPAAR  315

Query  603  PTAQEL  608
            PTA E+
Sbjct  316  PTAMEV  321

>PHALS_00921
Length=631

 Score = 226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/286 (41%), Positives = 160/286 (56%), Gaps = 19/286 (7%)

Query  342  ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA--------  393
            E    ++     L    +L   I ++ L+F   LSK A GE W+ Q+             
Sbjct  309  EYCDESEELTTFLQHPEVLSKCIAFDQLTFLSLLSKGAYGEVWLGQFNTQRVAIKRLLPE  368

Query  394  ----------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
                      FA EI+L   L H +IV F G++WN L NL  VLE++  GDL   L +N 
Sbjct  369  KCQLTSSLEQFAGEIQLMCMLQHRNIVSFEGLSWNRLQNLCAVLEYMEAGDLDAVLKQNR  428

Query  444  DVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-  502
            D  SW  ++I +A+ +AE L YLH   P I+HRDLKS N+LL E +  KL DFGVSR   
Sbjct  429  DCFSWQQEKISIAMDIAEGLVYLHCLRPVIVHRDLKSKNVLLNEKMHAKLSDFGVSRKTF  488

Query  503  MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLM  562
            ++ TMT+GVGT  WTAPE++EG +YSEKAD+YS GVVLSE+DT   P+ D +   G +L 
Sbjct  489  INETMTSGVGTLLWTAPEIIEGKKYSEKADVYSLGVVLSEMDTCESPFSDVISEKGGRLP  548

Query  563  PFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
              Q+   V  G +R S   DCP  ++++   C   DP  RP++ ++
Sbjct  549  GMQLAHFVRLGNIRVSLRDDCPTILRKLIMDCTQLDPDARPSSMQV  594

>PHYRA_84546
Length=406

 Score = 220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/290 (38%), Positives = 165/290 (57%), Gaps = 19/290 (7%)

Query  344  AGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA----------  393
            +G N    IL   + L   RIPYE +  +  L K+ + E  + +Y               
Sbjct  117  SGPNYISTILQEDRRLARKRIPYEEVKLRARLGKSQTREVRLGEYENQQVVIKRLLKTKR  176

Query  394  --------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV  445
                    F  +I+L ++L HP+IV  +GVAW S++++ +V+E +  GDL+ +L +N + 
Sbjct  177  SQILHIHEFVYQIQLRSTLDHPNIVALVGVAWTSMADVMVVVEHLPRGDLESYLDRNGEY  236

Query  446  LSWAGDRIYMAVAVAEALEYLHSRSPA-IIHRDLKSNNILLTEDLDPKLIDFGVSRGVMD  504
            +SW   +  +A+ +A AL YLH + P+ ++HRDL++ N+LLTE +  KL  F       D
Sbjct  237  ISWEHSKYRLAIDIARALAYLHRQQPSPVVHRDLRATNVLLTEAMQAKLTGFDSCCLNKD  296

Query  505  LTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPF  564
                   G P+W+APEVL G + + K+D+Y+FGV+L+ELDT + P+ D     G  L P 
Sbjct  297  NHCCHATGAPFWSAPEVLRGEQLTTKSDVYAFGVLLTELDTAKAPFHDAWSPIGTTLKPI  356

Query  565  QILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            Q+L EVM  TLRPSFS DCP R++ I   C   DPS RPTA +L++ LE 
Sbjct  357  QVLNEVMQRTLRPSFSPDCPRRVRVIGVGCYQQDPSRRPTADQLLRLLEA  406

>SPRG_14253
Length=610

 Score = 225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 163/271 (60%), Gaps = 26/271 (10%)

Query  362  NRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIELTAS  403
             R+PY S+     LSK A GE W+  +                      AFA+EI L AS
Sbjct  342  KRLPYSSVVCSRLLSKGAFGEVWLGSFNGQVVAVKRLLDSKRTSEAEIEAFADEIRLMAS  401

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
              HP+IV+F+G AW+SL NL  V E++ +GDL  +L  +  +     ++I +A+ +A AL
Sbjct  402  FTHPNIVRFVGFAWDSLQNLCAVTEYMPQGDLHTYLQSHLQLQWRRHEKIKIALGIAHAL  461

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVL  522
             YLHS SPAIIHRDLKS N+L+    + KL DFG+SR   +D TMTAGVGT +WTAPEVL
Sbjct  462  AYLHSLSPAIIHRDLKSKNVLMAAGCEAKLSDFGISRERTLDETMTAGVGTIFWTAPEVL  521

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLRPSFSV  581
             G  YSE ADIYSFGVVL E+DT   PY +       K +P   ++  +    LRP+FS 
Sbjct  522  LGEHYSEMADIYSFGVVLCEIDTREAPYPNM------KAVPQVTMVHRITNEGLRPAFSE  575

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
             CP ++Q IA+ CL  DP+ RP+A+EL+  L
Sbjct  576  ACPAQLQTIASRCLDADPTMRPSARELVTIL  606

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 82/190 (43%), Gaps = 17/190 (9%)

Query  72   KSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF---GISPNGDPVQIWTT-----GDF  123
            ++ P +V  RL +L + +  L    + A+LWD G      + N    Q++T      G  
Sbjct  32   ETAPPSVASRLAALSLNWADLGNADKQALLWDMGLVRTTTAENNQVTQVYTKCSDSGGGD  91

Query  124  TMADIAVSPDDI--TNVNCTMLECPQPNDTPAYSSQYCS-GTQILNVSRCIVDTFEDSGA  180
            +MA IA+S      +  + T+  C        Y  Q  S G ++   ++C++     +G 
Sbjct  92   SMATIALSKAAFLQSQADATVRTCTSSTINTTYVRQENSNGGKLAPYTKCMIANV--TGV  149

Query  181  KDFLGIMWSTGGDATMT-PHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNN  239
             D    MW+  G    T P   +  H W+      S+ +YA+HT ++ D+  +  C  ++
Sbjct  150  ADSHSSMWAQDGQGLSTYPVPNIMRHAWSASD---SWLIYAIHTQTAGDEIGFGFCGPSS  206

Query  240  GYSSLIVPCH  249
                L +PC 
Sbjct  207  TPGGLTIPCQ  216

>SPRG_03506
Length=379

 Score = 219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 158/265 (60%), Gaps = 15/265 (6%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTASLIHPH  408
            RI +  +     +S+ A G  W+  Y G+P A             F++EI+    L HP 
Sbjct  103  RIDHNEVLLTRAISRGAFGVVWLGHYHGQPVAIKRMIEGDEEAVLFSKEIQTMGRLSHPK  162

Query  409  IVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHS  468
            IV+FIG  W S  +LS + EF+  GD++  L      L+W   +I +A+  AEAL YLHS
Sbjct  163  IVEFIGATWTSGYDLSAITEFMDGGDVRTLLENTKINLTWKKQKINIAIDTAEALAYLHS  222

Query  469  RSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVLEGARY  527
             +P +IHRDLKS N+LLT ++  KL DFG+SR    + T+TAGVGT  WTAPEV+ G  Y
Sbjct  223  LTPKLIHRDLKSKNVLLTSNMVAKLSDFGLSRNRSYEETLTAGVGTVRWTAPEVMLGDIY  282

Query  528  SEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRI  587
            SE AD+YSFGVVLSELDT  IP+ D             I+ +V  G LRP+FS  CPP I
Sbjct  283  SEMADVYSFGVVLSELDTREIPFEDQKSSKAGGAPDMSIVVKVARGELRPTFSPTCPPCI  342

Query  588  QRIAAACLSFDPSDRPTAQELIQWL  612
             +++ ACL FDP+ RP++  L++ L
Sbjct  343  LQVSKACLQFDPALRPSSARLVEML  367

>PITG_17832
Length=767

 Score = 228 bits (581),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/293 (43%), Positives = 174/293 (59%), Gaps = 26/293 (9%)

Query  347  NQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG---------RP------  391
            N T + LL    ++ NRI Y+ +     LSK   G  ++ +Y          RP      
Sbjct  448  NSTTEALLEDPIIVTNRINYKDIKLDKCLSKGGFGLVFVGEYRGRQVAVKKIRPDRSQDP  507

Query  392  ---TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDV  445
                AF +EI L A L HP IV+FIGVAW++L ++S V EF+  GDL+  L    +    
Sbjct  508  KDVKAFLKEIILMAELHHPRIVEFIGVAWDNLKHISAVTEFMESGDLRHVLRSCKRQGAR  567

Query  446  LSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG---V  502
            LSW   +  +++ +AEA+++LHS +P +IHRDLKS N+LL   L+ KL DFGVSR    V
Sbjct  568  LSWRNHKTTISLHIAEAMQHLHSHNPKVIHRDLKSKNVLLNMHLEAKLTDFGVSRTQYTV  627

Query  503  MDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG--AK  560
                MTAG+GT +W APEVL G  Y+E+ADIYSFGVVLSE+DT   P+++  + DG   K
Sbjct  628  QTHPMTAGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPFWNDANRDGPRGK  687

Query  561  LMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            L    IL++V  G  RP FS +CP  I  +A +CL  +P DRPTA  +++ L+
Sbjct  688  LQEADILRQVATGNKRPHFSTNCPAGIMLLAESCLQENPDDRPTATAVVETLQ  740

>PHYRA_78868
Length=905

 Score = 229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 171/285 (60%), Gaps = 34/285 (12%)

Query  362  NRIPYESLSFQMELSKAASGEAWIC------------------QYGRPTAFAEEIELTAS  403
             R+P+  +S   +++  A GE W+                   Q      FA EI+L AS
Sbjct  510  RRVPFVDVSLVRQITTGAYGEVWLGRMRGEIVAVKRLTRDRRRQLHELEVFAAEIQLMAS  569

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV---------------LSW  448
              H +++  +GVAWN+L N+ +++E++  GDLQ  L  ++D                 SW
Sbjct  570  FSHLNVLGLLGVAWNTLENMLLIMEYMERGDLQHVLQYHTDQAAQAKGSVGNTSVEEFSW  629

Query  449  AGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVM-DLTM  507
            A  +  ++  VA  L+YLHSR P ++HRDLKS N+L+  + + KL DFG+SR    + TM
Sbjct  630  ASHKARISRDVACGLKYLHSRQPIVVHRDLKSKNVLIDSNYEAKLCDFGISRLRRGEETM  689

Query  508  TAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQIL  567
            T+GVGT YWTAPEVL G +YSEKAD+YS GVVL+ELDTG +P++D    DG K+    IL
Sbjct  690  TSGVGTAYWTAPEVLAGHKYSEKADVYSLGVVLTELDTGELPFYDARTSDGDKMEAIHIL  749

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
              V++G L+PSF++DCP  ++++A ACL+  P  RP+A+E++  L
Sbjct  750  SLVVSGELQPSFTLDCPDDVRKLALACLNPKPERRPSAKEILNEL  794

 Score = 120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/249 (33%), Positives = 126/249 (51%), Gaps = 20/249 (8%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRL-DSLKIAFTHLPGLVQLAVLWDTG  105
            GT+SD A+Q Y R+ +GD +  ++  S  T V D + D   + F  LP ++Q AV+WD G
Sbjct  63   GTHSDYAQQFYRRYLAGDEAETITDTSDLTEVVDYVSDEFGLDFAELPAMLQQAVVWDMG  122

Query  106  FGISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQIL  165
            +  + +   V+++T     M+++ +S     +V CT   C  PN    Y S YCSG Q+ 
Sbjct  123  YVAAADLGYVKVYTKCGMRMSELQISRSAFRSVGCTAQRCASPNGELFYQSLYCSGYQMG  182

Query  166  NVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVS  225
            NVS C       +G     G MWS GG   + P   ++ H WT+   G  Y++ A+H   
Sbjct  183  NVSLCAA----TNGITPVHGSMWSDGGTDDVVPVSEMQRHEWTD--AGTDYTIMAIHL--  234

Query  226  SADDP-TWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDE----FA  280
             +DDP ++ +C +     S+IVPC      +  E+   +  RG E V  WL+ E      
Sbjct  235  -SDDPNSYGKCVM----PSMIVPCVAYDASTADELDWCSPERG-EVVPQWLELEKTGGVI  288

Query  281  VGDSSGFDE  289
            V +SSG+ +
Sbjct  289  VTESSGWQK  297

>PHYSO_516459
Length=516

 Score = 222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 169/286 (59%), Gaps = 24/286 (8%)

Query  352  ILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------  393
            + L+   ++ NR+ ++ L     +SK   G  ++ +Y GR  A                 
Sbjct  201  VFLNDPVIVTNRLDHKLLKMGKCISKGGFGLVFMGEYKGRRVAIKKIRPDRSASAAEIEQ  260

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAG  450
            F +EI + A L HP IV+F+GVAW++L +LS V EF+  GDL+  LH      + LSW  
Sbjct  261  FLKEIIMMAVLYHPRIVEFVGVAWDNLRHLSAVTEFMDNGDLRDVLHGYKLKGERLSWES  320

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG--VMDLTMT  508
             +  +A+ +AEAL YLH+  P IIHRDLKS N+LL   L+ KL DFG++R   +++  MT
Sbjct  321  HKATIALHIAEALSYLHALKPKIIHRDLKSKNVLLNMYLEAKLSDFGIARMRYLVETHMT  380

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF-DTVDHDGAKLMPFQIL  567
            AGVGT +W APEVL G  Y E ADIYSFGVVLSE+DT   P++ D    +  K+   +IL
Sbjct  381  AGVGTSFWIAPEVLLGRDYDEAADIYSFGVVLSEIDTDDYPFWNDENKSNRGKIQEAEIL  440

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              V  G LRPSFS DCP  I  +A  CL  DP DRPTA E++  LE
Sbjct  441  SLVAEGKLRPSFSSDCPKAILDLADCCLQKDPGDRPTAAEIVVILE  486

>PPTG_18615
Length=605

 Score = 224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/299 (42%), Positives = 177/299 (59%), Gaps = 31/299 (10%)

Query  338  QGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRP------  391
            +G+ ESA        L  ++ +LG R+P E +  +  +S+   GE ++  Y R       
Sbjct  307  EGEEESA--------LWRNEVILGARVPREKVVAKRLISRGGYGEVYVGAYNRRRVALKM  358

Query  392  ------------TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL  439
                         +F  E++L A+L HP IV+ IG+AW+S ++L  ++EF+  GDL+  L
Sbjct  359  LLPETRKSKAHRISFLAEMKLMATLEHPRIVRLIGIAWDSPNDLCGLIEFIPGGDLRALL  418

Query  440  HKNSDV---LSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDF  496
            +K ++    + +  ++  +A  VA AL YLHS  PA+IHRDLKS NILLT +LD KL DF
Sbjct  419  NKYAEAHRPIGFTYEKAKIASHVAHALTYLHSLIPAVIHRDLKSKNILLTRELDAKLTDF  478

Query  497  GVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDH  556
            GVSR  +D TMTAGVGT  W +PEV+ G RY +KADI+S GVVLSEL+T  +PY      
Sbjct  479  GVSREHVDRTMTAGVGTSLWISPEVMMGERYDDKADIFSLGVVLSELNTHAMPYAHAKPR  538

Query  557  DGA--KLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            DG+  +L    ILQ V  G LR  FS   P  + ++  AC++ DP DRPTA E++  L+
Sbjct  539  DGSGDRLPDTAILQLVAGGKLRADFSQGGPEALMQLGLACVALDPKDRPTAPEVLYRLQ  597

>PHYCA_547243
Length=367

 Score = 217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 160/274 (58%), Gaps = 23/274 (8%)

Query  363  RIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASL  404
            RIP + +     +S+   GE +   Y   T                   F  E++L ASL
Sbjct  86   RIPKDKIDVGPLISRGGFGEVYKGTYNGLTVAVKKMLPAHRKNVAHVNNFLAEVKLMASL  145

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAVAVAE  461
             H  IV+F+GVAW+SLS++  V EF+  GDL+G L   H  +  + +  D++ +A+ VA 
Sbjct  146  DHSCIVQFVGVAWDSLSDVCAVTEFMDAGDLRGLLTTYHDENHPVGFDNDKVTIAMHVAH  205

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEV  521
            AL YLHS  P +IHRDLKS NILLT DL  KL DFGVSR   D TMTAGVGT  W APEV
Sbjct  206  ALTYLHSLEPVVIHRDLKSRNILLTSDLSAKLTDFGVSRERADCTMTAGVGTSLWMAPEV  265

Query  522  LEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQEVMAGTLRPSF  579
            L G RY +KAD++SFGVVLSELD   +PY    +  G+  ++    +LQ +  G LR  F
Sbjct  266  LMGERYDDKADVFSFGVVLSELDLQVLPYAHATESSGSGRRMRDLAVLQRMATGKLRVQF  325

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            S D    +  +  AC+S +PSDRP+A E++  L+
Sbjct  326  SPDATASMVELGLACVSLNPSDRPSAAEVLYKLQ  359

>PYU1_G014939
Length=663

 Score = 225 bits (573),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 160/267 (60%), Gaps = 19/267 (7%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIEL  400
             LL  RI ++ +     LS+   GE W+  Y                     AFA EI +
Sbjct  382  ELLAVRIDHKDVEAIKLLSRGGFGEVWLGLYMNENVAIKRLLSDKKSMDDALAFASEIRI  441

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAV  459
             A L HP IV+FIGV+W +   +  V EF+  GDL+  L  N +  L+WA  +  +++ +
Sbjct  442  MARLEHPKIVRFIGVSWTNYLTIQAVTEFMDCGDLKSLLDSNRASSLTWANLKCQISIDI  501

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTA  518
            A+AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR   ++ TMTAGVGT  W A
Sbjct  502  ADALVYLHTLNPKLIHRDLKSRNVLIDAQTGAKLSDFGISRDRSVEETMTAGVGTARWIA  561

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEV+ G  Y+E ADIYSFGVVLSELDT + P+ D  + +GAK+    ILQ V AG L+PS
Sbjct  562  PEVVLGGHYTEAADIYSFGVVLSELDTCKAPFHDATNTNGAKMQDVTILQLVSAGKLQPS  621

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTA  605
            F+  CPP I ++A ACL FDP+ RP A
Sbjct  622  FTDLCPPAILKLARACLEFDPARRPNA  648

>SDRG_03655
Length=364

 Score = 216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 161/274 (59%), Gaps = 20/274 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            +L  +I +E L +  +L+  A GE W+ Q  G   A                 F  EI L
Sbjct  81   ILPFKIEFERLLYTRKLASGAFGEVWLGQLDGTSVAIKQILPERRHDPVEIKCFLAEIGL  140

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVA  460
             A L HP+I+  +G +W+   NL    E++  GDL   L++  D  SW  +R+ +A+ VA
Sbjct  141  MAPLTHPNILTLVGFSWSPEYNLCFATEYLKHGDLFSCLNRLHDAWSWPIERLQIALGVA  200

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
              L YLH+R+P +IHRDLKS NILL +    K+ DFGVSR    + TMTAGVGT  W AP
Sbjct  201  RGLVYLHARTPKVIHRDLKSRNILLDDRFQAKITDFGVSRTRAFEETMTAGVGTALWAAP  260

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFD-TVDHDGAKLMPFQILQEVMAGTLRPS  578
            EV  G RY +KAD+YSFG+VLSELDTG IP+ D  V  +G K+ P  +L+ V      PS
Sbjct  261  EVFLGRRYDDKADVYSFGIVLSELDTGNIPFVDHPVFANGRKVDPTTVLKLVTMEHATPS  320

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            FS  CP  I+ +A  CLSF+PS RP+A +++ +L
Sbjct  321  FSPSCPAAIEALAKRCLSFEPSQRPSADDIVTYL  354

>PHYSO_421999
Length=294

 Score = 214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 165/280 (59%), Gaps = 25/280 (9%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGR-PTA-----------------FAEEIEL  400
            ++  R+P + +  +  +S+ A GE +  ++ R P A                 F  E ++
Sbjct  8    IVAKRVPRDKIHVKSLISRGAYGEVYSGRFNRHPVAIKMLIPSTRCSLPHVSDFLAEAKM  67

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN---SDVLSWAGDRIYMAV  457
            TAS+ HPHIVK IGV+W+SLS+L +VLEF+  GDL+  L+K+      + +   +  +A+
Sbjct  68   TASMDHPHIVKLIGVSWDSLSDLCVVLEFMDGGDLRALLNKHEVSKHPVGFDRKKATVAL  127

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             V  AL YLHS  P +IHRD+KS NILL   +D KL DFG SR  +D TMTAGVGT  W 
Sbjct  128  QVCHALTYLHSLMPPVIHRDVKSRNILLNRAMDAKLTDFGTSRERLDQTMTAGVGTSLWM  187

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDGAKLMPFQILQEVMAG  573
            APEV+ G RY  KAD++SFGVVLSELD   +PY      + D+DG  +    +LQ++  G
Sbjct  188  APEVMLGERYDVKADMFSFGVVLSELDNHTLPYTRAKQRSQDNDGRPMTDASLLQKITTG  247

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +R  FS   P  +  +  AC++ +P DRPTA E +  L+
Sbjct  248  AVRVDFSRSSPASVVELGLACVAVNPGDRPTAAEALYRLQ  287

>PYU1_G013198
Length=351

 Score = 216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 162/280 (58%), Gaps = 20/280 (7%)

Query  349  TFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY------------------GR  390
            TF  + +   LL  ++ Y+ +     +   A G  W+ +Y                   R
Sbjct  57   TFVSIWNDSDLLSVQLNYDDIEDIKTIGSGAYGVVWLVKYRNSQVLASKRLKPGETDRQR  116

Query  391  PTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG  450
              AF  EI+L A   HPHIVKF+G AW   S++  + E++  GDL+ +L        W  
Sbjct  117  TQAFIAEIKLVAKFDHPHIVKFVGAAWTMESDIQALFEYLEYGDLRTYLMDAYTPREWTR  176

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTA  509
            +++ +A+ + EAL Y+HS +P ++HRDLKS N+LL+E+L+ KL DFGVSR    D TMT 
Sbjct  177  EKLQIAIGIVEALVYVHSFTPPLVHRDLKSRNVLLSEELEAKLTDFGVSRFSSEDNTMTT  236

Query  510  GVGTPYWTAPEVLEG-ARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQ  568
            GVGT  W APEV+ G + Y + ADIY+FGVVLSE+DT  +PY +     G +L    ILQ
Sbjct  237  GVGTGKWLAPEVISGKSDYDQSADIYAFGVVLSEIDTHAVPYEELRGTSGNQLAEVAILQ  296

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
             V  G L PSFS  CP  I+ +AA CLSF+P+ RP+A E+
Sbjct  297  LVAKGELVPSFSETCPENIKELAARCLSFEPTARPSAVEI  336

>HYAP_05661
Length=698

 Score = 225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 159/266 (60%), Gaps = 19/266 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIELT  401
            LL  R+ +  +     LS+   GE W+  Y                     AFA EI++ 
Sbjct  418  LLAVRVEHRDVEAIKLLSRGGFGEVWLGLYMNENVAIKRLLSDKKTMQDALAFATEIKVM  477

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVA  460
            A L HP IV FIGV+W +   +  V EF+  GDL+  L  + +  L+WA  +  +A+ +A
Sbjct  478  ARLEHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDIA  537

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
            +AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT  W AP
Sbjct  538  DALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTARWIAP  597

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EV+ G  Y+E ADIYSFGVVLSELDT + P++D  + +G K+    ILQ V AG L+PSF
Sbjct  598  EVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSF  657

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTA  605
            +  CP  I R+A ACLSFDP+ RP+A
Sbjct  658  NESCPSSIVRLARACLSFDPAQRPSA  683

>PHYCA_125089
Length=523

 Score = 221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/288 (44%), Positives = 170/288 (59%), Gaps = 25/288 (9%)

Query  352  ILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------  393
            +LL+   ++ NRI Y  L     +SK   G  +  +Y GR  A                 
Sbjct  205  VLLNDPVVVTNRIEYRQLKIGKCISKGGFGLVFTGEYRGRRVAIKKIRPDRSGDVSDIEI  264

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVLSWAG  450
            F +EI L A L HP IV+FIGVAW++L +LS V EF+  GDL+  L+   +    L+W  
Sbjct  265  FLKEIILMAVLYHPRIVEFIGVAWDTLRHLSAVTEFMVNGDLRHVLYTFKERGSPLAWRT  324

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR--GVMDLTMT  508
             +  +A+ +AEAL YLHS  P +IHRDLKS N+LL   L+ KL DFG+SR    ++  MT
Sbjct  325  HKAPIALHIAEALTYLHSLHPPVIHRDLKSKNVLLNMHLEAKLSDFGISRIRYAIETHMT  384

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD--GAKLMPFQI  566
            AGVGT +W APEVL G  Y E+ADIYSFGVVLSE+DT   P+++    D    K+   +I
Sbjct  385  AGVGTSFWIAPEVLLGRDYDERADIYSFGVVLSEIDTDDYPFWNDKHQDEPRGKIHEAEI  444

Query  567  LQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            L +V AG +RP FS DCP  I  +A ACL  DP +RPTA E++  ++ 
Sbjct  445  LSQVAAGRIRPDFSPDCPEEILALADACLQRDPRNRPTAAEIVMEIQN  492

>HYAP_01732
Length=372

 Score = 216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 162/277 (58%), Gaps = 22/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIEL  400
            L+ +RIP E +  +  +++   G+ +   Y   T                  A   E ++
Sbjct  83   LVASRIPLEEIQIKELIARGGFGQVFTATYKGQTVAVKTLLPETAKDMDEINALYAESKI  142

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQG----FLHKNSDVLSWAGDRIYMA  456
             A L HP IV FIG+AW SLS +  V E++  GDL+     FL   +    +  D++ +A
Sbjct  143  LAKLDHPCIVSFIGIAWGSLSTVCCVTEYLVGGDLRALLNHFLANQTRPQGFDHDKVKIA  202

Query  457  VAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYW  516
            + +A+ L YLHS +P ++HRDLKS N+LLT  LD KL DFGVSR   +L MT  VGT  W
Sbjct  203  LNIAQGLAYLHSLTPNMLHRDLKSRNVLLTSQLDAKLTDFGVSRERSELMMTNAVGTSLW  262

Query  517  TAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLR  576
             APEV+ G+ Y  KAD++SFGV+LSELDT  +PY +  + +G KL    ILQ+   G L+
Sbjct  263  MAPEVMLGSHYDGKADVFSFGVLLSELDTHLMPYANVRNANGQKLTENGILQKTSTGQLQ  322

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              FS DCPP + R+A ACL+ +P+DRPTA E +  L+
Sbjct  323  VEFSRDCPPELLRLAHACLAVNPNDRPTAAEALYKLQ  359

>PPTG_16203
Length=403

 Score = 217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/289 (40%), Positives = 165/289 (57%), Gaps = 18/289 (6%)

Query  344  AGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA----------  393
            +G N  ++IL   ++L   R+PY+ +  +  LSK+ + E  + +Y               
Sbjct  115  SGPNYIWRILQEDRNLTRIRLPYKEIKLRALLSKSQTREIRLGEYQNQQVVVKRLLKTKR  174

Query  394  --------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV  445
                    F  +I++ ++L HP+IV  +GVAWNS+ ++ +V+E    GDL  +L  + + 
Sbjct  175  SHIFHIQEFIYQIQIRSTLEHPNIVTLVGVAWNSVDDVMLVMEHYPLGDLLTYLQNHGER  234

Query  446  LSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDL  505
             SW   +  +A+ +A AL YLHS+   I HRDL+++N+LLTE +  KL  F  S      
Sbjct  235  TSWEHGKYRLAIGIARALVYLHSQPTPIAHRDLRASNVLLTETMRSKLTGFDSSCLNEHS  294

Query  506  TMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQ  565
                  G PYW+APEVL G  Y+ K+DIY+FGV+L+ELDT   P+ D V   G KL P Q
Sbjct  295  HRCHIAGAPYWSAPEVLRGRPYTTKSDIYAFGVLLTELDTVNSPFHDAVSPIGTKLKPIQ  354

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            IL EVM GTLRPSFS +CP RI+ I   C   DP  RPTA +L++ LE 
Sbjct  355  ILNEVMQGTLRPSFSPECPRRIRVIGVGCYQHDPDRRPTAAQLLRLLEA  403

>H257_17422
Length=426

 Score = 218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 163/275 (59%), Gaps = 20/275 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------RPT------AFAEEIEL  400
            LL  ++ Y  + +  +LSK A GE W+ Q+             R T       F  EI+L
Sbjct  142  LLKAKVDYSDIQYTRKLSKGAFGEVWLGQFQGSYVAIKQILEERKTDAKEIECFVAEIKL  201

Query  401  TASLIHPHIVKFIGVAWNSL-SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAV  459
             A+  HP+IV F+G +WN   +NL  + E++  GDL  FL K    L+W  D+I +A+ +
Sbjct  202  MATFQHPNIVDFLGFSWNPKDANLCAMTEYMKNGDLFVFLQKRKATLTWRHDKIQIAIDI  261

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTA  518
            A+AL YLHS SP +IHRDLKS N+LL +    KL DFG+SR   ++ TMTAGVGT  W A
Sbjct  262  AQALVYLHSLSPKVIHRDLKSKNVLLDDRCTAKLSDFGISRLRQLEETMTAGVGTALWAA  321

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEV    +Y+++AD+YS GVVLSELDT  IPY D       KL    +++ V     +P+
Sbjct  322  PEVFLAMKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAVIKLVTQQKAKPT  381

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            FS  CP  ++ +A  CL ++P +RP+A E+++ L+
Sbjct  382  FSPSCPEEVRALAFRCLDYEPDNRPSAAEVVEILK  416

>HYAP_14838
Length=323

 Score = 214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/266 (42%), Positives = 151/266 (57%), Gaps = 19/266 (7%)

Query  362  NRIPYESLSFQMELSKAASGEAWI-----------------CQY-GRPTAFAEEIELTAS  403
             RI ++ L+F   LSK A GE W+                 CQ       FA EI+L   
Sbjct  2    KRITFDELTFLRILSKGAYGEVWLGQLETRHVAIKRLLPEKCQLTASLEQFAGEIKLMGL  61

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L H +IV FIGV WN L N+  V+E++  GDL   L +  +  SW  ++I +A+ + E L
Sbjct  62   LQHRNIVLFIGVCWNWLQNMCAVVEYMDAGDLDEILKRKREQFSWQHEKISIAMDITEGL  121

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAPEVL  522
             YLH   P I+HRDLK  N+LL  D   KL DFGVSR   ++ TMT+GVGT  WTAPE++
Sbjct  122  VYLHCLRPVIVHRDLKPKNVLLNRDFQAKLSDFGVSRKTRVNETMTSGVGTLLWTAPEII  181

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G +YSEKADIYS GV+LSE+DT   P+ D     G +L   Q+ Q V  G +R +   D
Sbjct  182  AGKKYSEKADIYSLGVLLSEMDTCEPPFSDVTSDKGERLPGMQLAQLVRLGKIRVTLRKD  241

Query  583  CPPRIQRIAAACLSFDPSDRPTAQEL  608
            CPP++ ++   C   DP  RP++ ++
Sbjct  242  CPPKLCKLVMDCTQLDPDARPSSMQV  267

>SPRG_07851
Length=393

 Score = 216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 162/274 (59%), Gaps = 20/274 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            +L  +I +E L +  +L+  A GE W+ Q  G   A                 F  EI L
Sbjct  110  ILPFKIEFERLLYTRKLASGAFGEVWLGQLDGTSVAIKQILPERRHDPVEVKCFLAEIGL  169

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVA  460
             A L HPHI+  +G +W+   NL     +   GDL   L++  D  SW  +R+ +A+ VA
Sbjct  170  MAPLSHPHILTLVGFSWSPEYNLCFATAYWKHGDLLSCLNRLHDAWSWPIERLQIALGVA  229

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
            + L YLH+R+P +IHRDLKS NILL +  + K+ DFGVSR    + TMTAGVGT  W AP
Sbjct  230  KGLVYLHARTPKVIHRDLKSRNILLDDHFEAKITDFGVSRTRAFEETMTAGVGTALWAAP  289

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFD-TVDHDGAKLMPFQILQEVMAGTLRPS  578
            EV  G RY +KAD+YSFG+VLSELDTG IP+ D  V  +G K+ P  +L+ V      P+
Sbjct  290  EVFLGRRYDDKADVYSFGIVLSELDTGNIPFVDHPVFANGRKVDPTTVLKLVTMEHATPT  349

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            FS  CP  I+ +A  CLSF+PS RP+AQ+++ +L
Sbjct  350  FSPSCPAAIEALAKRCLSFEPSARPSAQDIVAFL  383

>PITG_17840
Length=513

 Score = 220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 167/286 (58%), Gaps = 24/286 (8%)

Query  352  ILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------  393
            + L+   ++ NRI ++ L     +SK   G  ++ +Y GR  A                 
Sbjct  201  VFLNDPVIVTNRIDHKLLKLGQCISKGGFGLVFLGEYKGRRVAIKKIRPDRSVTTAEIET  260

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAG  450
            F +EI + A L HP IVKFIGVAW++L +LS V EF+  GDL+  LH      + LSW  
Sbjct  261  FLKEIIMMAVLYHPRIVKFIGVAWDNLRHLSAVTEFMDNGDLREVLHGYKLKGEQLSWES  320

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG--VMDLTMT  508
             +  +A+ +AEAL YLH+  P IIHRDLKS N+LL   L+ KL DFG+SR   +++  MT
Sbjct  321  HKATIALHIAEALAYLHALKPKIIHRDLKSKNVLLNMYLEAKLSDFGISRMHYLVETHMT  380

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF-DTVDHDGAKLMPFQIL  567
            AGVGT +W APEVL G  Y E ADI+SFGVVLSE+DT   PY+ D    +  K+   +IL
Sbjct  381  AGVGTSFWIAPEVLLGRDYDEAADIFSFGVVLSEIDTDDYPYWNDENPSNRGKIQEAEIL  440

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              V  G LRPSFS DCP  I  +A  CL   P  RPTA E++  LE
Sbjct  441  SLVAEGKLRPSFSKDCPKAILDLADCCLQKKPEARPTAAEIVVILE  486

>PHYCA_569895
Length=319

 Score = 214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 167/283 (59%), Gaps = 22/283 (8%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAF  394
            L + + ++  R+P + +  +  +S+   GE +  +Y                   +  AF
Sbjct  28   LWNDETIIATRVPRDQVRVEGCISRGGFGEVYRGKYNNQDVAVKMLFPEARSDLKKVNAF  87

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---D  451
              E++L ASL HPHIV+F+GV+W SL++L ++ E +  GDL+  L    D     G   D
Sbjct  88   LAEVKLMASLSHPHIVQFVGVSWGSLTDLCVLTELMKGGDLRSLLKGFEDQKHPQGIDHD  147

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            +I +A  +A+AL YLHS SP +IHRDLKS N+LLTEDLD KL DFG SR   + TMTAGV
Sbjct  148  KIQIAYQIAQALTYLHSLSPIVIHRDLKSKNVLLTEDLDAKLTDFGASRERQEQTMTAGV  207

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDT-VDHDGAKLMPFQILQEV  570
            GT  W APEV+    Y EKADI+SFGV++SELD   +PY    +D  G K     ILQ+V
Sbjct  208  GTMLWMAPEVMMAEHYDEKADIFSFGVLMSELDLQSLPYAHARIDSAGKKSPDAVILQKV  267

Query  571  MAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +G L+ +FS  C   + ++   C+S DPS+RP+A  ++  L+
Sbjct  268  ASGALQVAFSPHCLASLVQLGKECISLDPSNRPSAPMVVFRLQ  310

>PHYKE_6708
Length=311

 Score = 214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 2/173 (1%)

Query  442  NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG  501
            N D++SWA D+IYMA+ VA+ +EYLHSR   +IHRD+K+ N+LLT+ L PKLIDFG SR 
Sbjct  141  NGDLMSWACDKIYMAIGVAKGIEYLHSRE--VIHRDIKARNVLLTKRLQPKLIDFGTSRL  198

Query  502  VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKL  561
                 M+AGVGTP+WTAPEVLE   Y+EKADIYSFGV+LSELDT   PY D +  +G K+
Sbjct  199  WAPSDMSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLSELDTCEAPYHDMLGQNGMKM  258

Query  562  MPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
             PF IL++V+   L PSF+  CP RI+R+A AC   DP  RP+A +LI+ L+G
Sbjct  259  KPFHILKQVVDDLLTPSFTAGCPKRIRRVANACFQRDPKLRPSASDLIKQLQG  311

 Score = 112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 3/146 (2%)

Query  143  LECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRL  202
            + C QP+D+  Y+++ C+GTQ+L  ++C++D F DS     L  MWS GGD+ M P IR 
Sbjct  1    MNCTQPDDSEYYTNKLCTGTQMLTSAKCLIDDF-DSDWSSHLS-MWSNGGDSDMIPEIRA  58

Query  203  RDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAV  262
              H W +  T  SY VYAVHT+S+  +P +  C    GY SL+VPC+  S  S   +A +
Sbjct  59   MTHGWRDSYTNQSYLVYAVHTMSADSEPAYGTCNT-EGYGSLVVPCYPMSNTSADVVAVM  117

Query  263  NKPRGSEWVTMWLKDEFAVGDSSGFD  288
             +P  S W+T W+K   A  ++   D
Sbjct  118  AEPVASPWLTTWIKQYQASSETVNGD  143

>PHALS_05836
Length=732

 Score = 224 bits (572),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/293 (42%), Positives = 170/293 (58%), Gaps = 26/293 (9%)

Query  341  YESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPT--------  392
            +ES  S  T   L++   ++ +RIP+  +     ++K   G  +   Y R          
Sbjct  410  FESNSSPNTN--LINDPRIIAHRIPFTDIKIVKCINKGGFGLVYSGLYNRHRVAIKRIRT  467

Query  393  ----------AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---  439
                      AF +EI L ++L HPHIV FIGVAW++L NLS V E++  GDL+  L   
Sbjct  468  DLCLDMKHIEAFIKEISLMSTLNHPHIVTFIGVAWDTLQNLSAVTEYMELGDLRAVLQNI  527

Query  440  HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGV-  498
            H+    L+W   ++ +   +AEAL YLHS  P +IHRDLKS NILL   ++ KL DFGV 
Sbjct  528  HRAPSSLTWKKHKLRLVQHIAEALMYLHSLEPKLIHRDLKSKNILLNTKMEAKLSDFGVC  587

Query  499  -SRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVD-H  556
              R +++  MTAG+GT +W APEVL G  Y E+ADIYS G+VLSE+DT   PY++  +  
Sbjct  588  RERHLIETHMTAGIGTSFWIAPEVLLGKDYDERADIYSLGIVLSEIDTEDYPYWNAKNPP  647

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
             G K M   IL+ V AG L P F+  CP  + R+A ACLS +P DRP+A E++
Sbjct  648  KGGKAMEIAILRMVAAGELIPEFTESCPQEVLRLAKACLSLNPDDRPSAMEVV  700

>PPTG_00068
Length=741

 Score = 224 bits (572),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 178/310 (57%), Gaps = 25/310 (8%)

Query  329  SYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY  388
            SY   + S +  Y      +  + LL    ++ NRI Y+ L     +SK   G  +  +Y
Sbjct  406  SYSSKVDSTRTSYVDDARREVNRSLLDDPVIVTNRIEYKHLRLGKCISKGGFGLVFTGEY  465

Query  389  -GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFV  430
             GR  A                 F +EI L A L HP IV+FIGVAW++L +LS V E++
Sbjct  466  RGRRVAIKKIRPDRSGDVSEIEVFLKEIILMAVLYHPRIVEFIGVAWDNLRHLSAVTEYM  525

Query  431  SEGDLQGFLH---KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTE  487
             +GDL+  L+   +    LSW   +  + + +A+AL YLH + P +IHRDLKS N+LL  
Sbjct  526  DKGDLREVLYTFKERGSPLSWETHKAPIVLHIAQALSYLHCQHPKVIHRDLKSKNVLLNL  585

Query  488  DLDPKLIDFGVSRG--VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDT  545
             L+ KL DFG+SR    ++  MTAGVGT +W APE+L G  Y E+ADIYSFGVVLSE+DT
Sbjct  586  YLEAKLSDFGISRMRYAIETHMTAGVGTSFWIAPEILLGQDYDERADIYSFGVVLSEIDT  645

Query  546  GRIPYFDTV--DHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRP  603
               PY++    +    K+   +IL +V AG +RP FS +CP  I  IA ACL  DP DRP
Sbjct  646  DDYPYWNDKHPNEPRGKIQEAEILTQVAAGQIRPDFSTNCPEEITAIADACLQRDPRDRP  705

Query  604  TAQELIQWLE  613
            TA E+++ ++
Sbjct  706  TAAEIVEVMK  715

>H310_09505
Length=427

 Score = 217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/276 (41%), Positives = 163/276 (59%), Gaps = 20/276 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------RPT------AFAEEIEL  400
            LL  ++ Y  + +  +LSK A GE W+ Q+             R T       F  EI+L
Sbjct  141  LLKAKVDYTDIQYTRKLSKGAFGEVWLGQFQGNYVAIKQILEERKTDAKEIECFVAEIKL  200

Query  401  TASLIHPHIVKFIGVAWNSL-SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAV  459
             A+  HP+IV F+G +WN   +NL  + E++  GDL  FL K    L+W  D++ +A+ +
Sbjct  201  MATFQHPNIVDFLGFSWNPKDANLCAMTEYMKNGDLFVFLQKRKATLTWQHDKLQIAIDI  260

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTA  518
            A+AL YLHS SP +IHRDLKS N+LL +    KL DFG+SR   ++ TMTAGVGT  W A
Sbjct  261  AQALVYLHSLSPKVIHRDLKSKNVLLDDRCTAKLSDFGISRLRQLEETMTAGVGTALWAA  320

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEV    +Y+++AD+YS GVVLSELDT  IPY D       KL    +++ V     +P+
Sbjct  321  PEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAVGKNGKLDGMAVVKLVTQQKAKPT  380

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            FS  CP  ++ +A  CL ++P +RP+A E+++ L+ 
Sbjct  381  FSESCPQAVRALAFQCLDYEPDNRPSAAEVVEILKN  416

>PYVX_23713
Length=375

 Score = 215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/229 (46%), Positives = 145/229 (63%), Gaps = 3/229 (1%)

Query  47   GTNSDIARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF  106
            GT SDIARQLY RH +GD++  V   +VP+ V+ RL ++ + F  LPGL Q A+LWD+GF
Sbjct  87   GTTSDIARQLYLRHSAGDSAVQVVPNAVPSTVSARLSAIGVEFATLPGLAQRALLWDSGF  146

Query  107  GISPNGDPVQIWTTGDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILN  166
             IS N D V+I T G  +MAD+AVS  +     CT   C QP+ + ++++Q+C+GT +L+
Sbjct  147  AISANNDAVRIRTLGGVSMADLAVSKLEYEGAGCTAANCTQPDGSLSFNNQFCNGTGMLS  206

Query  167  VSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSS  226
            V++C+ D F+D         MWSTGGD  + P IRL  H W +  TGVSY V AVHT+S 
Sbjct  207  VAKCVTDAFDDDTEAHL--AMWSTGGDPELVPQIRLVQHAWMDDATGVSYIVNAVHTLSE  264

Query  227  ADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWL  275
              +P +  C   +GY SL+VPC+  S  S    A +  P+GSEWVT W+
Sbjct  265  TVEPAYGTC-ATDGYGSLVVPCYSSSSVSSDVDAEMEAPQGSEWVTTWM  312

>PHALS_05409
Length=698

 Score = 224 bits (570),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 158/266 (59%), Gaps = 19/266 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIELT  401
            LL  RI +  +     LS+   GE W+  Y                     AFA EI++ 
Sbjct  418  LLAARIEHRDIEAVKLLSRGGFGEVWLGLYMNENVAIKRLLNDKKSMQDALAFATEIKVM  477

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVA  460
            A L HP IV FIGV+W +   +  V EF+  GDL+  L  + +  L+WA  +  +A+ VA
Sbjct  478  ARLDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDVA  537

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
            +AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT  W AP
Sbjct  538  DALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTARWIAP  597

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EV+ G  Y+E AD+YSFGVVLSELDT + P+ D  + +G K+    ILQ V AG L+PSF
Sbjct  598  EVILGGHYTEFADVYSFGVVLSELDTCKAPFHDATNTNGGKMQDVTILQLVSAGKLQPSF  657

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTA  605
            S  CP  I ++A ACLSFDP+ RP+A
Sbjct  658  SDSCPHSIVKLARACLSFDPAQRPSA  683

>HYAP_05921
Length=565

 Score = 220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 174/312 (56%), Gaps = 27/312 (9%)

Query  318  EQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSK  377
            +Q   GTV    Y PS   +  +   +    TF I      +   RI Y+SLSF   +++
Sbjct  239  QQKNHGTV----YRPSTPRNSMNKRRSIELATFCI---DAKITAKRIAYDSLSFDKLIAR  291

Query  378  AASGEAWICQYGRPTA------------------FAEEIELTASLIHPHIVKFIGVAWNS  419
             A+GE W    G                      F+ EI++ ++L HP IV+F+G++WN 
Sbjct  292  GANGEVWRGTCGSQVVAIKQLLPEKRYNESDVRLFSHEIQIASALEHPTIVRFVGLSWNR  351

Query  420  LSNLSMVLEFVSEGDLQGFLHK-NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
              +L +V EF+ +GDL   L+    + LSW  +++ +A+ +A+AL YLH R P IIHRDL
Sbjct  352  ACDLCIVSEFMEQGDLSVLLNSARKEGLSWFKEKLAIAINIADALTYLHGREPIIIHRDL  411

Query  479  KSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            KS N+LL   L  KL DFG+SR    D TMT GVGT  WTAPE+L G  YSEKAD+YS+ 
Sbjct  412  KSLNVLLDNRLRAKLSDFGLSRERSSDDTMTNGVGTLLWTAPEILRGEAYSEKADVYSYA  471

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
            +VLSELDT   P+    +    +L   Q++    +G + P    DCP  +Q++ AAC SF
Sbjct  472  IVLSELDTCLPPFALNAEVRERRLTSMQLMHLATSGEISPQLREDCPVPLQQLTAACASF  531

Query  598  DPSDRPTAQELI  609
            DPS RP A E++
Sbjct  532  DPSQRPNALEIV  543

>H257_05418
Length=370

 Score = 214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 161/271 (59%), Gaps = 15/271 (6%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------FAEEIELTAS  403
             L+  RI +  +     +S+ A G  W+  Y G+P A             F++EI++   
Sbjct  89   ELMPFRIDHNEVLLTRAISRGAFGVVWLGHYHGQPVAIKRMIEGDDQAVLFSKEIQIMGR  148

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEAL  463
            L  P+IV+FIG  W S  +LS V EF+  GD++  L      LSW   ++ +A+ VA AL
Sbjct  149  LKAPNIVEFIGSTWTSGMDLSAVTEFMDGGDVRTLLENPKIQLSWPAQKVNIAIDVALAL  208

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAPEVL  522
             YLH  +P +IHRDLKS N+LLT ++  KL DFG+SR    + T+TAGVGT  WTAPEV+
Sbjct  209  AYLHGLTPKLIHRDLKSKNVLLTSNMVAKLSDFGLSRNRSYEETLTAGVGTVRWTAPEVM  268

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G  YSE +D+YSFGVVLSELDT  IP+ D             I+ +V  G LRP+FS D
Sbjct  269  LGDIYSEISDVYSFGVVLSELDTREIPFDDQKSSKAGGAPDMSIVVKVARGELRPTFSPD  328

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            CP  I +IA ACL FDP+ RP++  +++ L+
Sbjct  329  CPASILQIAKACLQFDPALRPSSARVVEMLQ  359

>PPTG_00076
Length=744

 Score = 224 bits (570),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 169/286 (59%), Gaps = 24/286 (8%)

Query  352  ILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------  393
            + L+   ++ NR+ ++ L     +SK   G  ++ +Y GR  A                 
Sbjct  432  VFLNDPVIVTNRLDHKLLKMGRCISKGGFGLVFMGEYKGRRVAIKKIRPDRSVTTAEIET  491

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAG  450
            F +EI + A L HP IV+FIGVAW++L NLS V EF+  GDL+  LH      + LSW  
Sbjct  492  FLKEIIMMAVLYHPRIVEFIGVAWDNLRNLSAVTEFMDNGDLREVLHGYKLKGERLSWES  551

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG--VMDLTMT  508
             +  +A+ +AEAL YLH+  P IIHRDLKS N+LL   L+ KL DFG+SR   +++  MT
Sbjct  552  HKATIALHIAEALSYLHALKPKIIHRDLKSKNVLLNMYLEAKLSDFGISRMRYLVETHMT  611

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF-DTVDHDGAKLMPFQIL  567
            AGVGT +W APEVL G  Y E ADI+SFGVVLSE+DT   PY+ D    +  K+   +IL
Sbjct  612  AGVGTSFWIAPEVLLGRDYDEAADIFSFGVVLSEIDTDDYPYWNDENPSNHGKIQEAEIL  671

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              V  G LRPSFS DCP  I  +A  CL  +P DRPTA E++  LE
Sbjct  672  SLVAEGKLRPSFSNDCPKAIVDLADCCLQKNPEDRPTAAEIVVILE  717

>H310_09502
Length=420

 Score = 216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/297 (38%), Positives = 172/297 (58%), Gaps = 23/297 (8%)

Query  337  HQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA--  393
            H  + +SA     F++    Q +L  ++ + ++ +  +L+K A GE W+ QY G+  A  
Sbjct  117  HVNNKKSAAKQALFQM---DQDMLDAKLDFNAIQYTRKLTKGAFGEVWLGQYCGKYVAIK  173

Query  394  ---------------FAEEIELTASLIHPHIVKFIGVAWNSLS-NLSMVLEFVSEGDLQG  437
                           F  EI+L  +L HP+I+ F+G +WN    NL  + E++  GDL  
Sbjct  174  QILEERKNDAKEIECFVAEIKLMLNLKHPNILDFLGFSWNPKDHNLCFLTEYMKNGDLFY  233

Query  438  FLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFG  497
            +L K   VLSW  ++I +A+ +A+ L YLHS +P IIHRDLKS N+LL E    K+ DFG
Sbjct  234  YLQKRKTVLSWKREKIQLALDIAQGLVYLHSLTPKIIHRDLKSKNVLLDEKFTAKINDFG  293

Query  498  VSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDH  556
            +SR    + TMTAGVGT  W APEV    +Y+++AD+YS GVVLSELDT  IP+ D    
Sbjct  294  ISRVRQFEETMTAGVGTALWAAPEVFMAKKYNDRADVYSLGVVLSELDTCAIPFADQAIG  353

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               KL    +++ V     +P+FS  CPP +  +A  CL ++P +RP+A ++++ ++
Sbjct  354  KNGKLDGMAVIKLVTQKRAKPTFSPQCPPPVLDLAMRCLDYEPENRPSAADVVELIQ  410

>PHYCA_547239
Length=391

 Score = 215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 159/274 (58%), Gaps = 23/274 (8%)

Query  363  RIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASL  404
            RIP + +     +S+   GE +   Y   T                   F  E++L ASL
Sbjct  110  RIPKDKIDVGPLISRGGFGEVYKGTYNGLTVAVKKMLPAHRKNVAHVNNFLAEVKLMASL  169

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAVAVAE  461
             H  IV+F+GVAW+SLS++  V EF+  GDL+G L   H  +  + +  D++ +A+ VA 
Sbjct  170  DHSCIVQFVGVAWDSLSDVCAVTEFMDAGDLRGLLTTYHDENHPVGFDNDKVTIAMHVAH  229

Query  462  ALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEV  521
            AL YLHS  P +IHRDLKS NILLT DL  KL DFGVSR   D TMTAGVGT  W APEV
Sbjct  230  ALTYLHSLEPVVIHRDLKSRNILLTSDLSAKLTDFGVSRERADCTMTAGVGTSLWMAPEV  289

Query  522  LEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQEVMAGTLRPSF  579
            L G RY +KAD++SFGVVLSELD   +PY    +  G+  ++    +LQ +  G LR  F
Sbjct  290  LMGERYDDKADVFSFGVVLSELDLQVLPYAHATESSGSGRRMRDLAVLQRMAMGKLRVQF  349

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            S D    +  +   C+S +PSDRP+A E++  L+
Sbjct  350  SPDATASMVELGLTCVSLNPSDRPSAAEVLYKLQ  383

>CCA19152
Length=720

 Score = 223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/267 (43%), Positives = 162/267 (61%), Gaps = 19/267 (7%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-----------------GRPTAFAEEIEL  400
             LL  R+ Y+ +     LS+   GE W+  Y                     AFA E+++
Sbjct  439  ELLAVRVDYKDVRLVKLLSRGGFGEVWLGSYMNEEVAVKRLLSDKKTMSDALAFASEVKV  498

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-KNSDVLSWAGDRIYMAVAV  459
             A L HP IV+FIGVAW++   +  V E++  GDL+  L+ +    L+WA  +  +A+ +
Sbjct  499  MAKLEHPKIVRFIGVAWSTALTIQAVTEYMDCGDLRSLLNSRKGSSLTWANLKCQIAIDI  558

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTA  518
            A+AL Y+H+ +P IIHRDLKS N+L+      KL DFG+SR   ++ TMTAGVGT  W A
Sbjct  559  ADALVYMHTMNPKIIHRDLKSRNVLVDAQQGAKLSDFGISRNRSLEDTMTAGVGTARWIA  618

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEV+ G  Y+E AD+YS GVVL+ELDT + P+ D V+ +G+K+    ILQ V +G L+PS
Sbjct  619  PEVIFGGHYTELADVYSLGVVLTELDTCKNPFHDAVNTNGSKMQDVTILQLVSSGQLKPS  678

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTA  605
            FS  CP  I ++A ACL+F PS+RP A
Sbjct  679  FSASCPASIVKLAEACLAFHPSERPGA  705

>PPTG_10361
Length=564

 Score = 219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 174/297 (59%), Gaps = 27/297 (9%)

Query  342  ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------  389
            E+A S QT   L +   +   RIP + +  +  LS+ A GE +  ++             
Sbjct  261  EAAMSGQTG--LWNDDVITAKRIPRDKVKMKKLLSRGAYGEVYTGRFNGQQVAVKMLLPS  318

Query  390  ------RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
                    T F  + +LTAS+ HPHIV F+GVAW+SLS+L +VLEF+  GDL+  L+K  
Sbjct  319  TRGNLQHVTDFLTKAKLTASMDHPHIVTFVGVAWDSLSDLCVVLEFMDGGDLRTLLNKYE  378

Query  444  DVLSWAG---DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR  500
             V   AG   ++  +A+ V  AL YLHS  P +IHRDLKS NILL +  + KL DFG+S+
Sbjct  379  AVKHPAGVDLEKATIALHVCHALTYLHSLMPPVIHRDLKSRNILLNQSKEAKLTDFGISK  438

Query  501  GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD----TVDH  556
              +D TMTAGVGT  W APEV+ G +Y  KADI+SFGV+LSELD   +PY      ++D 
Sbjct  439  ERLDQTMTAGVGTSLWMAPEVMLGEKYDVKADIFSFGVMLSELDVHTLPYAQAKQRSLDT  498

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             G K+    +LQ++ AG +R  FS   PP +  +  AC++ D +DRPTA E +  ++
Sbjct  499  TGRKMADATLLQKITAGEVRVEFSESSPPSMVELGYACVAVDSADRPTAAEALYRIQ  555

>PHYCA_553853
Length=513

 Score = 218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/286 (43%), Positives = 167/286 (58%), Gaps = 24/286 (8%)

Query  352  ILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------  393
            + L+   ++ NR+ +  L     +SK   G  ++ +Y GR  A                 
Sbjct  201  VFLNDPVIVTNRLDHTLLKMGRCISKGGFGLVFMGEYKGRRVAIKKIRPDRSVTTAEIEM  260

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAG  450
            F +EI + A L HP IV+F+GVAW++L +LS V EF+  GDL+  LH      + L+W  
Sbjct  261  FLKEIIMMAVLYHPRIVEFVGVAWDNLRHLSAVTEFMENGDLRDVLHGYKVKGERLTWES  320

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG--VMDLTMT  508
             +  +A+ +AEAL YLHS  P IIHRDLKS N+LL   L+ KL DFG++R   +++  MT
Sbjct  321  HKATIALHIAEALSYLHSLKPKIIHRDLKSKNVLLNMYLEAKLSDFGIARMRYIVETHMT  380

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF-DTVDHDGAKLMPFQIL  567
            AGVGT +W APEVL G  Y E ADI+SFGVVLSE+DT   PY+ D    +  ++   +IL
Sbjct  381  AGVGTSFWIAPEVLLGRDYDEAADIFSFGVVLSEIDTDDYPYWNDENQSNRGRIQEAEIL  440

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              V  G LRP FS DCP  I  +A  CL  DP +RPTA E++  LE
Sbjct  441  SLVAEGKLRPDFSEDCPKAIVDLADCCLQNDPKNRPTAAEIVVILE  486

>PPTG_07736
Length=431

 Score = 215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 163/277 (59%), Gaps = 23/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            ++  RIP++ +     LS+   GE +  +Y                      AF  EI+L
Sbjct  142  IVAARIPFDRVELGELLSRGGFGEVYRGRYRDQNVAVKTLLPSTRKDMNHIEAFLAEIKL  201

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
             A++ HP IV+FIGVAW SLS L  + EF+  GDL+  L   ++N     +   +I MA+
Sbjct  202  MATMEHPQIVQFIGVAWESLSELYAISEFMEGGDLRTLLVKHYENGHPRGFEPAKIKMAL  261

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P ++HRDLKS NILLTE LD K+ DFG SR   D TMTAGVGT +W 
Sbjct  262  QVAHALTYLHSLDPIVLHRDLKSRNILLTESLDAKITDFGASRERSDKTMTAGVGTSFWM  321

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDH-DGAKLMP-FQILQEVMAGTL  575
            APEV+ G RY EKAD++SFGVVLSELDT  +PY    ++ + ++ +P   +LQ V+ G L
Sbjct  322  APEVVMGERYGEKADVFSFGVVLSELDTHELPYSHAKENSETSRPLPDTAVLQLVLMGRL  381

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            +  FS   P  +  +A  CL  +P DRPTA E++  L
Sbjct  382  QVQFSGVGPIEMTELARQCLQIEPQDRPTAAEVLYRL  418

>PPTG_00069
Length=765

 Score = 223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 169/287 (59%), Gaps = 26/287 (9%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG---------RP---------TAF  394
            LL    ++ NRI Y+ +     LS+   G  ++ +Y          RP          AF
Sbjct  452  LLEDPVIITNRINYKEIKLGKCLSRGGFGLVFVGEYKGRQVAVKKIRPDRSQDPKDVQAF  511

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVLSWAGD  451
             +EI L   L HP IV+FIGVAW++L ++S V EF+  GDL+  L    +    LSW   
Sbjct  512  LKEIILMTELHHPRIVEFIGVAWDNLKHISAVTEFMESGDLRHVLRSFKRQGTPLSWRDH  571

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG---VMDLTMT  508
            +  +++ +AEA++YLHS +P +IHRDLKS N+LL   L+ KL DFGVSR         MT
Sbjct  572  KTTISLHIAEAMQYLHSHNPKVIHRDLKSKNVLLNMHLEAKLTDFGVSRTQYTAQTHPMT  631

Query  509  AGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDG--AKLMPFQI  566
            AG+GT +W APEVL G  Y+E+ADIYSFGVVLSE+DT   P+++  + DG   KL    I
Sbjct  632  AGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPFWNDANRDGPRGKLQEADI  691

Query  567  LQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            L++V  G  RP FS +CP  I  +A +CL  +P DRPTA  +++ L+
Sbjct  692  LRQVATGNKRPQFSTNCPAGIMLLAESCLQENPDDRPTAAAVVETLQ  738

>PHYSO_413418
Length=318

 Score = 211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 163/277 (59%), Gaps = 22/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            ++  R+P + + F+  LS+   GE +   Y                   +  AF  E +L
Sbjct  35   IVATRVPRDQVKFEAVLSRGGFGEVYRGTYNNEQVAIKMLFPEMRKDLKKVNAFLAEAKL  94

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAV  457
             ASL+HPH+V+F+GVAW +L++L ++ E +  GDL+  L   +      G   D++ +A 
Sbjct  95   MASLVHPHVVRFVGVAWGNLADLCVLTELMQGGDLRTLLKDFNAKGHPQGMDQDKLRIAY  154

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             +A+AL Y+HS SP +IHRDLKS N+LLTEDL  KL DFG SR   + TMTAGVGT  W 
Sbjct  155  HIAQALTYMHSLSPVVIHRDLKSKNVLLTEDLKAKLTDFGASRERQEHTMTAGVGTMLWM  214

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPY-FDTVDHDGAKLMPFQILQEVMAGTLR  576
            APEV+   RY+EKAD++SFGV+LSELD   +PY    +D  G K+    ILQ+V +G L+
Sbjct  215  APEVMMAERYTEKADVFSFGVLLSELDLQTLPYSHARIDSSGMKVPDALILQKVASGALQ  274

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              FS  C   +  +   C++ DPS RP+A  ++  L+
Sbjct  275  VQFSSKCLAAVVELGKDCVALDPSARPSAPMVVFRLQ  311

>PHYRA_82847
Length=696

 Score = 220 bits (561),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 157/266 (59%), Gaps = 19/266 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT-----------------AFAEEIELT  401
            LL  RI +  +     LS+   GE W+  +                     AFA EI+  
Sbjct  416  LLAARIEHRDVEAIKLLSRGGFGEVWLGLFMNENVAIKRLLNDKKSMQDALAFATEIKTM  475

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKN-SDVLSWAGDRIYMAVAVA  460
            A + HP IV FIGV+W +   +  V EF+  GDL+  L  + +  L+WA  +  +A+ +A
Sbjct  476  ARMDHPKIVHFIGVSWTNALTIQAVTEFMDCGDLKSLLDSSRASSLTWANLKCQIAIDIA  535

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG-VMDLTMTAGVGTPYWTAP  519
            +AL YLH+ +P +IHRDLKS N+L+      KL DFG+SR    D TMTAGVGT  W AP
Sbjct  536  DALVYLHTLNPKLIHRDLKSRNVLIDAQSGAKLSDFGISRNRSFDETMTAGVGTARWIAP  595

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSF  579
            EV+ G  Y+E ADIYSFGVVLSELDT + P++D  + +G K+    ILQ V AG L+PSF
Sbjct  596  EVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTILQLVSAGKLQPSF  655

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTA  605
                PP I ++A ACLSFDP+ RP+A
Sbjct  656  DESSPPSIVKLARACLSFDPAQRPSA  681

>H257_17420
Length=423

 Score = 213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 171/297 (58%), Gaps = 23/297 (8%)

Query  337  HQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA--  393
            H  + ++A     F++    Q +L  ++ + ++ +  +L+K A GE W+ QY G+  A  
Sbjct  120  HANNKKAAAKQALFQM---DQEMLDAKLDFNAIQYTRKLTKGAFGEVWLGQYRGKYVAIK  176

Query  394  ---------------FAEEIELTASLIHPHIVKFIGVAWNSLS-NLSMVLEFVSEGDLQG  437
                           F  EI+L  +L HP+I+ F+G +WN    NL  + E++  GDL  
Sbjct  177  QILEERKNDTKEIECFVAEIKLMLNLKHPNILDFLGFSWNPKDHNLCFLTEYMKNGDLFY  236

Query  438  FLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFG  497
            +L K   VL+W  ++I +A+ +A+ L YLHS +P IIHRDLKS N+LL E    K+ DFG
Sbjct  237  YLQKRKTVLTWKREKIQLALDIAQGLVYLHSLTPKIIHRDLKSKNVLLDEKFTAKINDFG  296

Query  498  VSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDH  556
            +SR    + TMTAGVGT  W APEV    +Y+++AD+YS GVVLSELDT  IP+ D    
Sbjct  297  ISRVRQFEETMTAGVGTALWAAPEVFMAKKYNDRADVYSLGVVLSELDTCAIPFADQAIG  356

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               KL    +++ V     +P+FS  CP  +  +A  CL ++P +RP+A +++Q ++
Sbjct  357  KNGKLDGMAVIKLVTQKRAKPTFSESCPAPVLELAMLCLDYEPGNRPSAADVVQLIQ  413

>HYAP_05922
Length=783

 Score = 221 bits (564),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 177/311 (57%), Gaps = 31/311 (10%)

Query  322  RGT---VATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
            RGT   VATT    ++S+ Q   ES       +  +    ++  RI +  L F   L+K 
Sbjct  402  RGTPALVATTRAEITLSNDQLCREST----ILRAFVSDPSIVTRRISFAQLHFLRLLAKG  457

Query  379  ASGEAWICQYGR---------------PTA---FAEEIELTASLIHPHIVKFIGVAWNSL  420
             SGE W+ QY                 P A   FAEEI + + L HP IV F GVAW SL
Sbjct  458  GSGEVWLGQYETRYVAMKCLLPAKREDPEALERFAEEIRMASLLAHPRIVAFCGVAWQSL  517

Query  421  SNLSMVLEFVSEGDLQGFLHK--NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDL  478
             +L  V E++  GDL+  L        LSW+ +++ ++  +AEAL YLHS    +IHRDL
Sbjct  518  LHLCAVTEYMPRGDLESLLANPIARKELSWSREKLTLSSDIAEALVYLHSLVSIVIHRDL  577

Query  479  KSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFG  537
            KS N+LL   L  KL DFG+SR   ++ TMT G+GT  W+APEVLEG RY EK+D++SFG
Sbjct  578  KSKNVLLDRRLRAKLSDFGLSREQSIEDTMTNGIGTILWSAPEVLEGKRYDEKSDLFSFG  637

Query  538  VVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSF  597
            VVLSE+DT  +PY  +     AK+   QI+  V  G L PSF  DCPP I+ +A  CLS 
Sbjct  638  VVLSEIDTCALPYGFS---RHAKMRSMQIVHLVSEGKLLPSFRDDCPPPIRALAQRCLSL  694

Query  598  DPSDRPTAQEL  608
            DP+ RPTA E+
Sbjct  695  DPAARPTAMEV  705

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 101/222 (45%), Gaps = 32/222 (14%)

Query  51   DIARQLYTRHRSGDTSA--AVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGI  108
            D+  +LY   +SG + A  ++S   +P+AVT RL S  +A++ + G +Q A+LWD+GF  
Sbjct  46   DLVMRLYDLEKSGHSIAKLSLSSSELPSAVTSRLSSYSLAWSEISGFMQRALLWDSGFVF  105

Query  109  --------------SPNGDPVQIWTTGDFTMADIAVSPDDITNVN-------CTMLECPQ  147
                          +P    VQI+T     M D+  S  +I  +        C + +C  
Sbjct  106  ASSSSASMTSSSLRAPTVTLVQIYTACSKGMEDLLPSLAEIKTLARNSSAGPCEVQKCGI  165

Query  148  PNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTW  207
                 A S   C   Q+L ++RC V      G +   G++W+  G +T  P   LR HT 
Sbjct  166  IGHFLAGS---CPLMQLLPLTRCAVYASAIEGQEQVKGVVWAEDGRSTSVPAPVLRRHTA  222

Query  208  TEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCH  249
             +  T  S S++AVH   +    T +  P    Y+  IVPC 
Sbjct  223  VD--TEASRSLFAVHLSEAIFTGTESCQP----YTDFIVPCR  258

>PHYRA_77814
Length=565

 Score = 217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 173/304 (57%), Gaps = 36/304 (12%)

Query  344  AGSNQTFKILLHSQHLL-------GNRIPYESLSFQMELSKAASGEAWICQ---YGRPTA  393
            +G+  + +  +H Q  L        NRIP + +  +  +S+ A GE  +C+    G+  A
Sbjct  256  SGNTASLEAAMHGQIGLWDDDVITANRIPRDKVRVKGIISRGAFGE--VCEGAFNGKQVA  313

Query  394  -----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQ  436
                             F  E ++TA++ HPH+V FIGVAW+SLS+L +VLEF+  GDL+
Sbjct  314  VKMLLPHMRGNLQQVNDFLAEAKMTATMDHPHVVGFIGVAWDSLSDLCVVLEFMDGGDLR  373

Query  437  GFLHKNSDVLSWAG---DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKL  493
              L+K        G   ++  +A+ V  AL YLHS  P +IHRDLKS NILL++  D KL
Sbjct  374  ALLNKYETTNHRVGFDREKTTIALQVCHALTYLHSLMPPVIHRDLKSRNILLSQARDAKL  433

Query  494  IDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDT  553
             DFG+SR  +D TMTAGVGT  W APEV+ G RY  KAD++SFGVVLSELD   +PY   
Sbjct  434  TDFGISRERLDQTMTAGVGTSLWMAPEVMLGERYDVKADMFSFGVVLSELDVHTLPYAQA  493

Query  554  V----DHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
                 D +G +L    ILQ+V  G L   FS   P  +  +  AC+S +PSDRPTA E +
Sbjct  494  KEQVRDSNGRRLPDAAILQQVAMGYLHVEFSQASPANMVELGRACISLNPSDRPTAAEAL  553

Query  610  QWLE  613
              L+
Sbjct  554  YRLQ  557

>PHYRA_77820
Length=251

 Score = 207 bits (528),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 154/227 (68%), Gaps = 7/227 (3%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAG  450
            F  E ++TA++ HPHIV F+GVAW+SL++L +VLEF+  G+L+  L+K    +  + +  
Sbjct  16   FLAEAKMTATMDHPHIVSFVGVAWDSLTDLCVVLEFLDGGELRTLLNKYETENYPIGFDK  75

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
             +  +A+ V +AL YLHS  P++IHRDLKS NILL  +++ KL DFG+SR  +D TMTAG
Sbjct  76   HKATIALQVCQALTYLHSLRPSVIHRDLKSRNILLDSNMEAKLSDFGISRERLDRTMTAG  135

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDGAKLMPFQI  566
            VGT  W APEV+ G RY +KAD++SFGVVLSELD   +PY     + +D +G ++    +
Sbjct  136  VGTSLWMAPEVMLGERYDDKADMFSFGVVLSELDVHTLPYAQARQENLDSNGREMADSVL  195

Query  567  LQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            LQ+V  GTL+ +F+   P  I  +  AC+S DP++RP+A E +  L+
Sbjct  196  LQKVALGTLQVTFTQAKPKSIGELGRACVSIDPTERPSAAEALYRLQ  242

>PPTG_14169
Length=687

 Score = 219 bits (559),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 114/267 (43%), Positives = 160/267 (60%), Gaps = 20/267 (7%)

Query  363  RIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASL  404
            RI Y+SL+F   +++ A+GE W    G                      F+ E+ L +SL
Sbjct  403  RIAYDSLTFDRLIARGANGEVWRGTCGSQVVAIKQLLPEKRHDESHVMLFSNEVRLASSL  462

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-KNSDVLSWAGDRIYMAVAVAEAL  463
             HP+IV+F+G++WN + +L +V EF+ +GDL   L+ K  D L+W  +++ +A  +AEAL
Sbjct  463  EHPNIVRFVGLSWNRVCDLCIVSEFMEQGDLSVLLNSKRGDELTWGKEKLGIATDIAEAL  522

Query  464  EYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVL  522
             YLH R P IIHRDLKS N+LL   L  KL DFG+SR    D TMT GVGT  WTAPE+L
Sbjct  523  AYLHGRQPIIIHRDLKSLNVLLDNRLRAKLSDFGLSRERSSDDTMTNGVGTLLWTAPEIL  582

Query  523  EGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVD  582
             G  YSEKAD+YS+ +VLSELDT   P+    +    +L   Q++    +G + P    D
Sbjct  583  RGEAYSEKADVYSYAIVLSELDTCLPPFTLNTEVSERRLTTMQLMHLATSGEVSPQLRDD  642

Query  583  CPPRIQRIAAACLSFDPSDRPTAQELI  609
            CP  +Q++ AAC SF+P+ RP A E++
Sbjct  643  CPISLQQLTAACASFEPNQRPNALEIV  669

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/241 (22%), Positives = 105/241 (44%), Gaps = 29/241 (12%)

Query  62   SGDTSA-AVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120
            +GDT+A  V + +VP ++  RL    + +  L G +Q A+LWD G  ++  G  VQ++  
Sbjct  53   NGDTAAPQVVLTNVPDSLFQRLSEKSVRWDALSGYLQRALLWDAGLVMTSEGRLVQVYVP  112

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
             D  M+ I  + +     +C +  C   +    ++   CS + +   ++C +   E + A
Sbjct  113  CDEDMSVILTTFEAFRGKDCPLGTC--ESTMLYFAESTCSRSTVWKAAQCGIHASEKN-A  169

Query  181  KDFLGI----MWSTGGDATMTPHIRLRDHTWTEP-------------TTGVSYSVYA--V  221
             D +      +WS  G  +  P +RL  H   +              +TG +Y++ A  +
Sbjct  170  TDIVDAQSSSLWSEDGSLSSVPDVRLYKHKLNDSAGSDGIEEVVGSDSTG-NYTIEADVL  228

Query  222  HTVSSAD--DPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEF  279
             T++  +    T   CP +  +   + PC +  +  ++       P+   +V +WL  E 
Sbjct  229  FTINQIELFPATIESCPSDPFF---VAPCIQFYDLHESPENPWCLPKRGGFVDLWLDSEI  285

Query  280  A  280
            +
Sbjct  286  S  286

>PHYRA_76005
Length=703

 Score = 220 bits (560),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 168/290 (58%), Gaps = 24/290 (8%)

Query  348  QTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-------------  393
            Q   + L+   ++ NRI ++ L     +S    G  ++ +Y GR  A             
Sbjct  387  QVDPVFLNDPVIVTNRIDHKQLKMGRCISTGGFGLVFMGEYRGRRVAIKKIRPDRSATAA  446

Query  394  ----FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVL  446
                F +EI + A L HP +V+F+GVAW++L +LS V EF+  GDL+  LH      + L
Sbjct  447  EIELFLKEIIMMAVLYHPRVVEFVGVAWDNLRHLSAVTEFMDNGDLRDVLHGYKMKGERL  506

Query  447  SWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG--VMD  504
            SW   +  +A+ +AEAL YLH   P IIHRDLKS N+LL   L+ KL DFG+SR   +++
Sbjct  507  SWESHKATIALHIAEALSYLHGLKPMIIHRDLKSKNVLLNMYLEAKLSDFGISRMRYLVE  566

Query  505  LTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF-DTVDHDGAKLMP  563
              MTAGVGT +W APEVL G  Y E ADIYSFGVVLSE+DT   PY+ D    +  K+  
Sbjct  567  THMTAGVGTSFWIAPEVLLGRDYDEAADIYSFGVVLSEIDTDDYPYWNDENKSNRGKIQE  626

Query  564  FQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +IL  V AG LRP FS DCP  I  +A  CL  +P DRPTA +++  LE
Sbjct  627  AEILSLVAAGELRPDFSGDCPKAILDLADCCLQKNPRDRPTASQIVVILE  676

>PPTG_14170
Length=768

 Score = 221 bits (563),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 176/306 (58%), Gaps = 30/306 (10%)

Query  325  VATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAW  384
            VATT    ++S+ Q   +S+      +  +    ++  RI +  L F   L+K  SGE W
Sbjct  410  VATTRAEITLSNDQLCRKSS----ILRAFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVW  465

Query  385  ICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMV  426
            + QY  R  A                 FAEEI + + L HP IV F GVAW SL +L  V
Sbjct  466  LGQYEARYVAMKCLLPAKREDPEALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAV  525

Query  427  LEFVSEGDLQGFLHK--NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
             E+++ GDL+  L        LSW+ +++ ++  + EAL YLHS  P +IHRDLKS N+L
Sbjct  526  TEYMARGDLESLLANPVAQKELSWSREKLTLSSDIVEALVYLHSLVPVVIHRDLKSKNVL  585

Query  485  LTEDLDPKLIDFGVSR--GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            L   L  KL DFG+SR   V D TMT G+GT  W+APEVLEG RY EK+D++SFGVVLSE
Sbjct  586  LDRRLRAKLSDFGLSRERSVED-TMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSE  644

Query  543  LDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDR  602
            +DT  +PY  +     AK+   QI+  V  G L P+F  DCPP I+ +A  CLS DP+ R
Sbjct  645  IDTCALPYGFS---RHAKMRSMQIVHLVSEGKLLPNFRDDCPPAIRDLAQRCLSLDPAAR  701

Query  603  PTAQEL  608
            PTA E+
Sbjct  702  PTAMEV  707

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 103/226 (46%), Gaps = 34/226 (15%)

Query  51   DIARQLYTRHRSGD--TSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGI  108
            D+  +LY    SG   T  ++S  ++P+AV  RL S  + ++ L GL+Q A+LWD+GF  
Sbjct  45   DLVGRLYDLETSGSSATKLSLSSSALPSAVAARLSSYSLTWSELSGLMQRALLWDSGFVF  104

Query  109  -SP-----------NGDPVQIWTTGDFTMADIAVSPDDITNV-------NCTMLECPQPN  149
             SP           +   VQI+T+    M D+     ++  +       NC + +C    
Sbjct  105  ASPVSSSSSSNEADDVKLVQIYTSCSQGMGDLLPGLAEVRTLQSTGNSSNCDVQDC---G  161

Query  150  DTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTW--  207
                +    C    ++ ++RC V   +  G   F G+ W+  G +   P   LR HT   
Sbjct  162  IIGHFLPTNCPVESVIPLTRCAVHASDMDGQNQFTGVFWAEDGRSNTVPEPVLRRHTPVD  221

Query  208  TEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCHKRSE  253
            TEP    S +++AVH   ++   T +  P    +++ I+PC   +E
Sbjct  222  TEP----SEALFAVHLSETSFTGTESCQP----HTNFILPCRGVAE  259

>SPRG_11832
Length=638

 Score = 218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 188/615 (31%), Positives = 286/615 (47%), Gaps = 75/615 (12%)

Query  52   IARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF---GI  108
            +AR      R  D  A      +P  VT RL SL + +  LP LV+ A+LWD G     +
Sbjct  21   VARFRSLDERKVDGGAVAFPAPMPETVTARLASLGLTWDVLPTLVRHALLWDMGLVVGNV  80

Query  109  SPNGDPVQIWTTGDFTMADIAVSPDDITNVNC---TMLECPQPNDTPAYS---SQYCSGT  162
            S     +Q++T     MA+I+++ D+ T  N    T+  CP   +    S    +  +GT
Sbjct  81   SGTDAYLQVYTKCGMGMANISLTFDEFTAANPSSQTVRSCPALVNGATVSLLRQEAATGT  140

Query  163  QILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAVH  222
             + +V +C +D    +    F  ++   G   +  P  R+    W        ++  A+H
Sbjct  141  FLDDVIKCAMDL--QNLPDGFSSLLAQDGLGPSDVPQPRV----WRHQDKTAGWTKLAIH  194

Query  223  TVSSADDP--TWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWL---KD  277
            T+ S   P   W+ CP   G  + I+PC  R+   ++    +  P  +  +T WL   K 
Sbjct  195  TLPSNMYPEAAWSTCPSRPG--ARIIPCEPRNNRPESPNTCLPTPSAA--MTSWLTAVKA  250

Query  278  EFAVGDSSGFDElllipillsssCCDFDV------------------VSPNYL--GVVAH  317
                 D++G     ++ I   SS     +                   SP Y    +   
Sbjct  251  SLPAKDTTGLSTTNVVLIATISSVLLLALLGCCCLWRRRRRHAPSPPASPKYEPPAMDGS  310

Query  318  EQARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSK  377
                R   ATT   P+          +  +   + L     +   ++ ++ L +   L+ 
Sbjct  311  TDPSRYMEATTPPSPAQQPPSFARSESSVDVALRELYRDPSIASKQLVFKELDWIRILAA  370

Query  378  AASGEAWICQY------------------GRPTAFAEEIELTASLIHPHIVKFIGVAWN-  418
             A GE ++ QY                  G   AFAEEI L A   HP+IV F+G AW+ 
Sbjct  371  GAFGEVYLGQYRQKRIAIKRIQSIRIEVDGVVEAFAEEIRLMAHFRHPNIVAFLGFAWDL  430

Query  419  -SLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSR-SPAIIHR  476
             + S L  V EF+ EGDL+ +L  +  VL W+   ++ A+ VA AL+YLH    P IIHR
Sbjct  431  ETPSTLCAVTEFLHEGDLKAYLVAHP-VLPWSTKMVF-ALDVARALQYLHELLEPTIIHR  488

Query  477  DLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYS  535
            DLKS NILL+     KL DFG+SR  + D T+TAGVGT +++APEV++G +Y+++ADIYS
Sbjct  489  DLKSKNILLSLP-HAKLSDFGISREQINDDTLTAGVGTAFYSAPEVMKGLKYTKQADIYS  547

Query  536  FGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACL  595
            FG VL+E+DT +  Y +       K     IL +VM   LRP+ +  CP  I ++A  C 
Sbjct  548  FGCVLAEMDTHKSLYHEW------KFPAIAILNKVMHEHLRPAMTPTCPRAILQLAQQCF  601

Query  596  SFDPSDRPTAQELIQ  610
              DPS RPTA ++ +
Sbjct  602  DADPSQRPTASDIAR  616

>PHYRA_77379
Length=773

 Score = 221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 174/306 (57%), Gaps = 30/306 (10%)

Query  325  VATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAW  384
            VATT    ++S+ Q   +SA      +  +    ++  RI +  L F   L+K  SGE W
Sbjct  404  VATTRAEITLSNDQLCRKSA----ILRAFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVW  459

Query  385  ICQYGR---------PTA---------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMV  426
            + QY           PT          FAEEI + + L HP IV F GVAW SL +L  V
Sbjct  460  LGQYETRYVAMKCLLPTKREDPEALEQFAEEIRMASFLAHPRIVAFCGVAWQSLLHLCAV  519

Query  427  LEFVSEGDLQGFLHK--NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
             E++  GDL+  L        LSW  +++ ++  + EAL YLHS  P +IHRDLKS N+L
Sbjct  520  TEYMPRGDLENLLANPIAQKELSWNREKLTLSSDIVEALVYLHSLVPIVIHRDLKSKNVL  579

Query  485  LTEDLDPKLIDFGVSR--GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            L   L  KL DFG+SR   V D TMT G+GT  W+APEVLEG RY EK+D++SFGVVLSE
Sbjct  580  LDRRLRAKLSDFGLSRERSVED-TMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSE  638

Query  543  LDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDR  602
            +DT  +PY  +     AK+   Q++  V  G L P+F  DCPP I+ +A  CLS DP+ R
Sbjct  639  IDTCALPYGFS---RHAKMRSMQVVHLVSEGKLLPNFRDDCPPAIRALAQRCLSLDPAAR  695

Query  603  PTAQEL  608
            PTA E+
Sbjct  696  PTAMEV  701

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 78/170 (46%), Gaps = 22/170 (13%)

Query  93   PGLVQLAVLWDTGF--------GISPNGDP--VQIWTTGDFTMADIAVSPDD---ITNVN  139
            PGL+Q A+LWD+GF          S  GD   VQI+T+    M D+    ++   +TN +
Sbjct  89   PGLMQRALLWDSGFVFASAVDASSSSTGDTKLVQIYTSCGQGMGDLLPDVEELQTLTNSS  148

Query  140  CTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPH  199
            C +  C        +  + C   Q+L ++RC V          F G+ W+  G +T  P 
Sbjct  149  CKLQNC---GIIGHFLPENCPVKQVLPLTRCAVYASAMDTQTQFAGVFWAQDGRSTSVPE  205

Query  200  IRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCH  249
              LR H  + P T  + S++AVH   ++   T +  P+ N     I+PC 
Sbjct  206  PVLRRH--SPPATQPTDSLFAVHLTDASFTGTDSCQPLTN----FILPCR  249

>PHYCA_55944
Length=294

 Score = 208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 165/280 (59%), Gaps = 25/280 (9%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            ++ NRIP E +     +S+ A GE +   Y                       F  E +L
Sbjct  8    IISNRIPREKVKTLKLISRGAFGEVYTGLYNDDQVAVKMLLPNTRRDMKMVNEFLAEAKL  67

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVLSWAGDRIYMAV  457
            TA++ HP IV FIGVAW+S S+L +VLEF+  GDL+  L+   ++   + +  +++ +A+
Sbjct  68   TATMDHPRIVSFIGVAWDSFSDLCVVLEFMDGGDLRSLLNTYERSGHTVGFDREKVTIAL  127

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P++IHRDLKS NILL E  + K+ DFG+SR  +D TMTAGVGT  W 
Sbjct  128  HVAHALTYLHSLEPSVIHRDLKSRNILLNEMHEAKVTDFGISRERLDRTMTAGVGTSLWM  187

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPY----FDTVDHDGAKLMPFQILQEVMAG  573
            APEV+ G +Y +KADI+SFGVVLSELD   +PY    F+     G ++    +LQ V  G
Sbjct  188  APEVMTGEKYDDKADIFSFGVVLSELDLHTLPYTAARFEMQQSQGRQMTDATLLQGVAMG  247

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            T+  +FS      ++ +  AC+S DP++RP+A E +  L+
Sbjct  248  TICVNFSDTGVQSVKDLGNACVSVDPANRPSAAEALFKLQ  287

>PHYRA_77380
Length=690

 Score = 219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 160/271 (59%), Gaps = 20/271 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIEL  400
            +   RI Y+SL+F   +++ A+GE W    G                      F+ E+ L
Sbjct  402  ITSKRIAYDSLTFDKLIARGANGEVWRGTCGSQIVAIKQLLPEKRHDESNVMLFSNEVRL  461

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-KNSDVLSWAGDRIYMAVAV  459
             ++L HP+IV+F+G++WN + +L +V EF+ +GDL   L+ K    LSW+ +++ +A  +
Sbjct  462  ASALEHPNIVRFVGLSWNRVCDLCIVSEFMEQGDLSMLLNSKRKGELSWSKEKLQIATDI  521

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTA  518
            AEAL YLH R P IIHRDLKS N+LL   L  KL DFG+SR    D TMT GVGT  WTA
Sbjct  522  AEALAYLHGRQPIIIHRDLKSLNVLLDNRLRAKLSDFGLSRERSADDTMTNGVGTLLWTA  581

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PE+L G  YSEKAD+YS+ +VLSELDT   P+    +     L   Q++    +G + P 
Sbjct  582  PEILRGETYSEKADVYSYAIVLSELDTCLPPFALNSEVSERHLTTMQLMHLATSGQVSPQ  641

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
               DCP  +Q++ AAC SF+PS RP A E++
Sbjct  642  LRDDCPSSLQQLTAACASFEPSQRPNALEIV  672

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 71/153 (46%), Gaps = 9/153 (6%)

Query  62   SGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTG  121
            +G T+  V + +VP ++  RL    + ++ L G +Q A+LWDTG  ++  G  VQ++   
Sbjct  56   AGATAPQVVLMNVPDSLMTRLSEKSVRWSSLSGYLQRALLWDTGLVMTSGGRLVQVYAPC  115

Query  122  DFTMADIAVSPDDITNVNCTMLECPQPNDTPAY-SSQYCSGTQILNVSRCIVDTFEDSGA  180
               M +   + +   N +C +  C   + T  Y +   CS +     S+C V   E   A
Sbjct  116  GEDMDNSVQTFEAFQNRDCPLETC---DSTELYFAGSNCSRSTAWRASQCAVAAVE-VNA  171

Query  181  KDFL----GIMWSTGGDATMTPHIRLRDHTWTE  209
             D +      +WS  GD +  P IRL  HT  E
Sbjct  172  TDIIDAQSSTLWSEDGDFSSAPDIRLYRHTRDE  204

>PHYSO_520489
Length=608

 Score = 217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 164/276 (59%), Gaps = 23/276 (8%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------F  394
            L + + ++  RIP E +    ++S+   GE ++  + GR  A                 F
Sbjct  332  LWNDEIIVAARIPREKVLLHEKISRGGYGEVYVGTFNGRRVAIKMLLPETRKKIQSVNDF  391

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---D  451
              E++L ASL HP IV+FIGVAWNSL++L +V EF+  GDL+  L +       +G   +
Sbjct  392  LAEVKLMASLEHPRIVQFIGVAWNSLTDLCVVSEFMVGGDLRALLSRYIAEDRPSGFDYN  451

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            ++ +A+ VA AL Y+HS  P ++HRDLKS NILL  DLD KL DFG SR  +D TMTAGV
Sbjct  452  KVKIALHVAHALTYMHSLDPPMVHRDLKSKNILLNNDLDAKLTDFGASRERIDRTMTAGV  511

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GT  W APE++ G +YSEKAD++SFGVVLSELD+  +PY +     G +     +LQ VM
Sbjct  512  GTSLWMAPEMMTGEKYSEKADMFSFGVVLSELDSNALPYANA--GKGRQGSDLVVLQLVM  569

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQE  607
             G L+  FS  CP  I  +   C+S DP+ RP A +
Sbjct  570  QGKLQVEFSDSCPSIIAELGMGCVSRDPTARPAAAQ  605

>PHALS_09634
Length=353

 Score = 210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 157/277 (57%), Gaps = 22/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            +L +RIP + ++    +     GE +  +Y                      AF  E+ L
Sbjct  69   ILASRIPIDRINLGAVIGHGGFGEVYRGRYRDQDVAIKTLLPDKRKDLKHIQAFLSEVLL  128

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
             A++ HPHIV+FIGVAW SLS+L  V E ++ GDL+  L   H N        D++ +A 
Sbjct  129  MATMDHPHIVQFIGVAWESLSDLFCVTELMTGGDLRSLLKDYHDNRFPQGMNSDKMRIAY  188

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P ++HRDLKS NILLT +LD K+ DFG SR   D+TMTAGVG+  W 
Sbjct  189  QVAFALTYLHSMDPVVLHRDLKSRNILLTNNLDAKITDFGASRVRSDVTMTAGVGSSLWM  248

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMP-FQILQEVMAGTLR  576
            APEV+ G RY EKAD++S GVV+SELDT  +PY    +      +P   +LQ V  G LR
Sbjct  249  APEVMMGMRYGEKADVFSLGVVISELDTHELPYSHAKESSSGHPLPDTAVLQMVSLGKLR  308

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              FS    P + R   +CL+ DP  RPTA E++ +L+
Sbjct  309  VQFSPFMAPDLARFVDSCLNIDPRLRPTAAEVLYFLQ  345

>PPTG_10350
Length=593

 Score = 216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/282 (45%), Positives = 162/282 (57%), Gaps = 21/282 (7%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWI-CQYGRP-----------------TAF  394
            L + + +   RIP   +  +  LS+ A GE +    Y R                   AF
Sbjct  304  LWNDEVITAKRIPRNKVKVKKLLSRGAFGEVYSGVFYQRRVAVKMLPSSTRTSLQHVNAF  363

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG-DRI  453
              E ++TA++ HPHIV FIGVAW+SLS+L + LEF+  GDL+  L+K        G DR 
Sbjct  364  LTEAKITATMDHPHIVPFIGVAWDSLSDLCVALEFMEGGDLRALLNKYEASNHHVGFDRQ  423

Query  454  YMAVA--VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
              A+A  V  AL YLHS +  IIHRDLKS NILL   ++ KL DFG+SR  +D TMTAGV
Sbjct  424  KTAIALHVCHALAYLHSLASPIIHRDLKSKNILLNGAMEAKLSDFGISRQRLDETMTAGV  483

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVM  571
            GT  W APEV+ G RY EKAD++SFGVVLSELD   +PY    + +G +L    +LQ V 
Sbjct  484  GTSLWLAPEVMLGGRYDEKADMFSFGVVLSELDVHTLPYAQARESEGRELTDPSLLQRVA  543

Query  572  AGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             G +R  FS   P  I  +  AC+S DP DRPTA E +  L+
Sbjct  544  TGEIRVEFSYFSPRSIVNLGHACVSVDPGDRPTAAEALYRLQ  585

>PHYRA_82925
Length=611

 Score = 217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/284 (43%), Positives = 172/284 (61%), Gaps = 23/284 (8%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------F  394
            L   + +LG R+P E ++ Q  +S+   GE ++  Y G+  A                 F
Sbjct  319  LWRDEAILGARVPREKVAVQQLISRGGYGEVYVGTYNGQQVAVKMLLPETRKSKVHRISF  378

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---D  451
              E++L A+L HP IV  +GVAW+S ++L  ++EF+S GDL+  L+K       +G   +
Sbjct  379  LAEVKLMATLEHPRIVHLVGVAWDSPNDLCALIEFMSGGDLRTLLNKYEAENRPSGFTYE  438

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            ++ +A+ VA AL YLHS  P +IHRDLKS NILL+++LD KL DFG+SR  +D TMTA V
Sbjct  439  KVKIALHVAHALTYLHSLDPPVIHRDLKSKNILLSKELDAKLTDFGISRERVDRTMTAAV  498

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQE  569
            GT  W +PEV+ G RY++KADI+SFGVVLSEL+T  +PY      DG+  +L    ILQ 
Sbjct  499  GTSLWMSPEVMMGERYNDKADIFSFGVVLSELNTHSMPYAHAKSRDGSGGRLPDTAILQL  558

Query  570  VMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            V AG LR  FS      + ++  AC+S DP  RP+A E++  L+
Sbjct  559  VAAGRLRADFSQGGQDALMQLGLACVSVDPKARPSAPEVLYHLQ  602

>PHYCA_509624
Length=567

 Score = 216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/297 (41%), Positives = 173/297 (58%), Gaps = 27/297 (9%)

Query  342  ESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYG------------  389
            E+A S QT   L +   +   R+P + +  +  LS+ A GE +   +             
Sbjct  264  EAAMSGQTG--LWNDDVITAKRVPRDKVKVKKLLSRGAYGEVYTGVFNGQQVAVKMLLPS  321

Query  390  ------RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS  443
                    T F  E +LTAS+ HPHIV F+GVAW+SLS+L ++LEF+  GDL+  L+K  
Sbjct  322  TRGNLQHVTDFLTEAKLTASMDHPHIVTFVGVAWDSLSDLCVILEFMDGGDLRSLLNKYE  381

Query  444  DVLSWAG---DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR  500
                  G   ++  +A+ V  AL YLHS  P +IHRDLKS NILL + ++ KL DFG+S+
Sbjct  382  ATKHPVGVDREKATIALHVCHALTYLHSLIPPVIHRDLKSRNILLNKGMEAKLTDFGISK  441

Query  501  GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD----TVDH  556
              +D TMTAGVGT  W APEV+ G  Y  KADI+SFGVVLSELD   +PY      ++D 
Sbjct  442  ERLDQTMTAGVGTSLWMAPEVMLGENYDVKADIFSFGVVLSELDVHTLPYAQAKQRSLDT  501

Query  557  DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            +G K+    +LQ++ AG +R  FS   P  +  + +AC++ +P+DRPTA E +  ++
Sbjct  502  NGRKMADATLLQKITAGEVRVDFSDTSPQAMVELGSACIAVNPADRPTAAEALYRIQ  558

>PHYCA_105269
Length=652

 Score = 217 bits (553),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 160/272 (59%), Gaps = 20/272 (7%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIE  399
            ++   RI Y+ L+F+  +++ A+GE W    G                      F+ E+ 
Sbjct  363  NITSKRISYDFLTFEKLIARGANGEVWRSTCGSQVVAIKQLLPEKRNDETNVMLFSNEVR  422

Query  400  LTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-KNSDVLSWAGDRIYMAVA  458
            L A+L HP+IV+F+G++W+ + +L +V EF+ +GDL   L+ K+ D LSW  +++ +A  
Sbjct  423  LAAALEHPNIVRFVGLSWSRVCDLCIVSEFMEQGDLSVLLNSKHKDELSWHKEKLAIATD  482

Query  459  VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWT  517
            +AEAL YLH R P IIHRDLKS N+LL   L  KL DFG+SR    + TMT GVGT  WT
Sbjct  483  IAEALAYLHGRQPIIIHRDLKSLNVLLDNRLRAKLSDFGLSRERSSNDTMTNGVGTLLWT  542

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRP  577
            APE+L G  YSEKAD+YS+ +VLSELDT   PY    +         Q++    +G + P
Sbjct  543  APEILRGEAYSEKADVYSYAIVLSELDTCLPPYTLNTEVSERNFTTMQLIHLATSGQVSP  602

Query  578  SFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
                DCP  +Q++  AC SFDP+ RP A E++
Sbjct  603  KLRDDCPAPLQQLTTACASFDPTQRPNALEIV  634

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 58/235 (25%), Positives = 97/235 (41%), Gaps = 32/235 (14%)

Query  69   VSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTTGDFTMADI  128
            + + +VP ++  RLD   + +  L G +Q A+LW+TG  ++  G  VQ++   D  M+  
Sbjct  22   IVLANVPESLFKRLDEKSVKWDALSGYLQRALLWETGLVMTSGGRLVQVYVPCDEDMSVT  81

Query  129  AVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGI--  186
                D   + +C +  C        ++   CS T +   ++C +   E   A D +    
Sbjct  82   LAPYDAFLDKDCPLETCQSSG--LYFTDSTCSLTTVWKAAQCGIHASE-KNASDIVDAKG  138

Query  187  --MWSTGGDATMTPHIRLRDHTWTEPTTG------VSYSVYAVHTVSSADDPTWNQ----  234
              +WS  GD T  P IRL  H   + T        V    +  +TV +    T NQ    
Sbjct  139  SSLWSEDGDLTSAPDIRLYKHVRVDNTGSGDTEDEVGSGQFGNYTVQTDVLFTINQIAPI  198

Query  235  ------CPVNNGYSSLIVPCHKRSEFSDAEMAAVNK---PRGSEWVTMWLKDEFA  280
                  CPV+  +   + PC    +F D +    N    P+   +V +WL  E +
Sbjct  199  PSTIESCPVDPFF---VAPC---VQFHDPDEMPENPWCLPKRGGFVDLWLDSELS  247

>HYAP_01725
Length=379

 Score = 210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/329 (39%), Positives = 182/329 (55%), Gaps = 38/329 (12%)

Query  322  RGTVATTS---YGPSISSHQGDYES--------AGSNQTFKILLHS----QHLLGNRIPY  366
            RG +  T+    GP++SS   +Y+         A S     I+++       ++  RIP 
Sbjct  32   RGQIPPTTCSFIGPALSSLTANYQRLRRTFIVPAASTIRRTIMMNRPWEDDFVIAARIPR  91

Query  367  ESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASLIHPH  408
            + ++    LS+   G  +   Y GR  A                    E+++ AS+ HPH
Sbjct  92   DKVTVDQLLSRGGFGVVYSGLYNGRRVAVKMLLPETRRNISHVINLLAEVKMMASMEHPH  151

Query  409  IVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVLSWAGDRIYMAVAVAEALEY  465
            IV+FIGVAW+SL+N+ +V EF++ GDL+  L    +    + ++ D++ +A+ +A AL Y
Sbjct  152  IVEFIGVAWDSLTNMCVVSEFMAGGDLKALLSDYDEQKHPMGFSRDKLRIALHIAHALMY  211

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGA  525
            LHS  P IIHRDLKS N+LL E L+ KL DFG SR  ++ +MT GVGT  W APEV+ G 
Sbjct  212  LHSLDPPIIHRDLKSKNVLLNEKLEAKLTDFGTSRERVNESMTGGVGTCLWMAPEVMIGD  271

Query  526  RYSEKADIYSFGVVLSELDTGRIPYFDTVD-HDGAKLMPF-QILQEVMAGTLRPSFSVDC  583
            RY +KAD++SFGVVLSELDT   PY+   D  D ++ MP   ILQ V  G LR  FS   
Sbjct  272  RYDDKADMFSFGVVLSELDTHAFPYWQARDPTDSSRPMPEPAILQMVATGKLRVQFSKQA  331

Query  584  PPRIQRIAAACLSFDPSDRPTAQELIQWL  612
               +  +  AC+S DP  RPTA E +  L
Sbjct  332  CKAVVELGTACVSLDPKARPTASEALYKL  360

>PHALS_02415
Length=731

 Score = 218 bits (556),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 124/314 (39%), Positives = 175/314 (56%), Gaps = 34/314 (11%)

Query  333  SISSHQGDYESAGSNQTFKI----------LLHSQHLLGNRIPYESLSFQMELSKAASGE  382
            S+S     Y S   N T  I          LL    ++ NR+ +  ++ +  LS+   G 
Sbjct  406  SVSLPAAYYLSQSGNNTINIQTSDTNSIETLLKDPLIINNRLNFSEITLRKCLSRGGFGL  465

Query  383  AWICQYG---------RP---------TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLS  424
             ++ ++          RP          AF  EI L A L HP IV++IGVAW+ L  +S
Sbjct  466  VFLGEFKGRQVAVKKIRPDRSNDPQDLKAFLREIILMARLSHPRIVEYIGVAWDRLQQIS  525

Query  425  MVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSN  481
             V E++  GDL+  L    +  + L+W   +I +A+ +AEAL+YLHS +P +IHRDLKS 
Sbjct  526  AVTEYMESGDLRHVLRTYQRQGNPLTWTTSKISIALHIAEALQYLHSHTPKVIHRDLKSK  585

Query  482  NILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLS  541
            N+L+   L+ KL DFGV+R +    MTAG+GT +W APEVL G  Y E+ADIYSFGVVLS
Sbjct  586  NVLINMHLEAKLTDFGVAR-MQSHAMTAGIGTSFWIAPEVLLGREYDEQADIYSFGVVLS  644

Query  542  ELDTGRIPYFDTVDHDG--AKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDP  599
            E+DT   P+++  + +    KL    IL++V+ G  RP FS DCP  I  IA  CL  +P
Sbjct  645  EIDTNDYPFWNDANCNSPRGKLQEADILRQVVTGNKRPQFSPDCPDGILSIATVCLQENP  704

Query  600  SDRPTAQELIQWLE  613
             DRP A  ++  L+
Sbjct  705  KDRPNALAVVAALQ  718

>SDRG_15865
Length=627

 Score = 216 bits (551),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 195/619 (32%), Positives = 288/619 (47%), Gaps = 84/619 (14%)

Query  52   IARQLYTRHRSGDTSAAVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGF---GI  108
            +AR      R  +  A      VP  VT RL  L + +  LP LV+ A+LWD G     +
Sbjct  11   VARFRSLDERKVNAGAVAFPAPVPETVTARLAPLGLTWDVLPTLVRQALLWDLGLVVGNV  70

Query  109  SPNGDPVQIWTTGDFTMADIAVSPDDITNVNC---TMLECPQPNDTPAYS---SQYCSGT  162
            S     +Q++T     MA+I+++ D+ T  N    T+  CP   +    S    +  +GT
Sbjct  71   SGTDAYLQVYTKCGMGMANISLTFDEFTAANPSSQTVRSCPASVNGATVSLLRQEAATGT  130

Query  163  QILNVSRCIVDTFE-DSGAKDFLGIMWSTGGDATMTPHIRLRDHTWTEPTTGVSYSVYAV  221
             + +V +C +D      G+   L      G   +  P  R+    W        ++  A+
Sbjct  131  FLDDVIKCAMDLQNLPDGSSSLLA---QDGLGPSDVPQPRV----WRHQDKSAGWTKLAI  183

Query  222  HT--VSSADDPTWNQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWL---K  276
            HT  VS   +  W+ CP     ++ I+PC  R+   ++    +  P  S  +T WL   K
Sbjct  184  HTLPVSLYPEAAWSTCPSRP--AARIIPCEPRNNRPESLNTCLPTP--STAMTSWLTAVK  239

Query  277  DEFAVGDSSGFDElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTS--YGPSI  334
                  DS+G   L    I+L ++ C   VV    LG     + R      +S  Y   I
Sbjct  240  ASLPAKDSTG--GLSTTNIVLIATICG--VVLLALLGCCLWRRRRHAPSPPSSPKYEQPI  295

Query  335  SSHQGDYES-----------------AGSNQTFKILLHSQH----LLGNRIPYESLSFQM  373
                 D                    A S  + ++ LH  +    +   ++ Y+ L +  
Sbjct  296  VDGSTDPSRYMEATTPPSPAQQPPSFARSGSSVEVALHELYRDPSVACKQLVYKELDWIR  355

Query  374  ELSKAASGEAWICQY------------------GRPTAFAEEIELTASLIHPHIVKFIGV  415
             L+  A GE ++ QY                  G   AFAEEI L A   HP+IV F+G 
Sbjct  356  ILAAGAFGEVYLGQYRQKRIAIKRIQSIRIEIEGVVEAFAEEIRLMAHFRHPNIVAFLGF  415

Query  416  AWN--SLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSR-SPA  472
            AW+  S S L  V E++ EGDL+ +L  N  VL W+   ++ A+ VA AL+YLH    P 
Sbjct  416  AWDLTSPSTLCAVTEYLPEGDLKAYLLANP-VLPWSTKMVF-ALDVARALQYLHELLEPT  473

Query  473  IIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKA  531
            IIHRDLKS NILL      KL DFG+SR  + D T+TAGVGT +++APEV++G +Y+++A
Sbjct  474  IIHRDLKSKNILLALP-HAKLSDFGISREQINDDTLTAGVGTAFYSAPEVMKGLKYTKQA  532

Query  532  DIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIA  591
            DIYSFG VL+E+DT +  Y +       K     IL +VM   LRP+ +  CP  I  +A
Sbjct  533  DIYSFGCVLAEMDTHKSLYHEW------KFPAIAILNKVMHENLRPAMTATCPRAILELA  586

Query  592  AACLSFDPSDRPTAQELIQ  610
              C   DP+ RPTA ++ +
Sbjct  587  RQCFHADPNQRPTASDIAR  605

>PHYRA_83084
Length=494

 Score = 213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 145/225 (64%), Gaps = 5/225 (2%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---  450
            F  E++L ASL HP IV+F+GVAWN+LS++  V E++  GDL+G L   +D     G   
Sbjct  263  FLAEVKLMASLDHPCIVQFVGVAWNALSDICAVTEYMEGGDLRGLLASYNDQQYPTGFDN  322

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
            D++ +A+  A AL YLHS  P +IHRDLKS NILLT DLD KL DFGVSR   D TMTAG
Sbjct  323  DKVKIALHTAHALTYLHSMKPVVIHRDLKSRNILLTSDLDAKLTDFGVSRERADHTMTAG  382

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQ  568
            VGT  W APEVL G RY +KADI+SFGVVLSELD   +PY    + DG+  ++    ILQ
Sbjct  383  VGTSLWMAPEVLMGERYDDKADIFSFGVVLSELDMHVLPYSHATESDGSGRRMRDLAILQ  442

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +  G LR  FS      +  +   C+S +P DRPTA +++  L+
Sbjct  443  RMATGKLRVQFSPGAMHSMVALGNECVSVNPKDRPTAAQVLYKLQ  487

>PHYCA_505168
Length=564

 Score = 215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 169/517 (33%), Positives = 247/517 (48%), Gaps = 101/517 (20%)

Query  185  GIMWSTGG--DATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYS  242
            G +WS  G  DA+  P I      +   +   +  + A  +  S +D T   CP     +
Sbjct  54   GPLWSMDGQVDASFDPQI----FEYEGNSENTTLFLLAPKSSWSMNDET---CP---NAA  103

Query  243  SLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAV----GDSSGFDElllipills  298
              IVPC   +  +DA+     +P+    V +W++ E+A     GD SG      + ILL 
Sbjct  104  QFIVPCQSVTVKADAQQEKWCEPKIDIGVKLWVEKEYASIVTGGDDSGSKVSSAVAILLG  163

Query  299  ssCCDFDVVS----------------------PNYLGVVAH----EQARRGTVA---TTS  329
                 F V +                       N   V AH    EQ ++G V+    ++
Sbjct  164  VLLGIFVVAAIVFFFMWRRSKSFSKDGLHENEQNTFFVQAHSFHGEQRQQGNVSGQYISN  223

Query  330  YGPSISSHQGDYESAGSNQTFKI-------LLHSQHLLGNRIPYESLSFQMELSKAASGE  382
             GP   S +   +    N++F++           Q L+  RI +  + ++ +++   +GE
Sbjct  224  NGPH-PSFENAMQIEAINESFRMRSPELAAFCDDQELMLKRIAFAGIIYREKMTSGPNGE  282

Query  383  AWICQY-GRPTA----------------------------------------FAEEIELT  401
             W  +Y G+  A                                        F +EI + 
Sbjct  283  VWRGEYEGQQVAIKCTVAAAVASAAAANASRNSAAMNASALLGDKEIKALEDFTKEIRMA  342

Query  402  ASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK-NSDVLSWAGDRIYMAVAVA  460
            A L HP+IV+F+G++W +L +L MV E+V  GDL  FL + +S  L+W  D++ +A  ++
Sbjct  343  AFLEHPNIVRFVGLSWRTLPDLCMVSEYVPLGDLAHFLAQPDSKQLTWRDDKLPIAADIS  402

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTAP  519
             AL YLHS SP ++HRDLKS N+LLTEDL  K+ DFG+SR    D TMT+GVGT  WTAP
Sbjct  403  NALVYLHSLSPVVLHRDLKSLNVLLTEDLQAKVSDFGLSRETSFDETMTSGVGTLLWTAP  462

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTV---DHDGAKLMPFQILQEVMAGTLR  576
            EVL G RYSEKADIYSFGVVL+ELDT   PY  +     + G   M +  L  + +G   
Sbjct  463  EVLRGERYSEKADIYSFGVVLAELDTCLPPYAYSQGGRKNKGKNDMDWVPL--IASGRAS  520

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            P F  DCP  I+ +AA CL  DP+ RP A +++  L 
Sbjct  521  PPFRPDCPRAIRDLAAQCLDQDPNKRPPAMQIVYMLR  557

>PHYRA_95777
Length=314

 Score = 207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 158/274 (58%), Gaps = 23/274 (8%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIELTASL  404
            RIP E+L  Q  +++   GE ++  Y GR  A                 F  EI++  S+
Sbjct  18   RIPMENLRVQQLINRGGFGEVFLGTYRGRAVAVKRLLPDRRKNMREVEAFIVEIKIMLSM  77

Query  405  IHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK----NSDVLSWAGDRIYMAVAVA  460
             HP IV  +GVAW S +++S V E++  GDL+  L +          +  D++ +A+ VA
Sbjct  78   DHPRIVGCLGVAWESWTDISAVTEYMEGGDLRTVLERFEQQEHRAHGFDDDKLNIALHVA  137

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPE  520
            + L YLH   P ++HRDLKS NILL ++LD KL DFGVSR   D+TMTAGVGT  W APE
Sbjct  138  QGLTYLHGMDPIVLHRDLKSKNILLNKNLDAKLTDFGVSRESADITMTAGVGTSLWMAPE  197

Query  521  VLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD-GAKLMPFQILQEVMAGTLRPSF  579
            V+ G RY+EKAD++SFGVVL ELD  ++PY    +   G KL    ILQ V AG LR   
Sbjct  198  VMIGDRYNEKADMFSFGVVLGELDCQQLPYSHAKESGTGRKLPGTAILQMVAAGQLRLEM  257

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            S   P  I  +  AC S DPSDRPTA E  + L+
Sbjct  258  SEASPSGIYDLVMACTSLDPSDRPTAAEAFERLQ  291

>H257_17421
Length=406

 Score = 210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 163/276 (59%), Gaps = 20/276 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQ-YGRPTA-----------------FAEEIEL  400
            LL  ++ Y  + +  +LSK A GE W+ Q +G   A                 F  EI L
Sbjct  120  LLKAKVDYADIHYTRKLSKGAFGEVWLGQCHGNYVAIKQILEERKHDAKEIECFVAEIRL  179

Query  401  TASLIHPHIVKFIGVAWNSLS-NLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAV  459
             A+  HP+IV F G +WN  + N+  + E++  GDL  +L +N   L+W  +++ +A+ +
Sbjct  180  MATFKHPNIVDFRGFSWNPKNGNMCALTEYMKHGDLFVYLQRNKAGLAWKHEKVGIAIDI  239

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTA  518
            A+AL YLHS SP +IHRDLKS N+LL ++   KL DFG+SR   ++ TMTAGVGT  W A
Sbjct  240  AQALVYLHSLSPKVIHRDLKSKNVLLDDNFTAKLSDFGISRLRQLEETMTAGVGTALWAA  299

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PEV    +Y+++AD+YS GVVLSELDT  IPY D       KL    +++ V     +P+
Sbjct  300  PEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAVIKLVTQQKAKPT  359

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            FS  CP  ++ +A  CL ++P +RP+A E+++ L+ 
Sbjct  360  FSRSCPEEVRALAFRCLDYEPDNRPSAAEVVEILKN  395

>PHYCA_503450
Length=452

 Score = 212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 159/283 (56%), Gaps = 31/283 (11%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            +L +RIP + +     +S+   GE +  +Y                      AF  E+ L
Sbjct  165  ILASRIPIDRIQLGTVISRGGFGEVYRGRYRDADVAVKTLLPEKRKDLAHIQAFLLEVRL  224

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWA------GDRIY  454
             A++ HPHIV+FIGVAW SLS+L  V EFV+ GDL+  L    D L+          ++ 
Sbjct  225  MATMEHPHIVQFIGVAWESLSDLFCVSEFVAGGDLRSLL---KDYLATGVPQGMDASKMQ  281

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTP  514
            +A  VA AL YLHS  P ++HRDLKS NILLTE LD KL DFG SR   D TMTAGVG+ 
Sbjct  282  IAYQVAYALTYLHSLDPVVLHRDLKSRNILLTESLDAKLTDFGASRIRSDTTMTAGVGSS  341

Query  515  YWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD----GAKLMPFQILQEV  570
             W APEV+ G RY EKAD++S GVV+SELDT  +PY    + +    G +L    +LQ V
Sbjct  342  LWMAPEVMMGQRYGEKADVFSLGVVISELDTHELPYSHAKEGNSGSSGHQLPDTAVLQMV  401

Query  571  MAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              G LR  FS    P + R    C++ DP  RPTA E++ +L+
Sbjct  402  SMGKLRVRFSPFMAPDMARFVGNCVNVDPQSRPTAAEVLYYLQ  444

>PITG_06481
Length=658

 Score = 216 bits (551),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 158/266 (59%), Gaps = 20/266 (8%)

Query  364  IPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIELTASLI  405
            I Y+SL+    +++ A+GE W    G                      FA E+ L A+L 
Sbjct  375  IAYDSLTLDRLIARGANGEVWRGTCGSQVVAIKQLLPEKRHDECHVMLFANEVRLAAALE  434

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH-KNSDVLSWAGDRIYMAVAVAEALE  464
            HP+IV+F+G++WN + +L +V EF+ +GDL   L+ K  + L+W  +++ +A  +AEAL 
Sbjct  435  HPNIVRFVGLSWNRMCDLCIVSEFMEQGDLSVLLNSKKGNELTWGKEKLGIATDIAEALA  494

Query  465  YLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWTAPEVLE  523
            YLH R P IIHRDLKS N+LL   L  KL DFG+SR    D TMT GVGT  WTAPE+L 
Sbjct  495  YLHGRQPIIIHRDLKSLNVLLDSRLRAKLSDFGLSRERSSDDTMTNGVGTLLWTAPEILR  554

Query  524  GARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDC  583
            G  YSEKAD+YS+ +VLSELDT   P+    +    +L   Q++    +G + P    DC
Sbjct  555  GEAYSEKADVYSYAIVLSELDTCLPPFTLNTEVSERRLTTMQLMHLATSGEVSPQLREDC  614

Query  584  PPRIQRIAAACLSFDPSDRPTAQELI  609
            P  +Q++ AAC SF+P+ RP A E++
Sbjct  615  PASLQQLTAACASFEPNQRPNALEIV  640

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 101/237 (43%), Gaps = 21/237 (9%)

Query  62   SGDTSA-AVSIKSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGISPNGDPVQIWTT  120
            +GDT+A  V + +VP ++  RL    + +  L G +Q A+LWD G  ++  G  VQ+   
Sbjct  51   NGDTAAPQVVLSNVPNSLFKRLSEKSVRWDALSGYLQRALLWDAGLVMTSGGRLVQVHVP  110

Query  121  GDFTMADIAVSPDDITNVNCTMLECPQPNDTPAYSSQYCSGTQILNVSRCIVDTFEDSGA  180
             D  M+ I  + +     +C +  C        ++   CS   +   ++C +   E++ A
Sbjct  111  CDEDMSVILTTFEAFRGKDCPLETCESTQ--LYFAGSTCSRATVWEAAQCGIYASEEN-A  167

Query  181  KDFLG----IMWSTGGDATMTPHIRLRDHTWTEPT--TGVSYSVYAVHTVSSADDP----  230
             D +      +WS  G  +  P +RL  HT  + +   G+   V +  T +   D     
Sbjct  168  TDIVNEESSALWSEDGRLSSVPDVRLYKHTLGDSSGLNGIEEVVGSGSTGNYTIDADVLF  227

Query  231  TWNQC-PVNNGYSS------LIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFA  280
            T NQ  P+ N   +       + PC +  +  ++       P+   +V +WL  E +
Sbjct  228  TINQIDPLPNSIDNCPSDPFFVAPCVQFYDLDESPENPWCLPKRGGFVDLWLDREMS  284

>PHYCA_570505
Length=472

 Score = 212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 121/320 (38%), Positives = 181/320 (57%), Gaps = 28/320 (9%)

Query  319  QARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
            + RR          S+  H   ++S  +  T   +++   ++ +RIP++ +     ++K 
Sbjct  127  RQRRAHNRRKERDESVFDHTLSFDSHFTANTN--IINDPLIIAHRIPFKDVKVANCINKG  184

Query  379  ASGEAWICQYGRPT------------------AFAEEIELTASLIHPHIVKFIGVAWNSL  420
              G  +   Y R                    AF +EI L ++L HP IV+FIGVAW++L
Sbjct  185  GFGLVYSGVYNRRRVAIKRIRTDLCQDMKHVEAFMKEICLISTLEHPRIVEFIGVAWDTL  244

Query  421  SNLSMVLEFVSEGDLQGFLH----KNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHR  476
             NLS V E++  GDL+  LH    +N+ V +W   ++ +   +AEAL YLHS  P +IHR
Sbjct  245  RNLSAVTEYMERGDLREVLHSFQLRNTPV-TWDAHKLRITQHIAEALTYLHSLDPKLIHR  303

Query  477  DLKSNNILLTEDLDPKLIDFGVSR--GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIY  534
            DLKS N+LL  +++ KL DFGVSR    M+  MTAG+GT +W APEVL G  Y E+ADI+
Sbjct  304  DLKSKNVLLNTEMEAKLSDFGVSRERHAMETHMTAGIGTSFWIAPEVLLGKDYDERADIF  363

Query  535  SFGVVLSELDTGRIPYFDTVD-HDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAA  593
            S G+V+SE+DT   PY++  +   G K+    IL+ V AG L P F+  CP  +  +A A
Sbjct  364  SLGIVISEIDTEDYPYWNAKNPPQGGKVEETAILRMVAAGELIPDFTEGCPKAVLELAKA  423

Query  594  CLSFDPSDRPTAQELIQWLE  613
            CLS +P DRP+A E++  ++
Sbjct  424  CLSLNPDDRPSATEVVYAIQ  443

>PHYCA_129660
Length=289

 Score = 206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 160/276 (58%), Gaps = 23/276 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            ++  RIP E +     +S+   GE ++  Y GR  A                 F  E++L
Sbjct  7    IVAARIPREKVLMHERISRGGFGEVYVGVYNGRKVAIKMLLPEIRKRIQSVNEFLVEVKL  66

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAGDRIYMAV  457
             A+L HP IV+FIGVAW+SL++L +V E +  GDL+  L +    +    +  D++ +A+
Sbjct  67   MAALEHPRIVEFIGVAWDSLTDLCVVSELMERGDLRALLSQFQAENHPHGFDHDKVKIAL  126

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL Y+HS SP I+HRDLKS NILLT + D KL DFG SR  +D TMTAGVGT  W 
Sbjct  127  HVAHALTYMHSFSPPIVHRDLKSKNILLTNEFDAKLTDFGASRERVDRTMTAGVGTSLWM  186

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRP  577
            APE++ G +Y EKAD++SF VVLSELD+  +PY  T      +     ILQ V+ G  + 
Sbjct  187  APEIMAGEKYDEKADMFSFAVVLSELDSHVLPY--TKLRQETRASDVAILQLVLQGKTQI  244

Query  578  SFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             FS  CP  I  +  AC + DP+ RPTA + +  L+
Sbjct  245  DFSDACPSSIAALGMACAAKDPTARPTAAQALYELQ  280

>PHYCA_572415
Length=358

 Score = 208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/274 (43%), Positives = 157/274 (57%), Gaps = 22/274 (8%)

Query  362  NRIPYESLSFQMELSKAASGEAW---------ICQYGRP---------TAFAEEIELTAS  403
             RIP   +  +  +S+ A GE +           +   P           F  E +L+A 
Sbjct  77   KRIPRRDIQIRQLISRGAYGEVYEGFFEDTRVAVKMLSPETRSVISFVNGFLAEAKLSAG  136

Query  404  LIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAVAVA  460
            + HP+IV FIGVAW SLS+L +VLEF++ GDL+  L+K  +     G    +  +A+ V 
Sbjct  137  MNHPNIVSFIGVAWKSLSDLCIVLEFMAGGDLRTLLNKYQESNHPMGIDRQKATIALQVC  196

Query  461  EALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPE  520
             AL YLHS +P ++HRDLKS NILL+  LD KL DFG+S+  +D TMTAGVGT  W APE
Sbjct  197  HALTYLHSLAPPVLHRDLKSRNILLSRSLDAKLTDFGISKENLDRTMTAGVGTSLWMAPE  256

Query  521  VLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQI-LQEVMAGTLRPSF  579
            V+ G RY  KADI+SFGVVLSELD   +PY +  D +    +P  + LQ+V  G L   F
Sbjct  257  VMLGERYGAKADIFSFGVVLSELDLHTLPYTEMTDQNQTSRLPEAVLLQQVAMGKLSVGF  316

Query  580  SVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            S   P  I  +   C+S DP+ RPTA E +  L+
Sbjct  317  SKSNPQSIVDLGRVCVSIDPNRRPTAAEALYKLQ  350

>PHYSO_546345
Length=672

 Score = 216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/344 (40%), Positives = 186/344 (54%), Gaps = 50/344 (15%)

Query  315  VAHEQARRGTVATTSYGPS---------ISSHQGDYESAGSNQTFKILLHSQHLLGNRIP  365
            V H+Q RR     T+ G           I++ Q  Y S         LL+   ++  R+ 
Sbjct  296  VQHQQERRRKKGLTTPGAEDVQTSRAADITATQEFYNSLHPTLNAD-LLNDPLIMSFRLK  354

Query  366  YESLSFQMELSKAASGEAWICQYG-RPTA-----------------FAEEIELTASLIHP  407
            Y+ L     +SK   G  +   Y  R  A                 F  EI L  SL H 
Sbjct  355  YKDLHIGRCISKGGFGLVYTGMYKHRRVAIKKIMREKCEKLSQIRMFIREITLMGSLKHE  414

Query  408  HIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH----KNSDV----LSWAGDRIYMAVAV  459
             IV+FIGVAW+SL NLS V E++  GDL+  LH    + S+V    L+W G ++ +A+ +
Sbjct  415  RIVEFIGVAWDSLRNLSAVTEYMERGDLRDVLHTLKHQGSNVDHQGLTWNGKKLTIALHI  474

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRG--VMDLT------MTAGV  511
            AE L Y+HS +P +IHRDLKS N+LL  D + KL DFGVSR   V D+       MT GV
Sbjct  475  AEGLAYMHSLNPKVIHRDLKSKNVLLNNDYEAKLSDFGVSRKRLVADVNGGPGRFMTPGV  534

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTV------DHDGAKLMPFQ  565
            GT +W APEVL G  Y E AD++SFGVVLSE+DT   PY+++       DHD  +    +
Sbjct  535  GTSFWIAPEVLLGRDYDEHADVFSFGVVLSEIDTDDYPYWNSGSIPAQDDHDERRSQEQK  594

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
            IL++V  G+LRP+F  DCPP +  +AA+CL   P +RP+A E++
Sbjct  595  ILEKVALGSLRPTFYNDCPPGVLALAASCLEGRPENRPSAAEVV  638

>PHYCA_503455
Length=469

 Score = 212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 159/283 (56%), Gaps = 31/283 (11%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            +L +RIP + +     +S+   GE +  +Y                      AF  E+ L
Sbjct  182  ILASRIPIDRIQLGTVISRGGFGEVYRGRYRDADVAVKTLLPEKRKDLAHIQAFLLEVRL  241

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWA------GDRIY  454
             A++ HPHIV+FIGVAW SLS+L  V EFV+ GDL+  L    D L+          ++ 
Sbjct  242  MATMEHPHIVQFIGVAWESLSDLFCVSEFVAGGDLRSLL---KDYLATGVPQGMDASKMQ  298

Query  455  MAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTP  514
            +A  VA AL YLHS  P ++HRDLKS NILLTE LD KL DFG SR   D TMTAGVG+ 
Sbjct  299  IAYQVAYALTYLHSLDPVVLHRDLKSRNILLTESLDAKLTDFGASRIRSDTTMTAGVGSS  358

Query  515  YWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD----GAKLMPFQILQEV  570
             W APEV+ G RY EKAD++S GVV+SELDT  +PY    + +    G +L    +LQ V
Sbjct  359  LWMAPEVMMGQRYGEKADVFSLGVVISELDTHELPYSHAKEGNSGSSGHQLPDTAVLQMV  418

Query  571  MAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              G LR  FS    P + R    C++ DP  RPTA E++ +L+
Sbjct  419  SMGKLRVRFSPFMAPDMARFVGNCVNVDPQSRPTAAEVLYYLQ  461

>SPRG_02180
Length=492

 Score = 212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 145/229 (63%), Gaps = 10/229 (4%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRI  453
            F  EI L+ASL HP+IV F+G+ W S+ NLS + E +S GDL  FL + S  L+W G  +
Sbjct  261  FMAEIRLSASLEHPNIVAFVGMTWTSVYNLSAIYELMSHGDLWQFL-RRSHGLTWHGPGV  319

Query  454  YMAVA---VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
              A     V  AL YLH+ SP ++HRDLK+ N+LL +    KL DFG SR   D TMTA 
Sbjct  320  SKASILRDVVAALVYLHALSPMVVHRDLKAKNVLLNDAYVAKLGDFGTSRECADHTMTAE  379

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD------TVDHDGAKLMPF  564
            +GT  W APEVL+G RYSEKADIYSFGV++SE+DT ++PY +      + D     L   
Sbjct  380  IGTVPWIAPEVLKGTRYSEKADIYSFGVLVSEVDTVKVPYSNVHDCCPSADGTSVALASA  439

Query  565  QILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             I   V+ GTL+PSFS  CP  +  IA  CLS+DP DRP+A +L  WL+
Sbjct  440  NIAMRVVKGTLQPSFSPSCPSVVLDIARQCLSYDPDDRPSAAQLAAWLQ  488

>PHYSO_354036
Length=437

 Score = 211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 159/277 (57%), Gaps = 23/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            ++  RIP + +     LS+   GE +  +Y                      AF  EI+L
Sbjct  148  IVAARIPVDRVELGELLSRGGFGEVYRGRYRDQNVAVKTLLPSTRKDMNHIEAFLSEIKL  207

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
             A++ HP IV+FIGVAW SLS L  V EF+  GDL+  L   ++N     +   +I MA+
Sbjct  208  MATMEHPQIVQFIGVAWESLSELYAVSEFMEGGDLRTLLIKYYENDHPRGFDPAKIKMAL  267

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P ++HRDLKS NILLT+ LD K+ DFG SR   D TMTAGVGT +W 
Sbjct  268  QVAHALTYLHSLDPVVLHRDLKSRNILLTDSLDAKITDFGASRERSDKTMTAGVGTSFWM  327

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD--GAKLMPFQILQEVMAGTL  575
            APEV+ G +Y  KAD++SFGVVLSELDT  +PY    ++   G  L    +LQ V+ G L
Sbjct  328  APEVVLGEQYGAKADVFSFGVVLSELDTHELPYSHAKENSETGRPLPDAAVLQLVLMGRL  387

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            +  FS   P  + ++A  CL  +P DRPTA E++  L
Sbjct  388  QVQFSDVGPTEMTQLAQQCLQMEPEDRPTAAEVLYRL  424

>PHYSO_415772
Length=496

 Score = 212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 144/228 (63%), Gaps = 7/228 (3%)

Query  393  AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG--  450
            AF  E ++TA++ HP I+  IGVAWNSLS+L +V+EF+  GDL+  L +        G  
Sbjct  266  AFLSEAKMTATMDHPRIISLIGVAWNSLSDLCVVMEFMEGGDLRALLDRYQTAQHPVGID  325

Query  451  -DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTA  509
             ++  +A+ V  AL YLHS  P +IHRDLKS NILLTE ++ K+ DFG+SR  +D TMTA
Sbjct  326  HEKATIALHVCHALTYLHSLMPQVIHRDLKSRNILLTETMEAKITDFGISRERLDQTMTA  385

Query  510  GVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTV----DHDGAKLMPFQ  565
            GVGT  W APEV+ G RY +KAD++SFGVVLSELD   +PY        D DG KL    
Sbjct  386  GVGTSLWMAPEVMMGERYDDKADMFSFGVVLSELDAHALPYAQAKEKNRDSDGRKLPDTI  445

Query  566  ILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            +LQ+V  G LR  FS   P  I  +  AC+S DP  RPTA E +  L+
Sbjct  446  LLQQVAMGRLRVEFSESTPQSIVDLGLACVSVDPKMRPTAAEALYRLQ  493

>SPRG_07856
Length=416

 Score = 209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/301 (38%), Positives = 172/301 (57%), Gaps = 28/301 (9%)

Query  338  QGDYESAGSNQT-----FKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQY-GRP  391
            + D++   + +T     FK+    Q +L  ++ +  + +  +L+K A GE W+ Q+ GR 
Sbjct  107  EDDFKRVATKKTASAPPFKM---DQEMLAMKVDFHLIQYTRKLTKGAFGEVWLGQFKGRY  163

Query  392  TA-----------------FAEEIELTASLIHPHIVKFIGVAWNSL-SNLSMVLEFVSEG  433
             A                 F  EI+L   L HP+++ F+G +WN    NL  + E++  G
Sbjct  164  VAIKQILEERKADKKEIECFVAEIKLMLHLQHPNVLDFLGFSWNPRDGNLCFLTEYMKNG  223

Query  434  DLQGFLHKNSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKL  493
            DL   L K    L+W  ++I +A+ +A+ L YLHS +P IIHRDLKS N+LL  +   K+
Sbjct  224  DLFYHLQKRKATLTWPIEKIKIALDIAQGLVYLHSLTPKIIHRDLKSKNVLLDANWTAKI  283

Query  494  IDFGVSR-GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD  552
             DFG+SR    + TMTAGVGT  W APEV  G +Y+++ADIYS GVVLSELDT  IP+ D
Sbjct  284  NDFGISRVRQFEETMTAGVGTALWAAPEVFMGKKYNDRADIYSLGVVLSELDTCAIPFAD  343

Query  553  TVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
                   KL    +++ V     +P+FSV+CPP +  +A  CL ++P  RP+A E+++ +
Sbjct  344  QAIGKNGKLDGMAVIKLVTQKRAKPTFSVECPPAVLDLAMRCLDYEPERRPSAMEVVRLI  403

Query  613  E  613
            +
Sbjct  404  Q  404

>PHYCA_118320
Length=527

 Score = 213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/280 (43%), Positives = 159/280 (57%), Gaps = 25/280 (9%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA------------------FAEEIEL  400
            +   RIP + +  +  LS+ A GE +   Y R                     F  E +L
Sbjct  240  ITAKRIPRDKVIVKNLLSRGAYGEVYNGVYNRQEVAVKMLLSSTRGNIQHVNDFLAEAKL  299

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
            TA++ HPHIV FIGVAW+SLSN+ +VLEF+  GDL+  L         + +   +  +A+
Sbjct  300  TATMDHPHIVTFIGVAWDSLSNVCVVLEFMDGGDLRTLLASYEATKRPVGFNKQKATIAL  359

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             V  AL YLHS  P +IHRDLKS NILL  +L+ KL DFGVS+  +D TMTAGVGT  W 
Sbjct  360  HVCHALTYLHSLMPPVIHRDLKSRNILLNRNLEAKLTDFGVSKERLDQTMTAGVGTSLWM  419

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD----GAKLMPFQILQEVMAG  573
            APEV+   RY  KADI+SFGVVLSELD   +PY  T +      G K+    +LQ+V AG
Sbjct  420  APEVMMSERYDVKADIFSFGVVLSELDVHTLPYTQTKERSLASTGRKMADATLLQKVTAG  479

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             ++  FS   P  +  +  AC+S DP +RPTA E +  L+
Sbjct  480  EVQVEFSDSIPRSLLELGLACVSVDPLNRPTAAEALYRLQ  519

>PHYCA_75205
Length=287

 Score = 205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 159/278 (57%), Gaps = 23/278 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            +LG R+P E +  Q  +++   GE +   Y                   R  AF  E++L
Sbjct  7    ILGARVPREKVIIQRRIARGGYGEVYTGTYHDKPVAVKMLLPETRKSKARRIAFLAEVKL  66

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAV  457
             A+L HPHIV+ IGVAW+S ++L  + E +  GDL+  L K        G   +++ +A+
Sbjct  67   MATLDHPHIVQLIGVAWDSPNDLCALTELMDGGDLRSLLDKYDMEHRHPGFTYEKVKIAL  126

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL Y+HS SP +IHRDLKS N+LLT  LD KL DFGV+R  +D TMTA VGT  W 
Sbjct  127  HVAHALAYIHSLSPPLIHRDLKSRNVLLTSHLDAKLADFGVAREHIDRTMTAEVGTSLWM  186

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQEVMAGTL  575
            APEVL G RY  KADI+SFGV+L+EL+T  +PY      DG+  +L    ILQ V+ G L
Sbjct  187  APEVLMGQRYDHKADIFSFGVMLAELNTHAMPYSHARFQDGSSDRLPDTAILQLVVTGNL  246

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               FS   P  + R+   C++ DPS RP+  E++  L 
Sbjct  247  HADFSQGGPDVLMRLGLECVAVDPSLRPSTPEVLYRLH  284

>PHYCA_563236
Length=289

 Score = 205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 157/279 (56%), Gaps = 23/279 (8%)

Query  358  HLLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIE  399
             +L  RIP E L  Q  +++   GE ++  Y GR  A                 F  EI+
Sbjct  9    EILQARIPMEKLRVQQLINRGGFGEVFLGTYRGRAVAVKRLLPDRSKNLREVEAFIVEIK  68

Query  400  LTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK----NSDVLSWAGDRIYM  455
            +  S+ HP IV  +GVAW + +++S + E++  GDL+  L +          +  D++ +
Sbjct  69   MMLSMDHPRIVGCLGVAWENWTDISAITEYMEGGDLRSVLERFEQQEHRAHGFDDDKLNI  128

Query  456  AVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPY  515
            A+ VAE L YLH   P ++HRDLKS NILL + LD KL DFGVSR   D+TMTAGVGT  
Sbjct  129  ALHVAEGLMYLHGMDPIVLHRDLKSKNILLNKRLDAKLTDFGVSRESADVTMTAGVGTSL  188

Query  516  WTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD-GAKLMPFQILQEVMAGT  574
            W APEV+ G RY+EKAD++SFGVVL ELD  ++PY    +   G KL    ILQ V AG 
Sbjct  189  WMAPEVMIGDRYNEKADMFSFGVVLGELDCQQLPYSHAKEQGTGRKLPGTAILQMVAAGQ  248

Query  575  LRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            LR   S   P  +  +  AC S  PSDRPTA E  + L+
Sbjct  249  LRLEISKSTPSGVYELVMACTSLTPSDRPTAAEAFERLQ  287

>PHYSO_522417
Length=1838

 Score = 221 bits (562),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 162/272 (60%), Gaps = 26/272 (10%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGR---------PTA---------FAEEIEL  400
            ++  RI +  L F   L+K  SGE W+ QY           PT          FAEEI +
Sbjct  443  IVTKRISFAQLHFLRLLAKGGSGEVWLGQYEARYVAMKCLLPTKREDPEALEQFAEEIRM  502

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK--NSDVLSWAGDRIYMAVA  458
             + L HP IV F GVAW SL +L  V E++  GDL+  L        LSW+ +++ ++  
Sbjct  503  ASLLAHPRIVAFCGVAWQSLLHLCAVTEYMPRGDLESLLANPIAQKELSWSREKLTLSSD  562

Query  459  VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR--GVMDLTMTAGVGTPYW  516
            + EAL YLHS  P +IHRDLKS N+LL   L  KL DFG+SR   V D TMT G+GT  W
Sbjct  563  IVEALVYLHSLVPIVIHRDLKSKNVLLDRRLRAKLSDFGLSRERSVED-TMTNGIGTILW  621

Query  517  TAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLR  576
            +APEVLEG RY EK+D++SFGVVLSE+DT  +PY  + +   AK+   QI+  V  G L 
Sbjct  622  SAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYGFSRN---AKMRSMQIVHLVSEGKLL  678

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
            P+F  DCPP I+ +A  CLS DP+ RPTA E+
Sbjct  679  PNFRDDCPPAIRALAQRCLSLDPAARPTAMEV  710

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 105/223 (47%), Gaps = 35/223 (16%)

Query  51   DIARQLYTRHRSGDTSAAVSIK--SVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGI  108
            D+  +LY    +G ++A +S+   ++P+AV+DRL S  +A++ L GL+Q A+LWD+GF  
Sbjct  46   DLVARLYNLETAGSSAAKLSLSPSALPSAVSDRLSSYSLAWSDLSGLMQRALLWDSGFVF  105

Query  109  -SPNGDP-----------VQIWTTGDFTMADIAVSPDDITNVN--------CTMLECPQP  148
             SP G             VQI+T     M D+  +  ++  +         C++  C   
Sbjct  106  ASPVGSSSASGAGDDVQLVQIFTACSQGMGDLLPALAEVKTIQESTDNSSACSVENC---  162

Query  149  NDTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTW-  207
                 +    C   Q++ ++RC V     +G K F G+ W   G +T  P   +R HT  
Sbjct  163  GIIGHFLPAACPAEQVIPLTRCAVYASAMAGQKQFAGVYWVEDGRSTAVPEPVVRRHTPE  222

Query  208  -TEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCH  249
             TEP    S +++AVH   ++   T +  P    +   I+PC 
Sbjct  223  DTEP----SDALFAVHLTDASFTGTESCQP----HVEFILPCR  257

>PHYSO_539944
Length=463

 Score = 210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/285 (42%), Positives = 160/285 (56%), Gaps = 30/285 (11%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            +L +RIP + +     +S+ A GE +  +Y                      AF  E+ L
Sbjct  171  ILASRIPIDRIELGAVISRGAYGEVYRGRYREQDVAIKTLLPEKRKDLAHIQAFLSEVRL  230

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAV  457
             A++ HPHIV+F+GVAW SLS+L  V EF++ GDL+  L +        G    ++ +A 
Sbjct  231  MATMEHPHIVQFVGVAWESLSDLFCVTEFMAGGDLRSLLREYLAAGVRQGMDASKVRIAY  290

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P ++HRDLKS NILLTE LD K+ DFG SR   D TMTAGVG+  W 
Sbjct  291  QVAYALTYLHSLEPVVLHRDLKSRNILLTEALDAKITDFGASRIRSDATMTAGVGSSLWM  350

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAK---------LMPFQILQ  568
            APEV+ G RY EKAD++S GVV+SELDT  +PY    +  G+          L    +LQ
Sbjct  351  APEVMLGKRYGEKADVFSLGVVISELDTHELPYSHAKEEGGSGTGGGGGGRPLPDTAVLQ  410

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             V  G LR  FS    P + R   +C+S +PS+RPTA E + +L+
Sbjct  411  MVSLGKLRVRFSAFMDPDMARFVGSCVSMEPSERPTAAEALYYLQ  455

>PHYRA_77817
Length=552

 Score = 212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 163/280 (58%), Gaps = 25/280 (9%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            +   RIP + +  +  LS+ A GE +   +                     T F  E ++
Sbjct  266  ITAKRIPRDKVKIKKLLSRGAYGEVYTGVFNGQQVAVKMLLPATRGNLQHVTDFLTEAKM  325

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAV  457
            TAS+ HPHIV F+GVAW+SLS+L +VLEF+  GDL+  L++        G   ++  +A+
Sbjct  326  TASMDHPHIVTFVGVAWDSLSDLCVVLEFMDGGDLRSLLNQYEATKHPVGIDREKATIAL  385

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             V  AL YLHS  P IIHRDLKS NILL +  + K+ DFG+SR  +D TMTAGVGT  W 
Sbjct  386  HVCHALTYLHSLIPPIIHRDLKSRNILLNQAKEAKVTDFGISRERLDQTMTAGVGTSLWM  445

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD----TVDHDGAKLMPFQILQEVMAG  573
            APEV+ G +Y  KADI+SFGVVLSELD   +PY      ++D +G K+    +LQ++ AG
Sbjct  446  APEVMLGEQYGVKADIFSFGVVLSELDVHTLPYSQAKQRSLDTNGRKMADATLLQKITAG  505

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +   FS   P  +  +  AC+S DP+DRP++ E +  L+
Sbjct  506  EVHVEFSASNPKALVELGYACVSVDPADRPSSAEALYRLQ  545

>PHYRA_93564
Length=316

 Score = 206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/277 (43%), Positives = 159/277 (57%), Gaps = 23/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            ++  RIP + +     LS+   GE +  +Y                      AF  EI+L
Sbjct  27   IVAARIPVDRIELGELLSRGGFGEVYRGRYRDQNVAVKTLLPSTRKDMNHIEAFLAEIKL  86

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
             A++ HP IV+FIGVAW SLS L  + EF+  GDL+  L   +++     +   ++ MA+
Sbjct  87   MATMEHPQIVQFIGVAWESLSELYALSEFMEGGDLRSLLVTYYESGHPRGFDPVKVKMAL  146

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
              A AL YLHS  P ++HRDLKS NILLTE LD K+ DFG SR   D TMTAGVGT +W 
Sbjct  147  QTAHALTYLHSLDPVVLHRDLKSRNILLTETLDTKITDFGASRERSDKTMTAGVGTSFWM  206

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD--GAKLMPFQILQEVMAGTL  575
            APEV+ G RY EKAD++SFGVVLSELDT  +PY    ++   G  L    +LQ V+ G L
Sbjct  207  APEVVMGERYGEKADVFSFGVVLSELDTHELPYSHAKENSETGRPLPDTAVLQLVLMGRL  266

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            + SFS      + ++A  CL  +P +RPTA E++  L
Sbjct  267  QVSFSGVGLVEMTQLAQQCLQIEPENRPTAAEVLYRL  303

>PITG_07549
Length=545

 Score = 212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/278 (42%), Positives = 164/278 (59%), Gaps = 25/278 (9%)

Query  361  GNRIPYESLSFQMELSKAASGEAWICQYG-RPTA-----------------FAEEIELTA  402
              RIP + +  +  +S+ + GE +   Y  R  A                 F  E ++TA
Sbjct  252  AKRIPRDKVQTEKLISRGSYGEVYAGTYNERKVAVKMLLPAMRGRIQHVKDFLAEAKMTA  311

Query  403  SLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAVAV  459
            ++ HPH+V FIGVAW+SLS++ +VLE++  G+L+  L    K+   + +  ++  +A+ V
Sbjct  312  TMDHPHVVAFIGVAWDSLSDICVVLEYMDGGELRALLDRYEKDKHPIGFTREKTTIALEV  371

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAP  519
              AL YLHS SP+IIHRDLKS NILL+ D+  KL DFG+SR  +D TMTAGVGT  W AP
Sbjct  372  CHALTYLHSLSPSIIHRDLKSRNILLSSDMKAKLSDFGISRERLDKTMTAGVGTSLWMAP  431

Query  520  EVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDGAKLMPFQILQEVMAGTL  575
            EV+ G RY +KAD++SFGVVLSELD   +PY     + +D  G  +    +LQ V  G +
Sbjct  432  EVMLGERYDDKADVFSFGVVLSELDVHSLPYATAKKENLDAKGNPIPDSILLQRVALGIV  491

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            +  FS  CP  I  +  AC S  P++RPTA E +  L+
Sbjct  492  KVEFSDACPEAIVELGRACTSVYPTERPTAAEALYKLQ  529

>HYAP_01722
Length=546

 Score = 212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 165/283 (58%), Gaps = 29/283 (10%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            ++  RIP + +  +  LS+   GE +I +Y                   +  AF  E++L
Sbjct  258  VVAARIPRDQVKIEELLSRGGYGEVYIGRYKGSQVAVKMLLPEKKKAMSQVNAFLCEVKL  317

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL----HKNSDVLSWAGDRIYMA  456
             A L HP IV FIGVAW+ L ++ +V E++S GDL+  L    H++  V  +   ++ +A
Sbjct  318  MACLDHPRIVSFIGVAWDQLVDICVVSEYMSGGDLKALLTEYEHRDYPV-GFDHLKVKIA  376

Query  457  VAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYW  516
              VA AL YLHS SP +IHRDLKS NILL E +D K+ DFG+SR  +D TMT GVGT +W
Sbjct  377  FHVAIALTYLHSCSPPVIHRDLKSKNILLDEAMDAKVTDFGISRERIDATMTGGVGTSFW  436

Query  517  TAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF-----DTVDHDGAKLMP-FQILQEV  570
             APEV+ G RY +K D++SFGVVLSELD+  +PY       T    G + +P   ILQ V
Sbjct  437  MAPEVMMGERYDDKVDMFSFGVVLSELDSHVLPYASASRSSTNRSSGTRNLPSAAILQMV  496

Query  571  MAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             AG LR  FS   P  I  +  AC+S DP++RPTA E +Q L 
Sbjct  497  AAGVLRVEFSEASPRSIVDLGLACVSLDPNERPTAAEAVQKLR  539

>PHYSO_476596
Length=535

 Score = 211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 144/227 (63%), Gaps = 7/227 (3%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---  450
            F  E +LTAS+ HPH+V FIGVAW++LS+L +V+EF+  GDL+  L +        G   
Sbjct  294  FLAEAKLTASMEHPHVVHFIGVAWDTLSDLCVVMEFMEGGDLRSLLSEYEQSGHPVGIDR  353

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
            ++  +A+ V  AL YLHS +P IIHRDLKS NILLT DL  K+ DFG+SR  +D TMTAG
Sbjct  354  EKATIALHVCHALTYLHSLAPPIIHRDLKSRNILLTHDLKAKVTDFGISREKLDQTMTAG  413

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDH----DGAKLMPFQI  566
            VGT  W APEV+ G RY +KADI+SFGVVLSELD   +PY    D     +G +     +
Sbjct  414  VGTSLWMAPEVMLGERYDDKADIFSFGVVLSELDLHTLPYAQAKDKNRDSNGHRFPDALL  473

Query  567  LQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            LQ+V  G LR  FS   P  +  +  AC+S DP  RPTA E +  L+
Sbjct  474  LQQVAMGKLRVEFSEGSPRSLVEVGVACVSVDPRLRPTAAEALYKLQ  520

>PHYCA_503452
Length=435

 Score = 209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/277 (43%), Positives = 159/277 (57%), Gaps = 23/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIEL  400
            ++  RIP + +     LS+   GE +  +Y   T                  AF  EI+L
Sbjct  146  IVAARIPVDRVELGELLSRGGFGEVYRGRYREQTVAVKTLLPSTRKDMNHIEAFLAEIKL  205

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
             A++ H  IV+F+GVAW SLS L  V EF+  GDL+  L   ++N     +   +I MA+
Sbjct  206  MATMEHAQIVQFVGVAWESLSELYAVSEFMEGGDLRTLLVKYYENGHPRGFDPAKIKMAL  265

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS  P ++HRDLKS NILLTE LD K+ DFG SR   D TMTAGVGT +W 
Sbjct  266  QVAHALTYLHSLDPVVLHRDLKSRNILLTETLDAKITDFGASRERSDRTMTAGVGTSFWM  325

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHD--GAKLMPFQILQEVMAGTL  575
            APEV+ G +Y EKAD++SFGVVLSELDT  +PY    ++   G  L    +LQ V+ G L
Sbjct  326  APEVVMGEQYGEKADVFSFGVVLSELDTHELPYSHAKENSETGRPLPDTAVLQLVLMGRL  385

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
            +  FS   P  +  +A  CL  +P +RPTA +++  L
Sbjct  386  QVQFSGVGPSEMTELAQQCLQIEPENRPTAADVLYRL  422

>PHYCA_568998
Length=458

 Score = 209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/271 (44%), Positives = 155/271 (57%), Gaps = 16/271 (6%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY----------GRPTAFAEEIELTASLIHPH  408
            L+  RIP E +     +S+ A G+ +   Y          G    F +EI++  S+ HP+
Sbjct  181  LIKARIPREKVEIHEFISRGAFGKVYKGTYKSQLVAVKTMGDVETFVQEIKMARSMSHPN  240

Query  409  IVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAVAVAEALEY  465
            IV+F+GVAWN   +   V+E++  GDL+G L K  D     G   +++ +A+ VA AL Y
Sbjct  241  IVQFVGVAWNYREDFCCVMEYMDGGDLRGLLDKYEDENRRTGFNSEKLTIALHVAHALAY  300

Query  466  LHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGA  525
            LHSR   ++HRDLKS NILL E L  KL DFGVSR  +D  MTA VGT  W APEV+ G 
Sbjct  301  LHSRDVPVLHRDLKSKNILLNEALGAKLTDFGVSRERVDRAMTADVGTSLWMAPEVMIGN  360

Query  526  RYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQEVMAGTLRPSFSVDC  583
             Y EKAD++SFGVVLSEL T  +PY       G+  +L P  IL  V  GTL   FS   
Sbjct  361  AYDEKADLFSFGVVLSELSTHTLPYAHA-KRPGSTEQLSPLVILHRVATGTLSVEFSKSD  419

Query  584  PPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            P  I R+  AC+S DP  RPTA E ++ L  
Sbjct  420  PQAIVRLGLACVSMDPDKRPTAAEAMRVLHA  450

>PHYRA_80666
Length=555

 Score = 212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 166/284 (58%), Gaps = 30/284 (11%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            ++G RIP E + FQ  +++   GE ++  Y GR  A                 F  E++L
Sbjct  267  IVGARIPREKVKFQKLINRGGYGEVYVGSYNGRQVAVKMLLPETKKTMSQVNAFLSEVKL  326

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
             ASL HP IV FIGVAW+ L ++ +V E+++ GDL+  L    K    + +   ++ +A+
Sbjct  327  MASLDHPRIVSFIGVAWDQLIDICVVSEYMAGGDLKVLLTEFDKQGHPVGFDHTKVKIAL  386

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             V+ AL YLHS +P +IHRDLKS NILL E +D K+ DFG+SR  +D TMT G+GT +W 
Sbjct  387  HVSIALTYLHSCAPPVIHRDLKSKNILLDEAMDAKVTDFGISRERIDATMTGGIGTSFWM  446

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPY--------FDTVDHDGAKLMPFQILQE  569
            APEV+ G RY +KAD++SFGVVLSELD+   PY          +  H   KL    ILQ 
Sbjct  447  APEVMMGERYDDKADMFSFGVVLSELDSHVTPYALSRSSSTTSSSSHQN-KLPHAAILQM  505

Query  570  VMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            V AG LR  FS   P  I  +  +C+S DP++RPTA E +  L+
Sbjct  506  VAAGKLRVHFSEAGPQSIVDLGLSCVSLDPTERPTAAEALYKLQ  549

>PPTG_06258
Length=528

 Score = 211 bits (537),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 156/277 (56%), Gaps = 22/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            ++  RIP E +  Q  +++   G+ ++  Y                     TA   E ++
Sbjct  239  IVAARIPLEKIRIQELIARGGFGQVFLASYNGQTVAVKTLLPETAQDMTEITALFAETKV  298

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQG----FLHKNSDVLSWAGDRIYMA  456
             A L HP IV FIG+AW SLS++S V E++  GDL+     FL  ++    +  D++ +A
Sbjct  299  MAKLEHPCIVNFIGIAWESLSSISCVTEYLVGGDLRALLNHFLDNHTRPRGFDHDKVKIA  358

Query  457  VAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYW  516
            + +A  L YLHS  P I+HRDLKS N+LLT  L+ KL DFGVSR   D  MT  VGT  W
Sbjct  359  MDIAHGLTYLHSMEPNILHRDLKSRNVLLTSQLNAKLTDFGVSRERTDDLMTNAVGTSLW  418

Query  517  TAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLR  576
             APEV+ G  Y  KAD+YSFGV+LSELDT  +PY +  +  G K     ILQ V  G L+
Sbjct  419  MAPEVMMGGHYDGKADVYSFGVLLSELDTHFMPYANVRNPSGRKPTEAAILQMVAVGNLQ  478

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              FS DCP  +  +A AC+S +P DRPTA E +  L+
Sbjct  479  VEFSRDCPVELLTLAHACISVEPDDRPTAAEAMHRLQ  515

>PHYCA_9190
Length=325

 Score = 205 bits (521),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 157/267 (59%), Gaps = 21/267 (8%)

Query  363  RIPYESLSFQMELSKAASGEAWICQY-----------------GRPTAFAEEIELTASLI  405
            RI Y+S++   ++++ A GE W+ QY                     AF  E++L A L 
Sbjct  48   RIDYDSVTLVKKIAQGAFGEVWVGQYRNTRVAVKRLIQEQVSLAASEAFLREVKLMAWLE  107

Query  406  HPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS-DVLSW--AGDRIYMAVAVAEA  462
            HP IV+F+GVAW  L ++  V+E++  GDL+  L K S   L W  +G ++  A    +A
Sbjct  108  HPKIVQFVGVAWTKLVDMLAVIEYMDGGDLRTLLDKKSPKKLPWEESGLKLQYAQDTIDA  167

Query  463  LEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVL  522
            + YLHS SP IIHRDLKS NILL      K+ DFGVS       MTAGVGT  W APE+ 
Sbjct  168  IVYLHSLSPVIIHRDLKSRNILLDSKKGAKIGDFGVSATKRLHDMTAGVGTTRWLAPEIA  227

Query  523  EGA-RYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSV  581
             G  +Y+E  D+YSFG++LSELDT ++P+ D     GA L    ILQ V +G L+ +FS 
Sbjct  228  RGEEKYTEAVDVYSFGIILSELDTHQLPFADAKTSTGAALNDMAILQGVSSGKLQVTFSP  287

Query  582  DCPPRIQRIAAACLSFDPSDRPTAQEL  608
             CP  ++ +A +C+S DP+DRPTA ++
Sbjct  288  SCPQNLEALARSCMSLDPADRPTAAQI  314

>PITG_06480
Length=1856

 Score = 219 bits (559),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 131/306 (43%), Positives = 176/306 (58%), Gaps = 30/306 (10%)

Query  325  VATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAW  384
            VATT    ++S+ Q   +S+      +  +    ++  RI +  L F   L+K  SGE W
Sbjct  410  VATTRAEITLSNDQLCRKSS----ILRAFVSDPAIVTKRISFAQLHFLRLLAKGGSGEVW  465

Query  385  ICQY-GRPTA-----------------FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMV  426
            + QY  R  A                 FAEEI + + L HP IV F GVAW SL +L  V
Sbjct  466  LGQYETRYVAMKCLLPAKREDREALEQFAEEIRMASLLAHPRIVAFCGVAWQSLLHLCAV  525

Query  427  LEFVSEGDLQGFLHK--NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNIL  484
             E+++ GDL+  L        L+W+ +++ ++  + EAL YLHS  P +IHRDLKS N+L
Sbjct  526  TEYMARGDLENLLANPVAQKELTWSREKLTLSSDIVEALVYLHSLVPVVIHRDLKSKNVL  585

Query  485  LTEDLDPKLIDFGVSR--GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSE  542
            L   L  KL DFG+SR   V D TMT G+GT  W+APEVLEG RY EK+D++SFGVVLSE
Sbjct  586  LDRRLRAKLSDFGLSRERSVED-TMTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSE  644

Query  543  LDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDR  602
            +DT  +PY  +     AK+   QI+  V  G L P+F  DCPP I+ +A  CLS DP+ R
Sbjct  645  IDTCALPYGFS---RHAKMRSMQIVHLVSEGKLLPNFRDDCPPAIRDLAQRCLSLDPAAR  701

Query  603  PTAQEL  608
            PTA E+
Sbjct  702  PTAMEV  707

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 103/222 (46%), Gaps = 34/222 (15%)

Query  51   DIARQLYTRHRSGDTSAAVSI--KSVPTAVTDRLDSLKIAFTHLPGLVQLAVLWDTGFGI  108
            D+  +LY    SG + A +S+  +++P+AVT RL S  + ++ L GL+Q A+LWD+GF  
Sbjct  45   DLVARLYDLETSGSSVAKLSLSSRALPSAVTARLSSYSLTWSELSGLMQRALLWDSGFVF  104

Query  109  -SP-----------NGDPVQIWTT-----GDFT--MADIAVSPDDITNVNCTMLECPQPN  149
             SP           N   VQI+T+     GD     A+I+       N NC + +C    
Sbjct  105  ASPLSSSSSSSEGDNVKLVQIYTSCSQGMGDLLPGFAEISTLQSSANNSNCHVQDC---G  161

Query  150  DTPAYSSQYCSGTQILNVSRCIVDTFEDSGAKDFLGIMWSTGGDATMTPHIRLRDHTW--  207
                +    C    +L ++RC V T +      F G+ W+  G +   P   LR HT   
Sbjct  162  IIGHFLPPTCPVESVLPLTRCAVHTSDMDRQNQFAGVFWAEDGRSNSVPEPVLRRHTPLD  221

Query  208  TEPTTGVSYSVYAVHTVSSADDPTWNQCPVNNGYSSLIVPCH  249
            TEP    S +++AVH      + T+        +++ I+PC 
Sbjct  222  TEP----SQALFAVHL----SETTFTGTESCEPHTNFILPCR  255

>CCA23126
Length=799

 Score = 216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 157/270 (58%), Gaps = 20/270 (7%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY-GRPTA-----------------FAEEIEL  400
            +L  +I Y+  +F   LSK A GE W+ Q   R  A                 FA EI L
Sbjct  507  VLSRQIAYDEFTFLRMLSKGAFGEVWLGQLEDRHVAIKRLLPERSHICSNLEEFAAEIRL  566

Query  401  TASLIHPHIVKFIGVAWN-SLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVAV  459
              +L HP+IV  IG++W+   SNL ++ EF+  GDL   + K  D L W   ++ +A+ +
Sbjct  567  MCNLNHPNIVTMIGISWDIRFSNLCVLTEFMDHGDLDVVIEKYGDELKWEKKKLQIALDI  626

Query  460  AEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGV-MDLTMTAGVGTPYWTA  518
            AE + YLHS+ P IIHRD+KS N+L+ +    K+ DFG+SR   M+ TMT+GVGT  WTA
Sbjct  627  AEGMLYLHSQQPVIIHRDMKSKNVLVNKKWQAKISDFGISRKTNMNETMTSGVGTLLWTA  686

Query  519  PEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRPS  578
            PE++EG +YSEKADIYS G+VL ELDTG  P+    +  G  +   Q++Q+V  G  R  
Sbjct  687  PEIIEGKKYSEKADIYSLGIVLGELDTGARPFAHMKNDRGDAMPAMQLVQQVRLGKARMQ  746

Query  579  FSVDCPPRIQRIAAACLSFDPSDRPTAQEL  608
               DCP  ++ +   C S DP  RPT++E+
Sbjct  747  LRPDCPQSVRELIEKCTSLDPDVRPTSKEV  776

>PITG_08890
Length=521

 Score = 210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 115/277 (42%), Positives = 156/277 (56%), Gaps = 22/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIEL  400
            ++  RIP E +  Q  +++   G+ ++  Y   T                  A   E ++
Sbjct  232  IVAARIPLEKIRIQELIARGGFGQVFLASYNGQTVAVKTLLPETAQDMTEINALFAETKV  291

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQG----FLHKNSDVLSWAGDRIYMA  456
             A L HP IV FIG+AW SLS +S V E++  GDL+     FL  ++    +  D++ +A
Sbjct  292  MAKLEHPCIVNFIGIAWESLSTISCVTEYLVGGDLRALLNHFLDNHTRPRGFDHDKVKIA  351

Query  457  VAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYW  516
            + +A  L YLHS  P I+HRDLKS N+LLT  L+ KL DFGVSR   D  MT  VGT  W
Sbjct  352  MDIANGLTYLHSMEPNILHRDLKSRNVLLTSQLNAKLTDFGVSRERTDDLMTNAVGTSLW  411

Query  517  TAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLR  576
             APEV+ G  Y  KAD+YSFGV+LSELDT  +PY +  +  G K     ILQ V  GTL+
Sbjct  412  MAPEVMMGGHYDGKADVYSFGVLLSELDTHFMPYANVRNPSGRKPTEAAILQMVAVGTLQ  471

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
              FS +CP  +  +A AC+S +P DRPTA E +  L+
Sbjct  472  VEFSRNCPVELLTLAHACISVEPDDRPTAAEALHRLQ  508

>PHYRA_72890
Length=734

 Score = 215 bits (547),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 177/315 (56%), Gaps = 26/315 (8%)

Query  319  QARRGTVATTSYGPSISSHQGDYESAGSNQTFKILLHSQHLLGNRIPYESLSFQMELSKA  378
            + RR          S+  H   ++S  S  T   +++   ++ +RIP++ +     ++K 
Sbjct  392  RQRRANNRRKERDESVFDHTLSFDSHFSANTN--IINDPLIIAHRIPFKDVKVANCINKG  449

Query  379  ASGEAWICQYGRPT------------------AFAEEIELTASLIHPHIVKFIGVAWNSL  420
              G  +   Y R                    AF +EI L ++L HP +V+FIGVAW++L
Sbjct  450  GFGLVYSGVYNRRRVAIKRIRTDLCQDMKHVEAFMKEICLISTLEHPRVVEFIGVAWDTL  509

Query  421  SNLSMVLEFVSEGDLQGFLHK---NSDVLSWAGDRIYMAVAVAEALEYLHSRSPAIIHRD  477
             NLS V E++  GDL+  LH     +  L+W   +  +   + EAL YLHS  P +IHRD
Sbjct  510  RNLSAVTEYMERGDLREVLHSFKLRNTPLTWEAHKYRITQHIGEALTYLHSLDPKLIHRD  569

Query  478  LKSNNILLTEDLDPKLIDFGVSRG--VMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYS  535
            LKS N+LL  +++ KL DFGVSR    M+  MTAG+GT +W APEVL G  Y E+ADI+S
Sbjct  570  LKSKNVLLNTEMEAKLSDFGVSRERHAMETHMTAGIGTSFWIAPEVLLGKDYDERADIFS  629

Query  536  FGVVLSELDTGRIPYFDTVD-HDGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAAC  594
             GVV+SE+DT   PY++  +   G K+    IL+ V AG L P F+ DCP  I ++A AC
Sbjct  630  LGVVISEIDTEDYPYWNAKNPPQGGKVEETAILRMVAAGELIPDFTEDCPKAILQLAKAC  689

Query  595  LSFDPSDRPTAQELI  609
            L+ +P DRP+A E++
Sbjct  690  LAVNPDDRPSATEVV  704

>PITG_18347
Length=547

 Score = 211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 164/280 (59%), Gaps = 25/280 (9%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG-RPTA-----------------FAEEIEL  400
            +   RIP + +  +  +S+ + GE +   Y  R  A                 F  E ++
Sbjct  250  ITAKRIPRDKVQTEKLISRGSYGEVYAGTYNERKVAVKMLLPAMRGRIQHVKDFLAEAKM  309

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFL---HKNSDVLSWAGDRIYMAV  457
            TA++ HPH+V FIGVAW+SLS++ +VLE++  G+L+  L    K+   + +  ++  +A+
Sbjct  310  TATMDHPHVVAFIGVAWDSLSDICVVLEYMDGGELRALLDRYEKDKHPIGFTREKTTIAL  369

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             V  AL YLHS SP+IIHRDLKS NILL+ D+  KL DFG+SR  +D TMTAGVGT  W 
Sbjct  370  EVCHALTYLHSLSPSIIHRDLKSRNILLSSDMKAKLSDFGISRERLDKTMTAGVGTSLWM  429

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDGAKLMPFQILQEVMAG  573
            APEV+ G RY +KAD++SFGVVLSELD   +PY     + +D  G  +    +LQ V  G
Sbjct  430  APEVMLGERYDDKADVFSFGVVLSELDVHSLPYAKAKKENLDAKGNPIPDSILLQRVALG  489

Query  574  TLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             ++  FS  CP  I  +   C S  P++RPTA E +  L+
Sbjct  490  IVKVEFSDACPEAIVELGRVCTSVYPTERPTAAEALYKLQ  529

>PHYRA_73578
Length=806

 Score = 216 bits (549),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 146/225 (65%), Gaps = 5/225 (2%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---  450
            F  E++L ASL HP IV+F+GVAWN+LS++  V+E++  GDL+G L    D     G   
Sbjct  53   FLAEVKLMASLDHPCIVQFVGVAWNALSDICAVMEYMEGGDLRGLLASYDDQHYPTGFDY  112

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
            +++ +A+  A AL Y+HS  P +IHRDLKS NILLT DLD KL DFGVSR   D TMTAG
Sbjct  113  NKVKIALHTAHALTYMHSLEPVVIHRDLKSRNILLTSDLDAKLTDFGVSRERADHTMTAG  172

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGA--KLMPFQILQ  568
            VGT  W APEVL G RY +KADI+SFGVVLSELD   +PY    + DG+  ++    ILQ
Sbjct  173  VGTSLWMAPEVLMGERYDDKADIFSFGVVLSELDLHVLPYSHATESDGSGHRMRDLAILQ  232

Query  569  EVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             +  G LR  FS D    +  +   C+S +P DRPTA +++  L+
Sbjct  233  RMAMGKLRVQFSPDAMHSMVELGNECVSVNPKDRPTAAQVLYKLQ  277

>PHYRA_81021
Length=609

 Score = 212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 180/591 (30%), Positives = 273/591 (46%), Gaps = 83/591 (14%)

Query  74   VPTAVTDRLDSLK---IAFTHLPGLVQLAVLWDTGF-GISPN-----------GDPVQIW  118
            VP+++   L SL      F   P  +Q A+LW+ G+  I P            G+ VQ++
Sbjct  39   VPSSLNMALRSLVKDVATFVKYPANLQRAMLWNAGWVRIIPESAGSGSASDGVGEYVQMY  98

Query  119  TTGDFTMADIAVSPDDITNVN-CTMLECPQPNDTPAYSSQYCSGTQILNVSRCIV----D  173
                 TM+ I +S   +++ + C +  C +   T  Y+   C  + + + + C +    D
Sbjct  99   VQCGLTMSSIFLSESTLSDGSLCELETCKEGIIT--YTRSTCERSYVESKTLCALSPEAD  156

Query  174  TFEDSGAKDFLGIMWSTGGD--ATMTPHIRLRDHTWTEPTTGVSYSVYAVHTVSSADDPT  231
            +F D+      G MWST GD   +  P     ++      TG + S+Y +     A   +
Sbjct  157  SF-DATLSQRNGPMWSTNGDLDESFDPQFYQFNNG-----TGDNPSIYML-----AQQSS  205

Query  232  W----NQCPVNNGYSSLIVPCHKRSEFSDAEMAAVNKPRGSEWVTMWLKDEFAVGDSSGF  287
            W    + CP     +  IVPC K  +   A+   V  P    WV  W+ +E    D S  
Sbjct  206  WIMSEDSCP---NRAQFIVPCRKVGDDEIADTWCV--PPIESWVLDWVDNETQSIDPSAV  260

Query  288  DElllipillsssCCDFDVVSPNYLGVVAHEQARRGTVATTSYGPSISSHQGDYESAGSN  347
              +            +  + +P  +G++         V     G  +   +    + G  
Sbjct  261  TTIQDSSEG------NGGLSTPAIVGIIVACI----VVILILLGFIVVRQRRSRANHGQT  310

Query  348  QTFKILLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRP----------------  391
                 L     +  NR+P E +     +S+ A GE +   Y                   
Sbjct  311  G----LWDDDIITANRVPREKVRIDQLISRGAFGEVYNGIYNEQHVAIKMLLPSTRRDIK  366

Query  392  --TAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVL  446
                F  E  LTA + HP IV  IG+AW+SLS+L +VLEF+  GDL+  L+   ++   +
Sbjct  367  LVNGFLAEARLTALMDHPRIVSCIGIAWDSLSDLCVVLEFMEGGDLRTLLNNYERSRYPV  426

Query  447  SWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLT  506
             +  ++  +A+ VA AL Y+HS  P +IHRDLKS NILL   L+ KL DFG+SR  +D T
Sbjct  427  GFNREKATIALHVAHALTYMHSLEPPVIHRDLKSRNILLNHMLEAKLTDFGISRERLDET  486

Query  507  MTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDGAKLM  562
            MTAGVGT  W APEV+ G +Y EKAD++SFGVVLSELD   +PY     +  +  G ++ 
Sbjct  487  MTAGVGTSLWMAPEVMRGEKYDEKADMFSFGVVLSELDVHTLPYAQAKQEMQNAHGRQMT  546

Query  563  PFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               +LQ V  GT+   FS   P  +  +  AC+S DPS RP+A E +  L+
Sbjct  547  DATLLQRVAMGTVGLEFSDAGPLSMIELGRACVSADPSVRPSAAEALFKLQ  597

>PPTG_21833
Length=579

 Score = 211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 165/278 (59%), Gaps = 24/278 (9%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYG------------------RPTAFAEEIEL  400
            ++  RIP E +  +  +++   GE ++  Y                   +  AF  E++L
Sbjct  296  IIAARIPREKVVAEHLINRGGFGEVYVGTYNGQQVAIKMLLPERKKSLTQVNAFLSEVKL  355

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAG---DRIYMAV  457
             ++L H HIV+FIGVAW+SL++L +V E++   DL+  L K  +     G   D++ +A+
Sbjct  356  MSTLDHAHIVEFIGVAWDSLTDLCVVTEYMVI-DLKALLSKFEEQRMPVGFDHDKVKVAL  414

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS +P +IHRDLKS+NILL E +D K+ DFG+SR  +D TMTAGVGT  W 
Sbjct  415  HVAHALTYLHSCAPPVIHRDLKSSNILLNEAMDAKVTDFGISRERIDATMTAGVGTSLWM  474

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVD--HDGAKLMPFQILQEVMAGTL  575
            APEV+ G RY +KAD++SFGVVLSELD   +PY    +  H G +L    ILQ V AG L
Sbjct  475  APEVMLGERYDDKADMFSFGVVLSELDQHALPYSHAKNNTHSGQRLTDTAILQMVAAGKL  534

Query  576  RPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            R  FS   P  + ++   C+S DP  RPTA E +  L+
Sbjct  535  RVQFSEAAPESMVQLGLECVSTDPKQRPTAAEALYRLQ  572

>PHYSO_320857
Length=664

 Score = 213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 149/231 (65%), Gaps = 7/231 (3%)

Query  390  RPTAFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVL  446
            R   F  E + TASL HPHIV F+GVAW+S S+L +VLE++  G+L+  L K   +   +
Sbjct  426  RVNEFLAEAKTTASLDHPHIVSFVGVAWDSFSDLCVVLEYMDGGELRALLDKFLESKHPV  485

Query  447  SWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLT  506
             +   ++ +A+ V  AL YLHS +P+IIHRDLKS NILL  +++ KL DFG+SR  +D T
Sbjct  486  GFDRQKVTIALQVCHALAYLHSLTPSIIHRDLKSRNILLGSNMEAKLADFGISRERLDRT  545

Query  507  MTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTV----DHDGAKLM  562
            MTAGVGT  W APEV+ G RY EKAD++SFGVVLSELD   +PY        D +G ++ 
Sbjct  546  MTAGVGTSLWMAPEVMLGERYDEKADMFSFGVVLSELDVHTLPYEKVKKQNPDSNGREMA  605

Query  563  PFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
               +LQ+V  G ++  FS  CP  +  +  AC+S DP+ RP+A E +  L+
Sbjct  606  SSTLLQKVALGAVKVEFSGTCPKAMAELGRACISIDPTKRPSAAEALYKLQ  656

 Score = 139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 90/143 (63%), Gaps = 4/143 (3%)

Query  471  PAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWTAPEVLEGARYSEK  530
            P +IHRDLKS NILL + +  KL DFG+SR  +D TMTAG+GT  W APEV+ G RY  K
Sbjct  11   PPVIHRDLKSRNILLNKAMHAKLTDFGISRERLDQTMTAGMGTSLWMAPEVMLGERYDVK  70

Query  531  ADIYSFGVVLSELDTGRIPYFD----TVDHDGAKLMPFQILQEVMAGTLRPSFSVDCPPR  586
            AD++SFGVVLSELD   +PY      ++D  G  L    +LQ V  GT+R  FS      
Sbjct  71   ADMFSFGVVLSELDVHTLPYAQEKKRSLDSGGRALADATLLQRVAEGTVRVEFSEGNASF  130

Query  587  IQRIAAACLSFDPSDRPTAQELI  609
            I  +  AC+S DPS RP+A E +
Sbjct  131  ITELGCACVSVDPSQRPSAAEAL  153

>H310_09503
Length=402

 Score = 206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 162/277 (58%), Gaps = 22/277 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWI--CQYGRPTA-----------------FAEEIE  399
            LL  ++ Y  + +  +LSK A GE W+  CQ G   A                 F  EI+
Sbjct  116  LLRAKVDYADIHYTRKLSKGAFGEVWLGQCQ-GNYVAIKQILEERKNDAKEIECFVAEIK  174

Query  400  LTASLIHPHIVKFIGVAWNSL-SNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRIYMAVA  458
            L A   HP+IV F G +WN    N+  + E++  GDL  +L +N   L+W  +++ +A+ 
Sbjct  175  LMAIFHHPNIVDFRGFSWNPTDGNMCALTEYMKHGDLFVYLQRNKASLAWKHEKVGIAID  234

Query  459  VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR-GVMDLTMTAGVGTPYWT  517
            +A+AL YLHS +P +IHRDLKS N+LL ++   KL DFG+SR   ++ TMTAGVGT  W 
Sbjct  235  IAQALVYLHSLNPKVIHRDLKSKNVLLDDNFTAKLSDFGISRLRQLEETMTAGVGTALWA  294

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLRP  577
            APEV    +Y+++AD+YS GVVLSELDT  IPY D       KL    +++ V     +P
Sbjct  295  APEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAVGKNGKLDGMAVVKLVTQQQAKP  354

Query  578  SFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLEG  614
            SFS  CP  ++ +A  CL ++P +RP+A E+++ L+ 
Sbjct  355  SFSPSCPEEVRALAYRCLDYEPDNRPSAAEVVEILKN  391

>PHYSO_477685
Length=526

 Score = 210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/286 (41%), Positives = 164/286 (57%), Gaps = 25/286 (9%)

Query  353  LLHSQHLLGNRIPYESLSFQMELSKAASGEAWICQYGRPTA------------------F  394
            L + + ++  ++P + +  Q  +S+ A GE +  Q  R                     F
Sbjct  229  LWNDEIIIAKKLPRDKVKIQKLISRGAFGEVYAGQLHRNQVAVKMLLPATRNSLKHVDDF  288

Query  395  AEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHK---NSDVLSWAGD  451
              E ++TA + HPH+V FIGVAW+SLS++ +VLEF+  GDL+  L+K   +   + +   
Sbjct  289  LAEAKMTAVMDHPHVVSFIGVAWDSLSDVCVVLEFMDGGDLRTLLNKYETSKHPVGFDKQ  348

Query  452  RIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGV  511
            +  +A+ V  AL YLHS +P +IHRDLKS NILL + +  KL DFG+SR  +D TMTAG+
Sbjct  349  KATIALHVCHALTYLHSLAPPVIHRDLKSRNILLNKAMHAKLTDFGISRERLDQTMTAGM  408

Query  512  GTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD----TVDHDGAKLMPFQIL  567
            GT  W APEV+ G RY  KAD++SFGVVLSELD   +PY      ++D  G  L    +L
Sbjct  409  GTSLWMAPEVMLGERYDVKADMFSFGVVLSELDVHTLPYAQEKKRSLDSGGRALADATLL  468

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            Q V  GT+R  FS      I  +  AC+S DPS RP+A E +  L+
Sbjct  469  QRVAEGTVRVEFSEGNASFITELGCACVSVDPSQRPSAAEALYKLQ  514

>SPRG_05680
Length=339

 Score = 204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 145/221 (66%), Gaps = 4/221 (2%)

Query  393  AFAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDR  452
            AF +EI L A    PH+V F+GV W++  +L  V+E +  GDL+ +L  +   L     +
Sbjct  100  AFVDEIRLMARFSCPHLVSFVGVQWSTFLHLQCVVEHMVHGDLRAYLETHR--LLSMHSK  157

Query  453  IYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVG  512
              MA AVA+AL YLH     ++HRDLKS N+LL E+L  K+ DFGV+R V D  MT+ VG
Sbjct  158  WRMAHAVAQALVYLHEH--CVVHRDLKSRNVLLGENLQAKVADFGVARRVDDDVMTSAVG  215

Query  513  TPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMA  572
            T  WTAPEVL+GARY  KAD+YSFG+VL+ELD+ ++PY D  +  G  +  F +L  VM 
Sbjct  216  TFRWTAPEVLQGARYDTKADMYSFGMVLTELDSHKVPYADVRNGRGHAMGSFTLLYHVMR  275

Query  573  GTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            G ++PSFS  CP  ++ +A  C++ +P  RPTA+E++Q LE
Sbjct  276  GEMQPSFSASCPEWLRDLALRCVAVNPDTRPTAREVVQALE  316

>PHYRA_95776
Length=494

 Score = 208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/276 (42%), Positives = 154/276 (56%), Gaps = 22/276 (8%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQYGRPT------------------AFAEEIEL  400
            L+  RIP E +  Q  +++   G+ ++  Y   T                  A   E ++
Sbjct  205  LVAARIPLEKIRIQELIARGGFGQVFLATYNGQTVAVKTLLPETAKDMTEINALFAETKV  264

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLS----WAGDRIYMA  456
             A L HP IV FIG+AW SLS +  V E++  GDL+  L+   D  +    +  D++ +A
Sbjct  265  MAKLEHPCIVNFIGIAWESLSTICCVTEYLVGGDLRALLNSFQDNHTRPRGYDHDKVQIA  324

Query  457  VAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYW  516
            + +A  L YLHS  P I+HRDLKS N+LLT  L+ KL DFGVSR   D  MT  VGT  W
Sbjct  325  MDIAHGLTYLHSMEPDILHRDLKSRNVLLTSHLNAKLTDFGVSRERSDDLMTNAVGTSLW  384

Query  517  TAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQILQEVMAGTLR  576
             APEV+ G  Y  KAD++SFGV+LSELDT  +PY +  +  G K     ILQ V  GTL+
Sbjct  385  MAPEVMIGGHYDGKADVFSFGVLLSELDTHLMPYANVRNSSGRKPTEAAILQMVAVGTLQ  444

Query  577  PSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWL  612
              FS DCP  +  +A AC+S DP DRPTA + +  L
Sbjct  445  VEFSRDCPLELLTLAHACISVDPKDRPTAADALYKL  480

>PHALS_14321
Length=553

 Score = 210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/286 (41%), Positives = 162/286 (57%), Gaps = 31/286 (11%)

Query  359  LLGNRIPYESLSFQMELSKAASGEAWICQY------------------GRPTAFAEEIEL  400
            ++  RIP E+L     L++   GE +I  Y                      AF  E++L
Sbjct  261  IVAARIPRENLKVGQLLTRGGYGEVYIGSYLGKDVAVKMLLPETKKTMSHVNAFLSEVKL  320

Query  401  TASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLH---KNSDVLSWAGDRIYMAV  457
             ASL HPHIV F+GVAW+ L +L +V E++  GDL+  L+   KN   + +   ++ +A+
Sbjct  321  MASLHHPHIVSFVGVAWDQLIDLCVVTEYMVGGDLKALLNNYEKNGHAVGFDRTKVKIAI  380

Query  458  AVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAGVGTPYWT  517
             VA AL YLHS    +IHRDLKS NILL +D++ K+ DFG+SR  +D TMT G+GT  W 
Sbjct  381  HVASALVYLHSCKQPVIHRDLKSKNILLDKDMNAKVTDFGISRERVDATMTGGIGTSLWM  440

Query  518  APEVLEGARYSEKADIYSFGVVLSELDTGRIPY----------FDTVDHDGAKLMPFQIL  567
            APEV+ G RY +KAD++SFGVVLSELD+   PY            +   +  KL    I+
Sbjct  441  APEVMMGERYDDKADMFSFGVVLSELDSHTTPYALSKNSSNTTSSSSSAEPNKLPNAAIM  500

Query  568  QEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            Q V AG LR  FS   P  I  +  AC++ DP++RPTA E ++ L 
Sbjct  501  QMVAAGKLRVHFSDAGPKSIVDLGYACVAVDPAERPTASEALKKLR  546

>SDRG_10935
Length=749

 Score = 213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 145/229 (63%), Gaps = 10/229 (4%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDVLSWAGDRI  453
            F  EI L+A L HP+IV F+G+ W S+ NLS + EF+S GDL  FL K S  L+W G  +
Sbjct  518  FMAEIRLSARLEHPNIVAFVGMTWTSVYNLSAIYEFMSHGDLWQFL-KRSHGLTWHGPGV  576

Query  454  YMAVA---VAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
              A     V  AL YLH+ SP ++HRDLK+ N+LL +    KL DFG SR   D TMTA 
Sbjct  577  SKASILQDVIAALVYLHALSPVVVHRDLKAKNVLLNDVYVAKLGDFGASRECADHTMTAE  636

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFD------TVDHDGAKLMPF  564
            +GT  W APEVL+G RYSEKADIYSFGV++SE+DT ++PY +      + D +   L   
Sbjct  637  IGTVPWIAPEVLKGTRYSEKADIYSFGVLVSEVDTAKVPYSNLHDCCPSADGNSVALASA  696

Query  565  QILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
             I   V+ GTL+PSFS  CP  +  IA  CLS DP DRP+A +L  WLE
Sbjct  697  NIAMRVVKGTLQPSFSPSCPSVVLDIARQCLSHDPDDRPSAAQLAAWLE  745

>HYAP_03127
Length=399

 Score = 205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 149/237 (63%), Gaps = 21/237 (9%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNS-------DVL  446
            F  EI L  SL H  IV+FIGVAW+SL NLS V E++  GDL+  LH +        D L
Sbjct  128  FIREIALMGSLKHERIVEFIGVAWDSLRNLSAVTEYMERGDLRDVLHSSKRHGSNADDGL  187

Query  447  SWAGDRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSR------  500
            +W G ++ +A+ +AE L Y+HS SP +IHRDLKS N+LL +  + KL DFGVSR      
Sbjct  188  TWRGLKLTIALHIAEGLAYMHSLSPKVIHRDLKSKNVLLNDAYEAKLSDFGVSRERQVVG  247

Query  501  --GVMDLTMTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDT---VD  555
              G +   MT GVGT +W APEVL G  Y E ADI+SFGVVLSELDT   PY+++     
Sbjct  248  AKGGLGKFMTPGVGTSFWIAPEVLLGKDYDEHADIFSFGVVLSELDTDDYPYWNSGTIPG  307

Query  556  H---DGAKLMPFQILQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELI  609
            H   D  ++   +IL++V  G+LRP+F  DCP  +  +AA+CL   P +RP+A E++
Sbjct  308  HGIPDERRVQEQKILEKVALGSLRPTFYNDCPAGVLSLAASCLEGRPENRPSASEVV  364

>PHYCA_45835
Length=442

 Score = 206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 151/227 (67%), Gaps = 7/227 (3%)

Query  394  FAEEIELTASLIHPHIVKFIGVAWNSLSNLSMVLEFVSEGDLQGFLHKNSDV---LSWAG  450
            F  E ++TA++ HPHIV FIGVAW+SLS+L +VLE+++ G+L+  L+   D    + +  
Sbjct  214  FLAEAKMTATMDHPHIVSFIGVAWDSLSDLCVVLEYMNGGELRSLLNNYLDSNHPIGFNR  273

Query  451  DRIYMAVAVAEALEYLHSRSPAIIHRDLKSNNILLTEDLDPKLIDFGVSRGVMDLTMTAG  510
             +  +A+ V  AL YLHS  P++IHRDLKS NILL  ++  KL DFG+SR  +D TMTAG
Sbjct  274  QKATIALQVCHALTYLHSLMPSVIHRDLKSRNILLDSNMVAKLSDFGISRERLDRTMTAG  333

Query  511  VGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYF----DTVDHDGAKLMPFQI  566
            VGT  W APEV+ G RY +KAD++SFGVVLSELD   +PY     + +D +G ++    +
Sbjct  334  VGTSLWMAPEVMLGERYDDKADMFSFGVVLSELDVHSLPYTRARKENLDSNGREIADSIL  393

Query  567  LQEVMAGTLRPSFSVDCPPRIQRIAAACLSFDPSDRPTAQELIQWLE  613
            LQ+V  GT++  FS   P  +  +  AC+S DP+DRP+A E +  L+
Sbjct  394  LQKVALGTVQVEFSNPKPRSLGELGQACISIDPTDRPSAAEALYRLQ  440

Lambda      K        H        a         alpha
   0.318    0.133    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 47519425908

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40