Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_00003398985211e-69
PITG_1758414078404985272e-66
PPTG_1618914078437784002e-47
PHYRA_8455814078415783941e-46
PITG_1758014074110833423e-42
PHYSO_33795314078377773553e-41
PHYCA_54395314074110833207e-39
PHYCA_54395514071190833242e-38
PPTG_1619860904656833427e-38
PITG_2076616258704833411e-37
PPTG_1619372104680833401e-37
PITG_1757714071510833362e-37
PHYCA_54394614077314833262e-37
PHYSO_52006459511669833383e-37
PHYSO_5196247457669833383e-37
PHYSO_48504457255669833383e-37
PHYCA_53339059412483833325e-37
PHYRA_8455116259638833331e-36
PHYSO_33796716258677833322e-36
PHYRA_8455216258704833313e-36
PPTG_1620116259656833303e-36
PPTG_1620016258745833303e-36
PHYSO_56395260904667833303e-36
PHYSO_48358157176667833303e-36
PITG_2076716259661833294e-36
PITG_1757614070661833294e-36
PHYCA_54394914070195833079e-36
PHYSO_52088514077623833269e-36
PHYCA_10715859511188833042e-35
PPTG_1618414080656833224e-35
PHYRA_8455714077643833214e-35
PHYSO_52007216259661833191e-34
PITG_1758614080686833172e-34
PHYRA_8455472104686983163e-34
PHYSO_51844159412663833154e-34
PHYRA_84559594122650833154e-34
PHYRA_8455559511663833136e-34
PHYCA_10722414080650833092e-33
PHYCA_56393416259645833083e-33
PHYSO_25319514080677833084e-33
PPTG_1618752329640983074e-33
PHYSO_33795252329619983074e-33
PITG_000055493983054e-33
PPTG_1618614070608983065e-33
PPTG_1618559412632833059e-33
PPTG_1619014077641833059e-33
PHYSO_33795714071656813013e-32
PHYSO_32525250467656813013e-32
PHYCA_10748441152343832924e-32
PPTG_0191018472114832747e-32
HYAP_1443968302414832921e-31
PPTG_1619259511637832933e-31
PITG_1757814072481832914e-31
PHYSO_33796652336668972926e-31
PHYSO_52001714079661832916e-31
HYAP_1444016259647832917e-31
PPTG_1618814079657982917e-31
PPTG_1619952336666832891e-30
PITG_1758514079655982891e-30
PITG_1758314077550712881e-30
PITG_000044614982881e-30
PHYSO_52039814076679982872e-30
PHYKE_670814076311982773e-30
PHYCA_10723914076649982821e-29
PHYRA_8455352336664982821e-29
PPTG_020664355305982704e-29
PPTG_1619114076877982784e-29
PITG_1758214076707982775e-29
PHALS_054094355698982768e-29
PITG_051124355699982751e-28
HYAP_056614355698982741e-28
PHYSO_33795614070563832732e-28
PHYCA_5042764355696982713e-28
PPTG_1995924990112832504e-28
PYU1_G01493984586663982706e-28
PHYSO_2890744355532982671e-27
PHALS_0930133553114822462e-27
HYAP_1444114076832982662e-27
PHYKE_22474355526982652e-27
PYAR_1309499507478982615e-27
PITG_079686652526822609e-27
PHYSO_25320146189540652601e-26
PHYRA_8455614076817982601e-26
PHYSO_33795914072642652601e-26
CCA191524355720982591e-26
PHALS_0092111483631972564e-26
HYAP_036586652522822554e-26
PHYCA_5112876652515822555e-26
PHYRA_828474355696982555e-26
PHYKE_316259598542531e-25
CCA1935816258682982531e-25
CCI410416651413812501e-25
PPTG_021329254665832521e-25
PPTG_084746652531822512e-25
CCA219366651435782492e-25
CCA24786156553435782492e-25
PPTG_084736651473782493e-25
PITG_079676651474782483e-25
PHYKE_18136651469782474e-25
PHYCA_10736568302269822405e-25
PHYCA_12206611483344972427e-25
PHYCA_5112826651465792457e-25
PHYKE_94286652503782459e-25
PHYSO_5654336651472782441e-24
PHYRA_788689254905832442e-24
PHYCA_919014014325992382e-24
PHYSO_34111711483900972423e-24
HYAP_1483811483323972373e-24
PHYRA_812746652518812405e-24
PHYSO_5290226652517822396e-24
PHALS_036266651495782396e-24
PHYRA_812736651445792386e-24
PPTG_1620314069403762378e-24
PITG_112369254727802381e-23
PITG_1415611483747972381e-23
CCI4150116258680812371e-23
PHYRA_8371611483960972372e-23
PPTG_0985311483761972362e-23
SPRG_07851126016393992342e-23
SDRG_00886123590494812334e-23
PPTG_0920714014655992344e-23
PHYCA_5050505441382982315e-23
PHALS_129465441676812335e-23
SDRG_03655126016364992305e-23
CCA15252152124146982187e-23
PHYSO_51843814069241762248e-23
SPRG_06057125108687932328e-23
PHYSO_52241754411838982301e-22
PHYRA_402421407090442112e-22
PITG_1757514069792742292e-22
HYAP_059225441783782292e-22
PHYCA_57050646792351832262e-22
PITG_0648054411856782282e-22
PHYKE_25759254274652213e-22
H257_17420126019423792263e-22
PYAR_26845107383115812104e-22
PHYRA_773795441773982265e-22
PPTG_1417099507768782265e-22
SDRG_12761125108733792256e-22
SPRG_03078123590494812256e-22
H310_09502126019420782238e-22
PHYSO_51645914269516792248e-22
PHYSO_4864899254796802248e-22
H310_00232125108690822249e-22
SPRG_0912312110206832149e-22
PHYRA_773805442690982231e-21
PPTG_1729310161417782221e-21
PHYSO_26069146792486812221e-21
CCI434804355704692221e-21
PHYRA_7288946792365792201e-21
SPRG_059814355710812222e-21
SPRG_07856126019416782202e-21
PHYKE_907377386275992162e-21
SDRG_054544355704812212e-21
PITG_0962040422117982052e-21
PYIR_214567406398892193e-21
PITG_1749514014529992203e-21
PHYSO_52048959535608792203e-21
H310_04787122588576982203e-21
PYAR_22562104822113972043e-21
H257_03172122588596992193e-21
PHYSO_33795072104575812194e-21
SPRG_1595413103910321052194e-21
CCI1043915660402942166e-21
PHYCA_5051737407128982036e-21
H310_095056651427782167e-21
SPRG_030757396565972177e-21
PHALS_044597396515982178e-21
PHALS_05836581732982178e-21
PYAP_25223101791135992039e-21
SDRG_00196128027642782169e-21
PPTG_0007614269744822169e-21
PPTG_141695442687982169e-21
PHYRA_84550683021132782169e-21
SPRG_05680124923339812131e-20
SDRG_010221334497651002161e-20
HYAP_074548796545992161e-20
PITG_1784014269513792151e-20
H257_06723125108724822161e-20
PPTG_0773643968431992141e-20
PHYRA_75791176731071792151e-20
SPRG_11390128027655792151e-20
SPRG_05677124920327982121e-20
SDRG_07151136165658992151e-20
SDRG_07165127060722822151e-20
SDRG_12347133024541832151e-20
H257_17421146426406812141e-20
SDRG_008837396571972151e-20
CCA1985115660401942131e-20
PITG_064815442658982151e-20
SDRG_010241222117261002152e-20
PHYCA_537412110806842152e-20
H310_018601866746982152e-20
H257_04203140046526782142e-20
H310_11716123694643952142e-20
SPRG_03077123589507782142e-20
SPRG_078556651420782132e-20
PPTG_0006914262765812142e-20
SDRG_07159124916972812142e-20
PYAP_25222101790114971992e-20
PHYSO_499386140144901002142e-20
SPRG_09616127064327982112e-20
SDRG_01023135238769812142e-20
SPRG_09620136165965812142e-20
SPRG_05673124916965812132e-20
H257_15213150633206812052e-20
PHYCA_55385314269513792132e-20
SPRG_18782133449783812132e-20
CCI47779437911841082132e-20
H310_12939142575559822132e-20
PHALS_025133957320992103e-20
PYVX_1794454417041192133e-20
PYIW_27949167408113821983e-20
PHYRA_8163114014634972123e-20
PHALS_00564176911221021983e-20
PYVX_179515442675832123e-20
PITG_1783214262767812123e-20
PHYKE_24037396532972123e-20
SDRG_11990124299885982124e-20
H257_184031866715972124e-20
PITG_088987404678842124e-20
PHYCA_50345253496435992114e-20
H257_1297612111557842124e-20
HYAP_059215442565982114e-20
PPTG_062467404674842124e-20
SPRG_002351222114821002114e-20
PYU1_G01319816607351992094e-20
PHYCA_1051105294327812084e-20
PHYSO_51560514262773832114e-20
PHALS_0478412110808842114e-20
PITG_088907396521972115e-20
PITG_106758796521992115e-20
PHYSO_35403653496437992105e-20
H310_08166124916348812085e-20
SPRG_12231128528306982075e-20
PHYCA_118938578979982116e-20
PPTG_062587396528972106e-20
PHYCA_12966043158289982066e-20
PPTG_141405294477752106e-20
PHYKE_50573957357992086e-20
PHYCA_5079908796235992046e-20
PHYCA_1052695442652982106e-20
PHALS_070565781216982106e-20
PITG_00643578896982106e-20
PPTG_111813957359992086e-20
HYAP_08539140146201002107e-20
SDRG_01027122208754992107e-20
PHYRA_748733957363992087e-20
SDRG_00885123589517782107e-20
H310_07796144455489972097e-20
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00003

Length=98
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00003                                                            205        1e-69
PITG_17584                                                            207        2e-66
PPTG_16189                                                            158        2e-47
PHYRA_84558                                                           156        1e-46
PITG_17580                                                            136        3e-42
PHYSO_337953                                                          141        3e-41
PHYCA_543953                                                          127        7e-39
PHYCA_543955                                                          129        2e-38
PPTG_16198                                                            136        7e-38
PITG_20766                                                            135        1e-37
PPTG_16193                                                            135        1e-37
PITG_17577                                                            134        2e-37
PHYCA_543946                                                          130        2e-37
PHYSO_520064                                                          134        3e-37
PHYSO_519624                                                          134        3e-37
PHYSO_485044                                                          134        3e-37
PHYCA_533390                                                          132        5e-37
PHYRA_84551                                                           132        1e-36
PHYSO_337967                                                          132        2e-36
PHYRA_84552                                                           132        3e-36
PPTG_16201                                                            131        3e-36
PPTG_16200                                                            131        3e-36
PHYSO_563952                                                          131        3e-36
PHYSO_483581                                                          131        3e-36
PITG_20767                                                            131        4e-36
PITG_17576                                                            131        4e-36
PHYCA_543949                                                          122        9e-36
PHYSO_520885                                                          130        9e-36
PHYCA_107158                                                          121        2e-35
PPTG_16184                                                            128        4e-35
PHYRA_84557                                                           128        4e-35
PHYSO_520072                                                          127        1e-34
PITG_17586                                                            126        2e-34
PHYRA_84554                                                           126        3e-34
PHYSO_518441                                                          125        4e-34
PHYRA_84559                                                           125        4e-34
PHYRA_84555                                                           125        6e-34
PHYCA_107224                                                          123        2e-33
PHYCA_563934                                                          123        3e-33
PHYSO_253195                                                          123        4e-33
PPTG_16187                                                            122        4e-33
PHYSO_337952                                                          122        4e-33
PITG_00005                                                            122        4e-33
PPTG_16186                                                            122        5e-33
PPTG_16185                                                            122        9e-33
PPTG_16190                                                            122        9e-33
PHYSO_337957                                                          120        3e-32
PHYSO_325252                                                          120        3e-32
PHYCA_107484                                                          117        4e-32
PPTG_01910                                                            110        7e-32
HYAP_14439                                                            117        1e-31
PPTG_16192                                                            117        3e-31
PITG_17578                                                            116        4e-31
PHYSO_337966                                                          117        6e-31
PHYSO_520017                                                          116        6e-31
HYAP_14440                                                            116        7e-31
PPTG_16188                                                            116        7e-31
PPTG_16199                                                            115        1e-30
PITG_17585                                                            115        1e-30
PITG_17583                                                            115        1e-30
PITG_00004                                                            115        1e-30
PHYSO_520398                                                          115        2e-30
PHYKE_6708                                                            111        3e-30
PHYCA_107239                                                          113        1e-29
PHYRA_84553                                                           113        1e-29
PPTG_02066                                                            108        4e-29
PPTG_16191                                                            111        4e-29
PITG_17582                                                            111        5e-29
PHALS_05409                                                           110        8e-29
PITG_05112                                                            110        1e-28
HYAP_05661                                                            110        1e-28
PHYSO_337956                                                          109        2e-28
PHYCA_504276                                                          108        3e-28
PPTG_19959                                                            100        4e-28
PYU1_G014939                                                          108        6e-28
PHYSO_289074                                                          107        1e-27
PHALS_09301                                                           99.4       2e-27
HYAP_14441                                                            107        2e-27
PHYKE_2247                                                            106        2e-27
PYAR_13094                                                            105        5e-27
PITG_07968                                                            104        9e-27
PHYSO_253201                                                          104        1e-26
PHYRA_84556                                                           104        1e-26
PHYSO_337959                                                          104        1e-26
CCA19152                                                              104        1e-26
PHALS_00921                                                           103        4e-26
HYAP_03658                                                            102        4e-26
PHYCA_511287                                                          102        5e-26
PHYRA_82847                                                           102        5e-26
PHYKE_3                                                               102        1e-25
CCA19358                                                              102        1e-25
CCI41041                                                              100        1e-25
PPTG_02132                                                            101        1e-25
PPTG_08474                                                            101        2e-25
CCA21936                                                              100        2e-25
CCA24786                                                              100        2e-25
PPTG_08473                                                            100        3e-25
PITG_07967                                                            100        3e-25
PHYKE_1813                                                            99.8       4e-25
PHYCA_107365                                                          97.1       5e-25
PHYCA_122066                                                          97.8       7e-25
PHYCA_511282                                                          99.0       7e-25
PHYKE_9428                                                            99.0       9e-25
PHYSO_565433                                                          98.6       1e-24
PHYRA_78868                                                           98.6       2e-24
PHYCA_9190                                                            96.3       2e-24
PHYSO_341117                                                          97.8       3e-24
HYAP_14838                                                            95.9       3e-24
PHYRA_81274                                                           97.1       5e-24
PHYSO_529022                                                          96.7       6e-24
PHALS_03626                                                           96.7       6e-24
PHYRA_81273                                                           96.3       6e-24
PPTG_16203                                                            95.9       8e-24
PITG_11236                                                            96.3       1e-23
PITG_14156                                                            96.3       1e-23
CCI41501                                                              95.9       1e-23
PHYRA_83716                                                           95.9       2e-23
PPTG_09853                                                            95.5       2e-23
SPRG_07851                                                            94.7       2e-23
SDRG_00886                                                            94.4       4e-23
PPTG_09207                                                            94.7       4e-23
PHYCA_505050                                                          93.6       5e-23
PHALS_12946                                                           94.4       5e-23
SDRG_03655                                                            93.2       5e-23
CCA15252                                                              88.6       7e-23
PHYSO_518438                                                          90.9       8e-23
SPRG_06057                                                            94.0       8e-23
PHYSO_522417                                                          93.2       1e-22
PHYRA_40242                                                           85.9       2e-22
PITG_17575                                                            92.8       2e-22
HYAP_05922                                                            92.8       2e-22
PHYCA_570506                                                          91.7       2e-22
PITG_06480                                                            92.4       2e-22
PHYKE_2575                                                            89.7       3e-22
H257_17420                                                            91.7       3e-22
PYAR_26845                                                            85.5       4e-22
PHYRA_77379                                                           91.7       5e-22
PPTG_14170                                                            91.7       5e-22
SDRG_12761                                                            91.3       6e-22
SPRG_03078                                                            91.3       6e-22
H310_09502                                                            90.5       8e-22
PHYSO_516459                                                          90.9       8e-22
PHYSO_486489                                                          90.9       8e-22
H310_00232                                                            90.9       9e-22
SPRG_09123                                                            87.0       9e-22
PHYRA_77380                                                           90.5       1e-21
PPTG_17293                                                            90.1       1e-21
PHYSO_260691                                                          90.1       1e-21
CCI43480                                                              90.1       1e-21
PHYRA_72889                                                           89.4       1e-21
SPRG_05981                                                            90.1       2e-21
SPRG_07856                                                            89.4       2e-21
PHYKE_9073                                                            87.8       2e-21
SDRG_05454                                                            89.7       2e-21
PITG_09620                                                            83.6       2e-21
PYIR_21456                                                            89.0       3e-21
PITG_17495                                                            89.4       3e-21
PHYSO_520489                                                          89.4       3e-21
H310_04787                                                            89.4       3e-21
PYAR_22562                                                            83.2       3e-21
H257_03172                                                            89.0       3e-21
PHYSO_337950                                                          89.0       4e-21
SPRG_15954                                                            89.0       4e-21
CCI10439                                                              87.8       6e-21
PHYCA_505173                                                          82.8       6e-21
H310_09505                                                            87.8       7e-21
SPRG_03075                                                            88.2       7e-21
PHALS_04459                                                           88.2       8e-21
PHALS_05836                                                           88.2       8e-21
PYAP_25223                                                            82.8       9e-21
SDRG_00196                                                            87.8       9e-21
PPTG_00076                                                            87.8       9e-21
PPTG_14169                                                            87.8       9e-21
PHYRA_84550                                                           87.8       9e-21
SPRG_05680                                                            86.7       1e-20
SDRG_01022                                                            87.8       1e-20
HYAP_07454                                                            87.8       1e-20
PITG_17840                                                            87.4       1e-20
H257_06723                                                            87.8       1e-20
PPTG_07736                                                            87.0       1e-20
PHYRA_75791                                                           87.4       1e-20
SPRG_11390                                                            87.4       1e-20
SPRG_05677                                                            86.3       1e-20
SDRG_07151                                                            87.4       1e-20
SDRG_07165                                                            87.4       1e-20
SDRG_12347                                                            87.4       1e-20
H257_17421                                                            87.0       1e-20
SDRG_00883                                                            87.4       1e-20
CCA19851                                                              86.7       1e-20
PITG_06481                                                            87.4       1e-20
SDRG_01024                                                            87.4       2e-20
PHYCA_5374                                                            87.4       2e-20
H310_01860                                                            87.4       2e-20
H257_04203                                                            87.0       2e-20
H310_11716                                                            87.0       2e-20
SPRG_03077                                                            87.0       2e-20
SPRG_07855                                                            86.7       2e-20
PPTG_00069                                                            87.0       2e-20
SDRG_07159                                                            87.0       2e-20
PYAP_25222                                                            81.3       2e-20
PHYSO_499386                                                          87.0       2e-20
SPRG_09616                                                            85.9       2e-20
SDRG_01023                                                            87.0       2e-20
SPRG_09620                                                            87.0       2e-20
SPRG_05673                                                            86.7       2e-20
H257_15213                                                            83.6       2e-20
PHYCA_553853                                                          86.7       2e-20
SPRG_18782                                                            86.7       2e-20
CCI47779                                                              86.7       2e-20
H310_12939                                                            86.7       2e-20
PHALS_02513                                                           85.5       3e-20
PYVX_17944                                                            86.7       3e-20
PYIW_27949                                                            80.9       3e-20
PHYRA_81631                                                           86.3       3e-20
PHALS_00564                                                           80.9       3e-20
PYVX_17951                                                            86.3       3e-20
PITG_17832                                                            86.3       3e-20
PHYKE_2403                                                            86.3       3e-20
SDRG_11990                                                            86.3       4e-20
H257_18403                                                            86.3       4e-20
PITG_08898                                                            86.3       4e-20
PHYCA_503452                                                          85.9       4e-20
H257_12976                                                            86.3       4e-20
HYAP_05921                                                            85.9       4e-20
PPTG_06246                                                            86.3       4e-20
SPRG_00235                                                            85.9       4e-20
PYU1_G013198                                                          85.1       4e-20
PHYCA_105110                                                          84.7       4e-20
PHYSO_515605                                                          85.9       4e-20
PHALS_04784                                                           85.9       4e-20
PITG_08890                                                            85.9       5e-20
PITG_10675                                                            85.9       5e-20
PHYSO_354036                                                          85.5       5e-20
H310_08166                                                            84.7       5e-20
SPRG_12231                                                            84.3       5e-20
PHYCA_118938                                                          85.9       6e-20
PPTG_06258                                                            85.5       6e-20
PHYCA_129660                                                          84.0       6e-20
PPTG_14140                                                            85.5       6e-20
PHYKE_5057                                                            84.7       6e-20
PHYCA_507990                                                          83.2       6e-20
PHYCA_105269                                                          85.5       6e-20
PHALS_07056                                                           85.5       6e-20
PITG_00643                                                            85.5       6e-20
PPTG_11181                                                            84.7       6e-20
HYAP_08539                                                            85.5       7e-20
SDRG_01027                                                            85.5       7e-20
PHYRA_74873                                                           84.7       7e-20
SDRG_00885                                                            85.5       7e-20
H310_07796                                                            85.1       7e-20
PHYRA_81229                                                           85.5       7e-20
PITG_04611                                                            84.7       7e-20
PPTG_23134                                                            85.5       7e-20
HYAP_09438                                                            84.7       7e-20
H310_09542                                                            85.1       7e-20
PHYCA_504366                                                          84.3       8e-20
PHYSO_292762                                                          84.3       8e-20
SPRG_00232                                                            85.1       8e-20
PHYRA_76005                                                           85.1       8e-20
PHYCA_570505                                                          85.1       9e-20
PHYSO_523359                                                          85.1       9e-20
H257_13791                                                            85.1       9e-20
PHYRA_84546                                                           84.7       1e-19
H257_12790                                                            85.1       1e-19
PPTG_08127                                                            85.1       1e-19
H310_03248                                                            85.1       1e-19
SDRG_07163                                                            84.7       1e-19
PHYCA_106047                                                          84.3       1e-19
H310_09503                                                            84.3       1e-19
PHALS_02415                                                           84.7       1e-19
HYAP_06259                                                            84.7       1e-19
SPRG_03267                                                            84.7       1e-19
PHYRA_93564                                                           83.6       1e-19
PHYSO_563622                                                          84.7       1e-19
PITG_09665                                                            84.7       1e-19
PHYRA_72888                                                           84.3       1e-19
PHYCA_125089                                                          84.3       2e-19
PHYSO_506773                                                          84.3       2e-19
H310_12631                                                            84.3       2e-19
PHYCA_540644                                                          80.9       2e-19
H310_07804                                                            84.0       2e-19
PITG_00646                                                            84.0       2e-19
PITG_14971                                                            84.0       2e-19
SPRG_02180                                                            84.0       2e-19
SDRG_01312                                                            84.0       2e-19
H310_07805                                                            83.6       3e-19
PPTG_08125                                                            84.0       3e-19
PHYSO_347055                                                          83.6       3e-19
PHYCA_10859                                                           83.6       3e-19
PHYRA_96877                                                           83.6       3e-19
SPRG_04439                                                            83.6       3e-19
PPTG_06243                                                            83.6       3e-19
SDRG_05329                                                            83.2       3e-19
SDRG_02921                                                            83.6       3e-19
H257_12933                                                            83.6       3e-19
PHYRA_76010                                                           83.6       3e-19
HYAP_03127                                                            83.2       3e-19
PHYCA_119381                                                          82.0       4e-19
SDRG_10935                                                            83.6       4e-19
PHYKE_1427                                                            83.2       4e-19
PHYCA_505168                                                          83.2       4e-19
PHYSO_540589                                                          81.3       4e-19
CCA15806                                                              83.2       4e-19
H257_05418                                                            82.8       4e-19
H310_07620                                                            83.2       4e-19
SDRG_12215                                                            83.2       4e-19
CCI46758                                                              83.2       5e-19
PHYRA_95776                                                           82.8       5e-19
SPRG_09125                                                            82.8       5e-19
PHYCA_541730                                                          81.6       5e-19
H257_09580                                                            82.8       6e-19
H257_17422                                                            82.4       6e-19
H257_09963                                                            82.4       6e-19
HYAP_03125                                                            82.8       6e-19
SDRG_04539                                                            77.8       6e-19
H310_09469                                                            82.8       6e-19
PHYSO_563616                                                          82.8       6e-19
PYAR_24694                                                            77.4       6e-19
PYAR_19484                                                            80.1       6e-19
SPRG_00505                                                            82.4       7e-19
PHYKE_9028                                                            82.4       7e-19
PHALS_09097                                                           82.4       7e-19
PHYSO_257110                                                          78.2       7e-19
H257_13799                                                            82.4       7e-19
PHYSO_515035                                                          82.4       8e-19
SDRG_07620                                                            82.4       8e-19
PHYRA_72890                                                           82.4       8e-19
SPRG_00989                                                            82.4       8e-19
H310_13576                                                            82.0       8e-19
PITG_06286                                                            82.0       8e-19
SPRG_09612                                                            82.0       8e-19
PPTG_00068                                                            82.4       8e-19
PYIW_27992                                                            77.0       8e-19
PPTG_01723                                                            82.4       8e-19
HYAP_01680                                                            82.4       9e-19
PHYSO_413418                                                          81.3       9e-19
PHYCA_503731                                                          78.6       9e-19
SDRG_05105                                                            82.0       1e-18
SPRG_03506                                                            81.6       1e-18
SDRG_16928                                                            82.0       1e-18
H257_07477                                                            82.0       1e-18
PHYRA_80633                                                           82.0       1e-18
PHYRA_80636                                                           82.0       1e-18
H310_05131                                                            82.0       1e-18
PHYSO_562449                                                          82.0       1e-18
PHYRA_77819                                                           82.0       1e-18
SDRG_03360                                                            82.0       1e-18
SPRG_14253                                                            82.0       1e-18
H310_12616                                                            81.6       1e-18
HYAP_13907                                                            81.3       1e-18
PHYRA_75692                                                           81.6       1e-18
SDRG_12348                                                            81.6       1e-18
PITG_09664                                                            81.6       1e-18
SDRG_16768                                                            81.6       1e-18
HYAP_14247                                                            76.6       1e-18
PITG_14972                                                            81.6       1e-18
PPTG_01724                                                            81.6       1e-18
H310_10437                                                            81.3       1e-18
PHYRA_75691                                                           81.6       1e-18
SDRG_05099                                                            81.6       2e-18
PHYSO_335179                                                          81.3       2e-18
PHYRA_95777                                                           80.5       2e-18
PHYSO_424746                                                          81.3       2e-18
SPRG_09124                                                            81.3       2e-18
PHYRA_76361                                                           81.3       2e-18
HYAP_01732                                                            80.9       2e-18
SDRG_14509                                                            81.3       2e-18
SDRG_14551                                                            80.5       2e-18
PHYCA_100619                                                          81.3       2e-18
PYIW_22386                                                            75.9       2e-18
PHYCA_504951                                                          76.6       2e-18
PHYRA_87701                                                           79.0       2e-18
H257_11245                                                            80.9       2e-18
SPRG_16131                                                            80.5       2e-18
H257_13792                                                            80.9       2e-18
SPRG_14246                                                            80.9       2e-18
PYAP_21127                                                            80.9       2e-18
H310_12940                                                            80.9       3e-18
PITG_21079                                                            76.6       3e-18
SDRG_13980                                                            78.6       3e-18
SDRG_00884                                                            80.1       3e-18
PHYCA_550540                                                          79.7       3e-18
SPRG_01930                                                            80.9       3e-18
SDRG_08311                                                            80.9       3e-18
H257_10569                                                            80.9       3e-18
PHYCA_100849                                                          78.2       3e-18
PHYSO_335699                                                          80.9       3e-18
PPTG_01986                                                            80.5       3e-18
CCI39781                                                              80.5       3e-18
H310_12630                                                            80.5       3e-18
PITG_23090                                                            80.5       3e-18
SPRG_12836                                                            80.5       4e-18
H257_13798                                                            80.5       4e-18
SPRG_00721                                                            80.5       4e-18
PHYSO_324311                                                          80.5       4e-18
SPRG_13911                                                            80.5       4e-18
SPRG_16132                                                            80.5       4e-18
SDRG_12013                                                            75.5       4e-18
SPRG_17043                                                            80.1       4e-18
PITG_17571                                                            80.1       5e-18
SPRG_04655                                                            80.1       5e-18
SDRG_10829                                                            80.1       5e-18
SDRG_02945                                                            80.1       5e-18
PHYCA_563236                                                          79.0       5e-18
SDRG_15850                                                            80.1       5e-18
SDRG_00109                                                            80.1       5e-18
SPRG_04928                                                            80.1       5e-18
PHYCA_101485                                                          79.7       6e-18
SPRG_07717                                                            80.1       6e-18
SPRG_11580                                                            79.7       6e-18
CCA23126                                                              80.1       6e-18
PHALS_14336                                                           79.7       6e-18
H257_09962                                                            79.7       6e-18
PHYSO_418557                                                          79.7       6e-18
SDRG_01554                                                            79.7       6e-18
PITG_20960                                                            77.0       7e-18
PHYRA_75980                                                           79.7       7e-18
SDRG_01275                                                            79.7       7e-18
SDRG_14547                                                            79.7       7e-18
PHYCA_6225                                                            78.2       7e-18
PHYCA_49291                                                           76.6       7e-18
PYIW_25432                                                            79.0       7e-18
H310_00376                                                            79.7       7e-18
H310_08315                                                            76.6       7e-18
PHALS_05686                                                           79.7       8e-18
SDRG_14284                                                            79.7       8e-18
SPRG_19673                                                            79.3       8e-18
CCI48517                                                              79.7       8e-18
H257_09180                                                            79.3       8e-18
PITG_19256                                                            78.2       8e-18
PPTG_16204                                                            79.3       9e-18
HYAP_09186                                                            79.3       9e-18
SDRG_15725                                                            79.3       1e-17
PITG_13397                                                            79.3       1e-17
PITG_08901                                                            79.3       1e-17
PPTG_19122                                                            79.3       1e-17
SPRG_09126                                                            79.3       1e-17
PHYSO_512254                                                          79.3       1e-17
H257_13800                                                            79.0       1e-17
PPTG_10350                                                            79.3       1e-17
SPRG_03241                                                            79.0       1e-17
PPTG_21833                                                            79.0       1e-17
PHYKE_9559                                                            79.0       1e-17
PYAR_26682                                                            74.3       1e-17
SDRG_09093                                                            79.0       1e-17
PHYCA_35810                                                           77.8       1e-17
PYIW_13137                                                            79.0       1e-17
PPTG_00610                                                            79.0       1e-17
PHYCA_506593                                                          78.6       1e-17
H310_07798                                                            79.0       1e-17
PHYRA_73247                                                           79.0       1e-17
PITG_08967                                                            79.0       1e-17
PHALS_09634                                                           78.2       1e-17
PYAP_19427                                                            77.8       1e-17
SPRG_15955                                                            79.0       1e-17
PPTG_02401                                                            78.6       1e-17
HYAP_14295                                                            78.6       1e-17
PHYKE_9600                                                            78.2       1e-17
PITG_17831                                                            78.6       1e-17
PHYRA_82498                                                           78.6       2e-17
PHYCA_542625                                                          78.6       2e-17
SPRG_14770                                                            78.6       2e-17
PHYRA_77814                                                           78.6       2e-17
PHYRA_81472                                                           78.6       2e-17
SDRG_14562                                                            78.6       2e-17
PITG_00640                                                            78.6       2e-17
PHALS_13757                                                           78.6       2e-17
PYIR_13884                                                            78.6       2e-17
SDRG_13972                                                            78.6       2e-17
CCA15593                                                              78.6       2e-17
CCA16348                                                              78.6       2e-17
SPRG_14734                                                            78.2       2e-17
PHALS_01863                                                           78.2       2e-17
PHYRA_72884                                                           78.2       2e-17
HYAP_06056                                                            78.2       2e-17
H257_15735                                                            78.2       2e-17
PYIW_27598                                                            73.6       2e-17
PHYCA_101449                                                          78.2       2e-17
PPTG_06851                                                            77.0       2e-17
SDRG_17343                                                            73.6       2e-17
SPRG_01416                                                            78.2       2e-17
PHYSO_262540                                                          78.2       2e-17
PPTG_20656                                                            78.2       3e-17
PPTG_11454                                                            78.2       3e-17
SDRG_02762                                                            78.2       3e-17
PITG_10971                                                            77.8       3e-17
SPRG_15849                                                            78.2       3e-17
SDRG_04071                                                            75.9       3e-17
PHYRA_74479                                                           77.8       3e-17
SDRG_07967                                                            78.2       3e-17
PHYCA_543324                                                          77.0       3e-17
H310_07797                                                            78.2       3e-17
SPRG_09773                                                            76.3       3e-17
H310_06674                                                            77.8       3e-17
PHYKE_8150                                                            76.6       3e-17
SDRG_15505                                                            77.8       3e-17
PPTG_16208                                                            77.8       3e-17
SDRG_01020                                                            77.8       3e-17
SDRG_12216                                                            77.8       3e-17
HYAP_04854                                                            77.8       3e-17

>PITG_00003
Length=98

 Score = 205 bits (521),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI
Sbjct  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60

Query  61  LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
           LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS
Sbjct  61  LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98

>PITG_17584
Length=404

 Score = 207 bits (527),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI
Sbjct  307  MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  366

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS
Sbjct  367  LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  404

>PPTG_16189
Length=437

 Score = 158 bits (400),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/78 (94%), Positives = 76/78 (97%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYWIAPEILEGKRYTE ADIYSFGVVLSELDTCK PFSDVVTAEGKKPKP+QI
Sbjct  321  MTAGVGTPYWIAPEILEGKRYTELADIYSFGVVLSELDTCKTPFSDVVTAEGKKPKPLQI  380

Query  61   LHWVLDGRLSPTFSDKCP  78
            LHWVLDGRLSP+F+DKCP
Sbjct  381  LHWVLDGRLSPSFTDKCP  398

>PHYRA_84558
Length=415

 Score = 156 bits (394),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/78 (91%), Positives = 75/78 (96%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVT EGKKPKP Q+
Sbjct  299  MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTDEGKKPKPFQV  358

Query  61   LHWVLDGRLSPTFSDKCP  78
            LHWVLDG LSP+FS++CP
Sbjct  359  LHWVLDGSLSPSFSEECP  376

>PITG_17580
Length=110

 Score = 136 bits (342),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MTAGVGTPYW APE+LEGKRYTEQAD+YSFGVVLSELDTCK+PF D +T++G+KPKPVQI
Sbjct  1   MTAGVGTPYWTAPEVLEGKRYTEQADLYSFGVVLSELDTCKLPFHDALTSDGRKPKPVQI  60

Query  61  LHWVLDGRLSPTFSDKCPSRLER  83
           L  V+ G L P+FS+ CP R+ R
Sbjct  61  LADVMAGMLRPSFSEDCPRRIRR  83

>PHYSO_337953
Length=377

 Score = 141 bits (355),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 0/77 (0%)

Query  2    TAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQIL  61
            TAGVGTPYWIAPE L+GKRY+EQADIYSFGVVLSELDTC+ PF+D VTAEGKKPKP QIL
Sbjct  265  TAGVGTPYWIAPESLQGKRYSEQADIYSFGVVLSELDTCRTPFTDGVTAEGKKPKPAQIL  324

Query  62   HWVLDGRLSPTFSDKCP  78
             WVLDG+LSP FS  CP
Sbjct  325  RWVLDGKLSPAFSQDCP  341

>PHYCA_543953
Length=110

 Score = 127 bits (320),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MTAGVGTPYW APEI+EGKRYTEQADI+SFGVVLSELDT K+P+ D +T++GKK KP QI
Sbjct  1   MTAGVGTPYWTAPEIMEGKRYTEQADIFSFGVVLSELDTGKLPYHDALTSDGKKQKPFQI  60

Query  61  LHWVLDGRLSPTFSDKCPSRLER  83
           L  V+ G L P+FS+ CP R+ R
Sbjct  61  LSDVMAGTLRPSFSENCPRRIRR  83

>PHYCA_543955
Length=190

 Score = 129 bits (324),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQAD+YSFGVVLSELDT K+P+ D +T+EGKK KP QI
Sbjct  83   MTAGVGTPYWTAPEILEGKRYTEQADLYSFGVVLSELDTGKLPYHDALTSEGKKLKPFQI  142

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CPS++ R
Sbjct  143  LADVMAGMLRPSFSEGCPSKIRR  165

>PPTG_16198
Length=656

 Score = 136 bits (342),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQAD+YSFGVVLSELDTCK+PF D  T++GKK KPVQI
Sbjct  547  MTAGVGTPYWTAPEILEGKRYTEQADLYSFGVVLSELDTCKLPFHDAFTSDGKKLKPVQI  606

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS++CP R+ R
Sbjct  607  LADVMAGMLRPSFSNECPQRIRR  629

>PITG_20766
Length=704

 Score = 135 bits (341),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEGKRYTEQADIYSFGVVL+ELDT K+P+ D +TAEGKKPKP QI
Sbjct  595  MTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLTELDTSKVPYHDALTAEGKKPKPFQI  654

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CPSR+ R
Sbjct  655  LTDVMAGMLRPSFSENCPSRIRR  677

>PPTG_16193
Length=680

 Score = 135 bits (340),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDTCK+P+ DVV ++GK  KPVQI
Sbjct  571  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTCKLPYHDVVGSDGKMLKPVQI  630

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FSD+CP R+ R
Sbjct  631  LADVMAGMLRPSFSDECPRRIRR  653

>PITG_17577
Length=510

 Score = 134 bits (336),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEGKRYTEQADIYSFGVVL+ELDT K+P+ D +TAEGKKPKP QI
Sbjct  401  MTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLTELDTSKVPYHDALTAEGKKPKPFQI  460

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  461  LTDVMAGMLRPSFSENCPLRIRR  483

>PHYCA_543946
Length=314

 Score = 130 bits (326),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEGKRY+EQADIYSFGVVLSELDTCK+PF D ++A GKK KP  I
Sbjct  206  MTAGVGTPYWTAPEVLEGKRYSEQADIYSFGVVLSELDTCKIPFHDCLSANGKKAKPFHI  265

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS  CP R+ R
Sbjct  266  LQGVMSGTLRPSFSPDCPPRIRR  288

>PHYSO_520064
Length=669

 Score = 134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEG+RYTEQADIYSFGVVLSELDTCK+P+ D +T +G+KPKP QI
Sbjct  560  MTAGVGTPYWTAPEILEGRRYTEQADIYSFGVVLSELDTCKLPYHDALTQDGQKPKPFQI  619

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  620  LADVMAGTLRPSFSESCPRRIRR  642

>PHYSO_519624
Length=669

 Score = 134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEG+RYTEQADIYSFGVVLSELDTCK+P+ D +T +G+KPKP QI
Sbjct  560  MTAGVGTPYWTAPEILEGRRYTEQADIYSFGVVLSELDTCKLPYHDALTQDGQKPKPFQI  619

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  620  LADVMAGTLRPSFSESCPRRIRR  642

>PHYSO_485044
Length=669

 Score = 134 bits (338),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEG+RYTEQADIYSFGVVLSELDTCK+P+ D +T +G+KPKP QI
Sbjct  560  MTAGVGTPYWTAPEILEGRRYTEQADIYSFGVVLSELDTCKLPYHDALTQDGQKPKPFQI  619

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  620  LADVMAGTLRPSFSESCPRRIRR  642

>PHYCA_533390
Length=483

 Score = 132 bits (332),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVL+ELDTC +P+SD  T  G KPKP QI
Sbjct  376  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTCAIPYSDAATENGGKPKPFQI  435

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L PTFS  CP R+++
Sbjct  436  LQDVMMGKLRPTFSQDCPPRIKK  458

>PHYRA_84551
Length=638

 Score = 132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVL+ELDTCK+P+S+  T  G KPKP QI
Sbjct  528  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTCKIPYSNAATEGGGKPKPFQI  587

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L P+FS+ CP R++R
Sbjct  588  LQDVMAGKLRPSFSEDCPPRIKR  610

>PHYSO_337967
Length=677

 Score = 132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRY EQ DIYSFGVVLSELDT K+P+ D +T+EGKKPKP QI
Sbjct  566  MTAGVGTPYWTAPEILEGKRYMEQVDIYSFGVVLSELDTGKIPYHDALTSEGKKPKPFQI  625

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS++CP+R+ R
Sbjct  626  LSDVMAGMLRPSFSEQCPTRIRR  648

>PHYRA_84552
Length=704

 Score = 132 bits (331),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 70/83 (84%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQAD+YSFGVVLSELDT K+P+ D +T+ GKKPKP QI
Sbjct  595  MTAGVGTPYWTAPEILEGKRYTEQADMYSFGVVLSELDTGKIPYHDALTSNGKKPKPFQI  654

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CPSR+ R
Sbjct  655  LTDVMAGMLRPSFSEDCPSRIRR  677

>PPTG_16201
Length=656

 Score = 131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVL+ELDT K+P+SD  T  G KPKP QI
Sbjct  545  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDATTEHGGKPKPFQI  604

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L PTFS+ CP R+++
Sbjct  605  LQDVMAGKLRPTFSEDCPPRIKK  627

>PPTG_16200
Length=745

 Score = 131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEGKRYTEQADIYSFGVVL+ELDT K+P+ D +TAEG KPKP QI
Sbjct  636  MTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLTELDTGKVPYHDALTAEGNKPKPFQI  695

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS  CPSR+ R
Sbjct  696  LTDVMAGMLRPSFSKDCPSRIRR  718

>PHYSO_563952
Length=667

 Score = 131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEIL+G RYTEQADIYSFGVVLSELDT K+P+ D +T+ GKKPKPVQI
Sbjct  558  MTAGVGTPYWTAPEILQGSRYTEQADIYSFGVVLSELDTTKLPYHDALTSNGKKPKPVQI  617

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  618  LADVMAGMLRPSFSEDCPRRIRR  640

>PHYSO_483581
Length=667

 Score = 131 bits (330),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 69/83 (83%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEIL+G RYTEQADIYSFGVVLSELDT K+P+ D +T+ GKKPKPVQI
Sbjct  558  MTAGVGTPYWTAPEILQGSRYTEQADIYSFGVVLSELDTTKLPYHDALTSNGKKPKPVQI  617

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  618  LADVMAGMLRPSFSEDCPRRIRR  640

>PITG_20767
Length=661

 Score = 131 bits (329),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVL+ELDT K+P+SD  T  G KPKP QI
Sbjct  540  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDAATEHGGKPKPFQI  599

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L PTFS  CP R+++
Sbjct  600  LQDVMAGKLRPTFSKDCPPRIQK  622

>PITG_17576
Length=661

 Score = 131 bits (329),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVL+ELDT K+P+SD  T  G KPKP QI
Sbjct  540  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLTELDTSKIPYSDAATEHGGKPKPFQI  599

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L PTFS  CP R+++
Sbjct  600  LQDVMAGKLRPTFSKDCPPRIQK  622

>PHYCA_543949
Length=195

 Score = 122 bits (307),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEIL+G RYTEQADIYSFGV+LSELDT K P+ DV+  + KKP+P QI
Sbjct  83   MTAGVGTPYWTAPEILQGGRYTEQADIYSFGVILSELDTGKFPYHDVLRPDRKKPRPFQI  142

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            +  V+ G+L P+FS+ CP R+ R
Sbjct  143  MEEVMAGKLRPSFSEDCPPRIRR  165

>PHYSO_520885
Length=623

 Score = 130 bits (326),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDTCK+PF D +   GKK KP +I
Sbjct  515  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTCKIPFHDCMDTNGKKAKPFRI  574

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS+ CP R+ R
Sbjct  575  LQEVMSGVLRPSFSEDCPPRIRR  597

>PHYCA_107158
Length=188

 Score = 121 bits (304),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGTPYW APEILEG RYTEQADIYSFGVVLSELDT K P+ D +T EGK  KPV+I
Sbjct  81   MTTGVGTPYWSAPEILEGNRYTEQADIYSFGVVLSELDTGKNPYHDALTPEGKNEKPVKI  140

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L PTFS  CP  + R
Sbjct  141  LAEVIAGNLRPTFSAHCPDNIRR  163

>PPTG_16184
Length=656

 Score = 128 bits (322),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDT K+P+ D +T  G K KPVQI
Sbjct  537  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGKIPYHDALTESGGKVKPVQI  596

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L PTFS  CP R++R
Sbjct  597  LQDVVSGMLRPTFSKDCPPRIQR  619

>PHYRA_84557
Length=643

 Score = 128 bits (321),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTP+W APEILEGKRY+EQADIYSFGVVLSELDTCK+PF D ++++GKK KP  I
Sbjct  535  MTAGVGTPFWTAPEILEGKRYSEQADIYSFGVVLSELDTCKIPFHDCISSKGKKAKPFHI  594

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS  CP R+ R
Sbjct  595  LKEVMAGTLRPSFSADCPPRIRR  617

>PHYSO_520072
Length=661

 Score = 127 bits (319),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEI EGKRYTEQADIYSFGVVL+ELDTCK+P+S+  T  G  PKP QI
Sbjct  550  MTAGVGTPYWTAPEIHEGKRYTEQADIYSFGVVLTELDTCKIPYSNAATEGGGMPKPFQI  609

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L P+FS  CP R++R
Sbjct  610  LQDVMAGKLRPSFSQDCPPRIQR  632

>PITG_17586
Length=686

 Score = 126 bits (317),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDT K+P+ D +T  G + KPVQI
Sbjct  567  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGKIPYHDALTGAGGRVKPVQI  626

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L PTFS  CP R+ R
Sbjct  627  LQDVVSGALRPTFSSDCPPRILR  649

>PHYRA_84554
Length=686

 Score = 126 bits (316),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGV+LSELDT K P+ D + ++G KPKP QI
Sbjct  578  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVILSELDTGKRPYHDALRSDGTKPKPFQI  637

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +  V+ G L P+ SD CP R+ R   +  +   R +P+
Sbjct  638  MERVMAGVLRPSLSDDCPPRIRRISTACCQQDSRQRPT  675

>PHYSO_518441
Length=663

 Score = 125 bits (315),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDT ++P+ D VT  G K KP Q+
Sbjct  547  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGRIPYHDAVTEGGGKAKPFQV  606

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G+L P+FS  CP R++R
Sbjct  607  LQDVMAGKLRPSFSRDCPPRIQR  629

>PHYRA_84559
Length=2650

 Score = 125 bits (315),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (82%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW+APE+LEG RYTE+ DIYSFGVVLSELDT K+P+ D VTA+G K KP Q+
Sbjct  447  MTAGVGTPYWVAPEVLEGNRYTEKGDIYSFGVVLSELDTGKIPYFDAVTADGTKMKPFQV  506

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L+ V+ G L P+ SD+CP R+ R
Sbjct  507  LNEVMSGSLRPSLSDECPPRIRR  529

 Score = 124 bits (312),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (76%), Gaps = 4/98 (4%)

Query  1     MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
             MT G+GTPYWIAPE+LEG+ YTEQADIYSFGVVLSELDT K+P+ D VT +G K KP +I
Sbjct  1120  MTGGIGTPYWIAPEVLEGEHYTEQADIYSFGVVLSELDTGKIPYHDAVTEDGTKLKPFRI  1179

Query  61    LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
             L+ V+ G L P+F+  CP+R++R    +  +C  L PS
Sbjct  1180  LNEVMSGTLRPSFAGDCPARIQR----ISTACLSLDPS  1213

 Score = 120 bits (300),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 0/83 (0%)

Query  1     MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
             MTAG+GTPYW APE+LEG RYTEQADIYSFGVVLSELDT ++P+ D VT  G K KPVQI
Sbjct  2532  MTAGIGTPYWTAPEVLEGSRYTEQADIYSFGVVLSELDTGRIPYFDAVTEGGSKLKPVQI  2591

Query  61    LHWVLDGRLSPTFSDKCPSRLER  83
             L  V+ G L P+FS  C  R+ R
Sbjct  2592  LQDVVSGTLQPSFSADCAPRIRR  2614

 Score = 117 bits (293),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1     MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
             MTAGVGTPYW APEILEGKRYT QADIYSFGVVLSELDT ++P+ D  T  G K K  QI
Sbjct  1835  MTAGVGTPYWTAPEILEGKRYTVQADIYSFGVVLSELDTGRIPYYDAATEGGGKAKSFQI  1894

Query  61    LHWVLDGRLSPTFSDKCPSRLER  83
             L  V+ G L P+FS  CP R++R
Sbjct  1895  LQDVMAGMLRPSFSRDCPPRIQR  1917

>PHYRA_84555
Length=663

 Score = 125 bits (313),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQ+DIYSFGVVL+ELDT K+P+ D +T +GKKPKP  I
Sbjct  554  MTAGVGTPYWTAPEILEGKRYTEQSDIYSFGVVLTELDTGKIPYHDALTPDGKKPKPFHI  613

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P FSD CP  + R
Sbjct  614  LADVMAGVLRPNFSDDCPRAVRR  636

>PHYCA_107224
Length=650

 Score = 123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYT+QADIYSFG+VLSELDT K+P+ D +T  G K KPVQI
Sbjct  532  MTAGVGTPYWTAPEILEGKRYTQQADIYSFGIVLSELDTGKIPYHDALTENGGKTKPVQI  591

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P FS  CP R+ R
Sbjct  592  LQDVVSGTLRPKFSTDCPPRILR  614

>PHYCA_563934
Length=645

 Score = 123 bits (308),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 64/83 (77%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GTPYW APE+LEGKRY+EQADIYSFGVVLSELDT K P+ D VT  G  PKP  I
Sbjct  538  MTGGIGTPYWTAPEVLEGKRYSEQADIYSFGVVLSELDTGKAPYCDAVTEHGGMPKPFYI  597

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ GRL PTFS  CP R++R
Sbjct  598  LQDVMAGRLRPTFSQDCPLRIKR  620

>PHYSO_253195
Length=677

 Score = 123 bits (308),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDT ++P+ D +T  G K KPVQI
Sbjct  560  MTAGVGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGRIPYHDALTEGGGKAKPVQI  619

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L PTF+  CP R+ R
Sbjct  620  LQDVVCGTLRPTFTKDCPPRILR  642

>PPTG_16187
Length=640

 Score = 122 bits (307),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTP+W APEILEG  YTE+ADIYS GVVLSELDTC++P+ D V+ +G K KP QI
Sbjct  521  MTAGVGTPFWTAPEILEGNHYTEKADIYSLGVVLSELDTCEVPYHDAVSEDGTKLKPFQI  580

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G + P+FS +CP+R+ R    +  +C  L+PS
Sbjct  581  LKEVMSGTMRPSFSQECPARIRR----ITSACLSLEPS  614

>PHYSO_337952
Length=619

 Score = 122 bits (307),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILE KRY E+AD+YSFGVVLSELDTC++PFSD +T +G K KP QI
Sbjct  508  MTAGVGTPYWTAPEILESKRYDEKADVYSFGVVLSELDTCEIPFSDALTEDGSKAKPFQI  567

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G L P FS  CP  + +    +  SC +L P+
Sbjct  568  LQNVMKGTLQPRFSTDCPPVIRQ----IALSCLKLDPA  601

>PITG_00005
Length=493

 Score = 122 bits (305),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTP+W APEILEG  YTE+AD+YSFGVVLSELDT ++P+ D VT +G K KPVQI
Sbjct  373  MTAGVGTPFWTAPEILEGNHYTEKADMYSFGVVLSELDTGQVPYHDAVTEDGTKLKPVQI  432

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G + P+FSD+CP R+ R    +  +C  L PS
Sbjct  433  LKEVMSGTMRPSFSDECPPRIRR----IGTACLSLDPS  466

>PPTG_16186
Length=608

 Score = 122 bits (306),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 70/98 (71%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GTP+W APE+LEG RYTEQADIYSFGVVLSELD CK P++D VT  G K +  QI
Sbjct  499  MTAGIGTPFWTAPEVLEGDRYTEQADIYSFGVVLSELDMCKTPYTDAVTEGGSKARHFQI  558

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G L P FS+ CPSR+ R    +  +C  L PS
Sbjct  559  LQEVMAGELRPNFSEDCPSRVLR----VAMACLSLDPS  592

>PPTG_16185
Length=632

 Score = 122 bits (305),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GTPYW APEILEGKRYTEQADIYSFGVVLSELDT K P+ D  T  G K KP QI
Sbjct  516  MTAGIGTPYWTAPEILEGKRYTEQADIYSFGVVLSELDTGKTPYHDARTQGGSKAKPFQI  575

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  ++DG L P+F+ +CP R+ R
Sbjct  576  LQDIVDGCLQPSFTRQCPPRIYR  598

>PPTG_16190
Length=641

 Score = 122 bits (305),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTP+W APEILEGKRY+EQADIYSFGVVLSELDT K+PF D   ++GKK KP  I
Sbjct  533  MTAGVGTPFWTAPEILEGKRYSEQADIYSFGVVLSELDTGKIPFYDCAGSDGKKTKPFHI  592

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS  CP R+ R
Sbjct  593  LQEVMAGTLRPSFSPDCPPRIRR  615

>PHYSO_337957
Length=656

 Score = 120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEG++YTEQADIYSFGVV+SELDT  +P+ D +T++GKK +P+QI
Sbjct  540  MTAGVGTPYWSAPEILEGRKYTEQADIYSFGVVMSELDTGMIPYQDTLTSDGKKLEPIQI  599

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            L  V+ GRL PT S  CP ++
Sbjct  600  LAEVVAGRLRPTLSKDCPQQI  620

>PHYSO_325252
Length=656

 Score = 120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEG++YTEQADIYSFGVV+SELDT  +P+ D +T++GKK +P+QI
Sbjct  540  MTAGVGTPYWSAPEILEGRKYTEQADIYSFGVVMSELDTGMIPYQDTLTSDGKKLEPIQI  599

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            L  V+ GRL PT S  CP ++
Sbjct  600  LAEVVAGRLRPTLSKDCPQQI  620

>PHYCA_107484
Length=343

 Score = 117 bits (292),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEG RYTE+ADIYSFGVVLSELDT ++P+ D +  +G K  P QI
Sbjct  230  MTAGVGTPYWTAPEVLEGNRYTEKADIYSFGVVLSELDTGRIPYFDALEDDGTKLMPFQI  289

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+F++ CP R++R
Sbjct  290  LQEVMSGTLRPSFTEDCPLRIQR  312

>PPTG_01910
Length=114

 Score = 110 bits (274),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MTAGVGTPYW APE +EG RYT++ADIYSFGVVLSELDT ++P  D V  +G +  P QI
Sbjct  1   MTAGVGTPYWTAPENMEGDRYTDKADIYSFGVVLSELDTGRIPHFDAVEDDGTRLMPFQI  60

Query  61  LHWVLDGRLSPTFSDKCPSRLER  83
           L  V+ G L P+FS  CP+R++R
Sbjct  61  LQEVMTGTLRPSFSVDCPTRIQR  83

>HYAP_14439
Length=414

 Score = 117 bits (292),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDT ++P+ + VT  G +    QI
Sbjct  298  MTAGVGTPYWAAPEILEGKRYTEQADIYSFGVVLSELDTGEIPYHNAVTESGGQATSFQI  357

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS  CP R+ R
Sbjct  358  LQDVMAGSLRPSFSRDCPPRIRR  380

>PPTG_16192
Length=637

 Score = 117 bits (293),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGK+YTE ADIYSFGVVLSELDT K+P+ D +T EGK  KP +I
Sbjct  527  MTAGVGTPYWSAPEILEGKQYTELADIYSFGVVLSELDTAKLPYHDALTPEGKSQKPFKI  586

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L PTFS +C  ++ R
Sbjct  587  LAEVITGVLRPTFSKECSPQIRR  609

>PITG_17578
Length=481

 Score = 116 bits (291),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYS GVVL+E+DT K+P+ D +T EG  PKP  I
Sbjct  369  MTAGVGTPYWTAPEILEGKRYTEQADIYSLGVVLTEIDTGKLPYHDALTPEGTIPKPFMI  428

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+F+++CP ++ +
Sbjct  429  LADVIAGILRPSFAEECPPKIRQ  451

>PHYSO_337966
Length=668

 Score = 117 bits (292),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 70/97 (72%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GTPYW APE+LEGKRY+++ADIYSFGVVLSELDT K P++D VT  G  PKP  +
Sbjct  551  MTGGIGTPYWTAPEVLEGKRYSQRADIYSFGVVLSELDTGKAPYADAVTENGGMPKPFYV  610

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            L  V+ GRL P+FS  CP  ++R    +  +C  L+P
Sbjct  611  LQDVMAGRLRPSFSKNCPVWIKR----LGLACLALEP  643

>PHYSO_520017
Length=661

 Score = 116 bits (291),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGTPYW APEILEG RYTE++DIYSFGVVLSELDT ++P+SD V  +G K +P  I
Sbjct  552  MTSGVGTPYWTAPEILEGDRYTEKSDIYSFGVVLSELDTGRIPYSDAVMEDGSKVRPFHI  611

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G + P FS  CP R++R
Sbjct  612  LQEVMAGAMRPNFSRDCPPRIQR  634

>HYAP_14440
Length=647

 Score = 116 bits (291),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQADIYSFGVVLSELDT ++P+ + VT  G +    QI
Sbjct  531  MTAGVGTPYWAAPEILEGKRYTEQADIYSFGVVLSELDTGEIPYHNAVTESGGQATSFQI  590

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+FS  CP R+ R
Sbjct  591  LQDVMAGSLRPSFSRDCPPRIRR  613

>PPTG_16188
Length=657

 Score = 116 bits (291),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 70/98 (71%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEG RYTE+ADIYSFGVVLSELDT ++P+ D V  +G +  P QI
Sbjct  544  MTAGVGTPYWTAPEILEGDRYTEKADIYSFGVVLSELDTGRIPYFDAVEDDGTRLMPFQI  603

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G L P+FS  CP R++R    +  +C   +PS
Sbjct  604  LQEVMTGTLRPSFSADCPPRIQR----IGAACLSFEPS  637

>PPTG_16199
Length=666

 Score = 115 bits (289),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  +GTPYW APE+LEGKRYTE+ADIYSFGV+LSELDT K P+SD VT  G  PKP  +
Sbjct  552  MTGEIGTPYWTAPEVLEGKRYTERADIYSFGVMLSELDTGKAPYSDAVTENGGMPKPFYV  611

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ GRL P+F   CP R++R
Sbjct  612  LQDVMAGRLRPSFLKDCPLRIKR  634

>PITG_17585
Length=655

 Score = 115 bits (289),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEG RY+E+ADIYSFGVVLSELDT ++P+ D V  +G K  P QI
Sbjct  548  MTAGVGTPYWTAPEVLEGARYSEEADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQI  607

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G L P+FS  CP R++R    +  +C    PS
Sbjct  608  LQEVMAGTLRPSFSVDCPPRIQR----IAAACLSFDPS  641

>PITG_17583
Length=550

 Score = 115 bits (288),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 58/71 (82%), Gaps = 0/71 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT +W APEILEGKRY+EQADIYSFGVVLSELDTCK+PF D   ++GKKPKP  I
Sbjct  456  MTAGVGTLFWTAPEILEGKRYSEQADIYSFGVVLSELDTCKIPFHDCAGSDGKKPKPFHI  515

Query  61   LHWVLDGRLSP  71
            L  V+ G L P
Sbjct  516  LQEVMAGTLRP  526

>PITG_00004
Length=614

 Score = 115 bits (288),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APE+LEG RY+E+ADIYSFGVVLSELDT ++P+ D V  +G K  P QI
Sbjct  507  MTAGVGTPYWTAPEVLEGARYSEKADIYSFGVVLSELDTGRIPYFDTVDHDGAKLMPFQI  566

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G L P+FS  CP R++R    +  +C    PS
Sbjct  567  LQEVMAGTLRPSFSVDCPPRIQR----IAAACLSFDPS  600

>PHYSO_520398
Length=679

 Score = 115 bits (287),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+AGVGTP+W APE+LE   YTE+ADIYSFGV+L+ELDTC+ PF  VV A G+K KP  I
Sbjct  572  MSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLTELDTCEAPFHSVVGANGEKMKPFLI  631

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+DG L P+ +D CP R+ +   +  +   +L+PS
Sbjct  632  LKQVVDGLLRPSLTDGCPQRIRKAADACFQHDPKLRPS  669

>PHYKE_6708
Length=311

 Score = 111 bits (277),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+AGVGTP+W APE+LE   YTE+ADIYSFGV+LSELDTC+ P+ D++   G K KP  I
Sbjct  204  MSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLSELDTCEAPYHDMLGQNGMKMKPFHI  263

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+D  L+P+F+  CP R+ R   +  +   +L+PS
Sbjct  264  LKQVVDDLLTPSFTAGCPKRIRRVANACFQRDPKLRPS  301

>PHYCA_107239
Length=649

 Score = 113 bits (282),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+AGVGTP+W APE+LE   YTE+ADIYSFGV+L+ELDTC+ P+ + + A G+K KP  I
Sbjct  542  MSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLTELDTCEAPYHNTLGANGEKMKPFHI  601

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+DG L P+ + +CP R+ R   +  +   +L+PS
Sbjct  602  LKEVVDGTLRPSLTPECPQRIRRAAVACFQHDPKLRPS  639

>PHYRA_84553
Length=664

 Score = 113 bits (282),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 68/98 (69%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GTPYW APEIL GKRYTEQADIYSFGVVLSELDT K P+SD +T  G  PKP  I
Sbjct  552  MTGGIGTPYWTAPEILIGKRYTEQADIYSFGVVLSELDTGKSPYSDTLTECGGMPKPFYI  611

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+ G+L P+FS  CP     +V  +  SC  + P+
Sbjct  612  LQDVMAGKLRPSFSPTCP----LHVLQLGLSCLAIDPA  645

>PPTG_02066
Length=305

 Score = 108 bits (270),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  192  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  251

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+FSD CP     ++  + R+C    P+
Sbjct  252  LQLVSAGKLQPSFSDSCPP----SIVKLARACLSFDPA  285

>PPTG_16191
Length=877

 Score = 111 bits (278),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTP+W APE+LE   YTE+ADIYSFGV+L+ELDTC+ P+ + + A G+K KP  I
Sbjct  770  MTAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLTELDTCEAPYHNTLGANGEKMKPFHI  829

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+DG L P+ S  CP R+ +   +  +    L+PS
Sbjct  830  LKEVVDGTLRPSLSCNCPQRISKAADACFQHDPNLRPS  867

>PITG_17582
Length=707

 Score = 111 bits (277),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+AGVGTP+W APE+LE   YTE+ADIYSFGV+L+ELDTC+ P+ D + A G+K KP  +
Sbjct  600  MSAGVGTPFWTAPEVLESSEYTEKADIYSFGVLLTELDTCEAPYHDTLGANGEKKKPFHV  659

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+DG L P+ S  CP R+ R   +  +    L+PS
Sbjct  660  LKDVVDGTLRPSLSTGCPQRICRAADACFQHDPTLRPS  697

>PHALS_05409
Length=698

 Score = 110 bits (276),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE AD+YSFGVVLSELDTCK PF D     G K + V I
Sbjct  585  MTAGVGTARWIAPEVILGGHYTEFADVYSFGVVLSELDTCKAPFHDATNTNGGKMQDVTI  644

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+FSD CP     ++  + R+C    P+
Sbjct  645  LQLVSAGKLQPSFSDSCP----HSIVKLARACLSFDPA  678

>PITG_05112
Length=699

 Score = 110 bits (275),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  586  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  645

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+FSD CP     ++  + R+C    P+
Sbjct  646  LQLVSAGKLQPSFSDSCPP----SIVKLARACLSFDPA  679

>HYAP_05661
Length=698

 Score = 110 bits (274),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/98 (54%), Positives = 64/98 (65%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  585  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  644

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+F++ CPS + R    + R+C    P+
Sbjct  645  LQLVSAGKLQPSFNESCPSSIVR----LARACLSFDPA  678

>PHYSO_337956
Length=563

 Score = 109 bits (273),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTEQAD+YSFGVVLSELDT   P+S      G +   +QI
Sbjct  448  MTAGVGTPYWTAPEILEGKRYTEQADVYSFGVVLSELDTGIAPYSADEREGGGRLNHLQI  507

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L PTFS +CP R++R
Sbjct  508  LKGVVAGTLRPTFSSECPLRIQR  530

>PHYCA_504276
Length=696

 Score = 108 bits (271),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  583  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  642

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+F+D CP     ++  + R+C    P+
Sbjct  643  LQLVSAGKLQPSFTDSCPP----SIVKLARACLSFDPA  676

>PPTG_19959
Length=112

 Score = 100 bits (250),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MT+GVGT YWIAPE+L G +Y+E+ADIYS GVVL+ELDT ++PF D  T++G K + + I
Sbjct  1   MTSGVGTAYWIAPEVLAGHKYSEKADIYSLGVVLAELDTGELPFFDARTSDGDKMEAIHI  60

Query  61  LHWVLDGRLSPTFSDKCPSRLER  83
           L  V+ G L P+F+  CP  + +
Sbjct  61  LSLVVSGELQPSFTLDCPEDVRK  83

>PYU1_G014939
Length=663

 Score = 108 bits (270),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  550  MTAGVGTARWIAPEVVLGGHYTEAADIYSFGVVLSELDTCKAPFHDATNTNGAKMQDVTI  609

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+F+D CP      +  + R+C    P+
Sbjct  610  LQLVSAGKLQPSFTDLCPPA----ILKLARACLEFDPA  643

>PHYSO_289074
Length=532

 Score = 107 bits (267),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  419  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  478

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+F + CP     ++  + R+C    P+
Sbjct  479  LQLVSAGKLQPSFEESCPP----SIVKLARACLSFDPA  512

>PHALS_09301
Length=114

 Score = 99.4 bits (246),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 61/82 (74%), Gaps = 0/82 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DT ++P+SD     GKK + ++I
Sbjct  1   MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTSEVPYSDKRDNSGKKLQSMKI  60

Query  61  LHWVLDGRLSPTFSDKCPSRLE  82
           +  V+   L PTF   CP +++
Sbjct  61  IQMVIRMALRPTFGKNCPVQIK  82

>HYAP_14441
Length=832

 Score = 107 bits (266),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+AGVGTP+W APE+LE   YTE+ADIYSFGV+LSELDT K P+ +++ A G+K KP  I
Sbjct  725  MSAGVGTPFWTAPEVLESTEYTEKADIYSFGVLLSELDTGKAPYHNMLRANGEKAKPFLI  784

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+DG L P+    CP R+ +   +  +   +L+PS
Sbjct  785  LKKVVDGSLRPSLVMGCPQRIRKAAEACFQHDPKLRPS  822

>PHYKE_2247
Length=526

 Score = 106 bits (265),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  413  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  472

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+F++ CP     ++  + R+C    P+
Sbjct  473  LQLVSAGKLQPSFNESCPP----SIVKLARACLSFDPA  506

>PYAR_13094
Length=478

 Score = 105 bits (261),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 64/98 (65%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APE+LEGKRY E+ADI+S+G+VLSE+DTC +P+         K K +QI
Sbjct  355  MTNGVGTILWSAPEVLEGKRYDEKADIFSYGIVLSEIDTCALPYGFNKDKTRNKMKSMQI  414

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H V +G+L PTF D CP  L      + RSC  L PS
Sbjct  415  VHLVAEGKLLPTFRDDCPEEL----VELARSCLDLDPS  448

>PITG_07968
Length=526

 Score = 104 bits (260),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 64/82 (78%), Gaps = 0/82 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DTC++PFSD   + GKK + ++I
Sbjct  413  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTCEVPFSDKRDSSGKKLQSMKI  472

Query  61   LHWVLDGRLSPTFSDKCPSRLE  82
            +  V+   L P+F + CP +++
Sbjct  473  IQMVIRSALRPSFREDCPEQIK  494

>PHYSO_253201
Length=540

 Score = 104 bits (260),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILE KRYTEQ DIYSFGVVLSELDT K+P+ D +T +GKKPKP  I
Sbjct  475  MTAGVGTPYWSAPEILEEKRYTEQTDIYSFGVVLSELDTGKLPYHDALTPDGKKPKPFHI  534

Query  61   LHWVL  65
            L  V+
Sbjct  535  LSDVI  539

>PHYRA_84556
Length=817

 Score = 104 bits (260),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+AGVGTP+W APE+LE   Y+E+ADIYSFGV+LSELDTC+ P+   +   G+K KP  +
Sbjct  710  MSAGVGTPFWTAPEVLESTEYSEKADIYSFGVLLSELDTCEAPYHSTLGPNGEKMKPFHV  769

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V+DG L P  +  CP R+ +   +  +    L+PS
Sbjct  770  LKLVMDGSLRPGLTAGCPQRIRQAADACFQRDPTLRPS  807

>PHYSO_337959
Length=642

 Score = 104 bits (260),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILE KRYTEQ DIYSFGVVLSELDT K+P+ D +T +GKKPKP  I
Sbjct  577  MTAGVGTPYWSAPEILEEKRYTEQTDIYSFGVVLSELDTGKLPYHDALTPDGKKPKPFHI  636

Query  61   LHWVL  65
            L  V+
Sbjct  637  LSDVI  641

>CCA19152
Length=720

 Score = 104 bits (259),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE AD+YS GVVL+ELDTCK PF D V   G K + V I
Sbjct  607  MTAGVGTARWIAPEVIFGGHYTELADVYSLGVVLTELDTCKNPFHDAVNTNGSKMQDVTI  666

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+FS  CP+    ++  +  +C    PS
Sbjct  667  LQLVSSGQLKPSFSASCPA----SIVKLAEACLAFHPS  700

>PHALS_00921
Length=631

 Score = 103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 68/97 (70%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+EGK+Y+E+AD+YS GVVLSE+DTC+ PFSDV++ +G +   +Q+
Sbjct  493  MTSGVGTLLWTAPEIIEGKKYSEKADVYSLGVVLSEMDTCESPFSDVISEKGGRLPGMQL  552

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
             H+V  G +  +  D CP+ L +    +I  C +L P
Sbjct  553  AHFVRLGNIRVSLRDDCPTILRK----LIMDCTQLDP  585

>HYAP_03658
Length=522

 Score = 102 bits (255),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 64/82 (78%), Gaps = 0/82 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DTC++P+SD   ++GKK + ++I
Sbjct  408  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTCEVPYSDKRDSDGKKLQSMKI  467

Query  61   LHWVLDGRLSPTFSDKCPSRLE  82
            +  V+   L PTF   CP +++
Sbjct  468  IQLVIRQALRPTFLGTCPEQIK  489

>PHYCA_511287
Length=515

 Score = 102 bits (255),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 63/82 (77%), Gaps = 0/82 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DTC++P+SD     GKK + ++I
Sbjct  402  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTCEVPYSDKRDNAGKKLQGMKI  461

Query  61   LHWVLDGRLSPTFSDKCPSRLE  82
            +  V+   L P+F D CP +++
Sbjct  462  IQMVIRMALRPSFRDDCPEQVK  483

>PHYRA_82847
Length=696

 Score = 102 bits (255),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE ADIYSFGVVLSELDTCK PF D     G K + V I
Sbjct  583  MTAGVGTARWIAPEVILGGHYTEFADIYSFGVVLSELDTCKAPFYDATNTNGGKMQDVTI  642

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+F +  P     ++  + R+C    P+
Sbjct  643  LQLVSAGKLQPSFDESSPP----SIVKLARACLSFDPA  676

>PHYKE_3
Length=598

 Score = 102 bits (253),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKK  54
            MTAGVGTPYW APE+LEGKRYTEQADIYSFGVVLSELDTCK+P++D VT +G +
Sbjct  545  MTAGVGTPYWTAPEVLEGKRYTEQADIYSFGVVLSELDTCKIPYADAVTEDGSR  598

>CCA19358
Length=682

 Score = 102 bits (253),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 67/98 (68%), Gaps = 2/98 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GTPYW APE L+G  Y+E +D+YSFGV LSE+DTC+ P+ D+      +  PVQI
Sbjct  577  MTAGIGTPYWTAPENLQGSEYSESSDMYSFGVFLSEVDTCRTPYVDL--KSDMELGPVQI  634

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            LH V++G L P+FS   PS+LE+     +    +L+P+
Sbjct  635  LHRVMNGTLQPSFSCHIPSQLEKIAKLCLHRDAKLRPA  672

>CCI41041
Length=413

 Score = 100 bits (250),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YWIAPE+L G++YTE+ADIYSFGVV+SELDT  +P+SD     G++  PV+I
Sbjct  300  MTAGVGTVYWIAPEVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRRVTPVKI  359

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
               V    L PTFS  CP ++
Sbjct  360  ARAVAQLGLRPTFSRACPQKV  380

>PPTG_02132
Length=665

 Score = 101 bits (252),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 61/83 (73%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT YWIAPE+L G +Y+E+ADIYS GVVL+ELDT ++PF D  T++G K + + I
Sbjct  554  MTSGVGTAYWIAPEVLAGHKYSEKADIYSLGVVLAELDTGELPFFDARTSDGDKMEAIHI  613

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+F+  CP  + +
Sbjct  614  LSLVVSGELQPSFTLDCPEDVRK  636

>PPTG_08474
Length=531

 Score = 101 bits (251),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 63/82 (77%), Gaps = 0/82 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DTC++P+SD     GKK + ++I
Sbjct  418  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTCEVPYSDKRDNSGKKLQGMKI  477

Query  61   LHWVLDGRLSPTFSDKCPSRLE  82
            +  V+   L P+F + CP +++
Sbjct  478  IQMVIRMALRPSFREDCPEQIK  499

>CCA21936
Length=435

 Score = 100 bits (249),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YWIAPE+L G++YTE+ADIYSFGVV+SELDT  +P+SD     G+K  PV+I
Sbjct  323  MTAGVGTVYWIAPEVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRKVTPVKI  382

Query  61   LHWVLDGRLSPTFSDKCP  78
               V    L PTFS  CP
Sbjct  383  ARAVAQLGLRPTFSRTCP  400

>CCA24786
Length=435

 Score = 100 bits (249),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 57/78 (73%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YWIAPE+L G++YTE+ADIYSFGVV+SELDT  +P+SD     G+K  PV+I
Sbjct  323  MTAGVGTVYWIAPEVLLGRKYTEKADIYSFGVVMSELDTHHLPYSDHKDGAGRKVTPVKI  382

Query  61   LHWVLDGRLSPTFSDKCP  78
               V    L PTFS  CP
Sbjct  383  ARAVAQLGLRPTFSRTCP  400

>PPTG_08473
Length=473

 Score = 100 bits (249),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SELDT  +P+SD   A GKK + ++I
Sbjct  361  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDASGKKLQGMKI  420

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+   L PTFS  CP
Sbjct  421  VQMVIRRNLRPTFSSDCP  438

>PITG_07967
Length=474

 Score = 100 bits (248),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SELDT  +P+SD   A GKK + ++I
Sbjct  362  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDASGKKLQGMKI  421

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+   L PTFS  CP
Sbjct  422  VQMVIRRNLRPTFSSDCP  439

>PHYKE_1813
Length=469

 Score = 99.8 bits (247),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SELDT  +P+SD     GKK + ++I
Sbjct  357  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKI  416

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+  +L PTFS +CP
Sbjct  417  VQMVIRRQLRPTFSSECP  434

>PHYCA_107365
Length=269

 Score = 97.1 bits (240),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 0/82 (0%)

Query  2    TAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQIL  61
            T+G    YW APE+LEGK+ T+QADIYSFGV+LSELDT K P+ D +T  G K +P Q+L
Sbjct  161  TSGGEMSYWTAPEVLEGKQMTQQADIYSFGVLLSELDTGKAPYWDTMTKTGIKLQPSQVL  220

Query  62   HWVLDGRLSPTFSDKCPSRLER  83
              V  G+L P  S  CP RL+R
Sbjct  221  QLVKTGKLRPHLSKNCPLRLQR  242

>PHYCA_122066
Length=344

 Score = 97.8 bits (242),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (66%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+EGK+Y+E+ADIYS GVVLSE+DTC  PFSDV + +G++   +QI
Sbjct  201  MTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCDAPFSDVTSDKGERLPGMQI  260

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
               V  G++  T    CP  L +    ++  C +L P
Sbjct  261  AQLVRLGKIRVTLRKDCPPNLHK----LVMDCTQLDP  293

>PHYCA_511282
Length=465

 Score = 99.0 bits (245),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SELDT  +P+SD     GKK + ++I
Sbjct  353  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKI  412

Query  61   LHWVLDGRLSPTFSDKCPS  79
            +  V+   L PTFS  CP+
Sbjct  413  VQMVIRRNLRPTFSSDCPA  431

>PHYKE_9428
Length=503

 Score = 99.0 bits (245),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DTC +PFSD     GKK + +++
Sbjct  390  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTCAVPFSDKRDDAGKKLQGMKV  449

Query  61   LHWVLDGRLSPTFSDKCP  78
            L  V+   L P+F   CP
Sbjct  450  LQMVIRMSLRPSFKPDCP  467

>PHYSO_565433
Length=472

 Score = 98.6 bits (244),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SELDT  +P+SD     GKK + ++I
Sbjct  360  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKI  419

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+   + PTFS+ CP
Sbjct  420  VQMVIRRNMRPTFSEDCP  437

>PHYRA_78868
Length=905

 Score = 98.6 bits (244),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 60/83 (72%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT YW APE+L G +Y+E+AD+YS GVVL+ELDT ++PF D  T++G K + + I
Sbjct  689  MTSGVGTAYWTAPEVLAGHKYSEKADVYSLGVVLTELDTGELPFYDARTSDGDKMEAIHI  748

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V+ G L P+F+  CP  + +
Sbjct  749  LSLVVSGELQPSFTLDCPDDVRK  771

>PHYCA_9190
Length=325

 Score = 96.3 bits (238),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MTAGVGT  W+APEI  G+ +YTE  D+YSFG++LSELDT ++PF+D  T+ G     + 
Sbjct  212  MTAGVGTTRWLAPEIARGEEKYTEAVDVYSFGIILSELDTHQLPFADAKTSTGAALNDMA  271

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            IL  V  G+L  TFS  CP  LE    ++ RSC  L P+
Sbjct  272  ILQGVSSGKLQVTFSPSCPQNLE----ALARSCMSLDPA  306

>PHYSO_341117
Length=900

 Score = 97.8 bits (242),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+EGK+Y+E+ADIYS GVVLSE+DTC+ PFSDV + +G++   +Q+
Sbjct  618  MTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEQPFSDVTSDKGERLPGMQL  677

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
               V  G++  +  + CP  L +    ++  C +L P
Sbjct  678  AQLVRLGKIRVSLREDCPPNLRK----LVMDCTQLDP  710

>HYAP_14838
Length=323

 Score = 95.9 bits (237),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+ GK+Y+E+ADIYS GV+LSE+DTC+ PFSDV + +G++   +Q+
Sbjct  166  MTSGVGTLLWTAPEIIAGKKYSEKADIYSLGVLLSEMDTCEPPFSDVTSDKGERLPGMQL  225

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
               V  G++  T    CP +L    C ++  C +L P
Sbjct  226  AQLVRLGKIRVTLRKDCPPKL----CKLVMDCTQLDP  258

>PHYRA_81274
Length=518

 Score = 97.1 bits (240),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 59/81 (73%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+D C +P+SD     GK  + ++I
Sbjct  405  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDMCAVPYSDKRDNSGKPLQGMKI  464

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V+   L P+F + CP ++
Sbjct  465  IQMVIRSALRPSFQEDCPEQI  485

>PHYSO_529022
Length=517

 Score = 96.7 bits (239),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 0/82 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADIYSFG+V+SE+DTC +P+SD     GK  + ++I
Sbjct  403  MTAGVGTIYWTAPEVLMGKKYTEKADIYSFGIVMSEMDTCAVPYSDKRDDSGKVLQGMKI  462

Query  61   LHWVLDGRLSPTFSDKCPSRLE  82
            +  V+   L P+F   CP +++
Sbjct  463  IQMVIRMALRPSFRKDCPEQVK  484

>PHALS_03626
Length=495

 Score = 96.7 bits (239),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SEL+T  +P+SD     GKK + ++I
Sbjct  383  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELETHAVPYSDKRDNAGKKLQGMKI  442

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+   L PTFS +CP
Sbjct  443  VQMVIRRNLRPTFSTECP  460

>PHYRA_81273
Length=445

 Score = 96.3 bits (238),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT YW APE+L GK+YTE+ADI+SFG+V+SELDT  +P+SD     GKK + ++I
Sbjct  333  MTAGVGTIYWTAPEVLMGKKYTEKADIFSFGIVMSELDTHAVPYSDKRDNSGKKLQGMKI  392

Query  61   LHWVLDGRLSPTFSDKCPS  79
            +  V+   L PTF+  CP+
Sbjct  393  VQMVIRRSLRPTFTSDCPA  411

>PPTG_16203
Length=403

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)

Query  6    GTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHWVL  65
            G PYW APE+L G+ YT ++DIY+FGV+L+ELDT   PF D V+  G K KP+QIL+ V+
Sbjct  301  GAPYWSAPEVLRGRPYTTKSDIYAFGVLLTELDTVNSPFHDAVSPIGTKLKPIQILNEVM  360

Query  66   DGRLSPTFSDKCPSRL  81
             G L P+FS +CP R+
Sbjct  361  QGTLRPSFSPECPRRI  376

>PITG_11236
Length=727

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)

Query  4    GVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHW  63
            GVGT YW APE+L G RY+E+ADIYS GVVL+ELDT ++PF D  T++G K + + IL  
Sbjct  619  GVGTAYWTAPEVLAGHRYSEKADIYSLGVVLAELDTGELPFYDARTSDGHKMETIHILSL  678

Query  64   VLDGRLSPTFSDKCPSRLER  83
            V+ G L P+F+  CP  + +
Sbjct  679  VVSGELHPSFTLDCPEDVRK  698

>PITG_14156
Length=747

 Score = 96.3 bits (238),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+EGK+Y+E+ADIYS GVVLSE+DTC+ PFSDV + +G++   +Q+
Sbjct  603  MTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEAPFSDVTSDKGERLPGMQL  662

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
               V  G++  +    CP  L RN   ++  C +L P
Sbjct  663  AQLVRLGKIRVSLRKDCPPNL-RN---LVLDCTQLDP  695

>CCI41501
Length=680

 Score = 95.9 bits (237),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 2/81 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GTPYW APE L G  Y+E++D+YSFGV LSE+DTC+MP+ D       +  PVQI
Sbjct  574  MTAGIGTPYWTAPENLHGLEYSEKSDMYSFGVFLSEVDTCEMPYVD--HKSELELGPVQI  631

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            L+ V++G L PTFS   P R+
Sbjct  632  LNRVMNGTLQPTFSAHIPRRI  652

>PHYRA_83716
Length=960

 Score = 95.9 bits (237),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+EGK+Y+E+ADIYS GVVLSE+DTC+ PFSDV + +G++   +Q+
Sbjct  620  MTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEPPFSDVTSDKGERLPGMQL  679

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
               V  G++  +    CP  L +    ++  C +L P
Sbjct  680  AQLVRLGKIRVSLRQDCPPNLRK----LVMDCTQLDP  712

>PPTG_09853
Length=761

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEI+EGK+Y+E+ADIYS GVVLSE+DTC+ PF+DV + +G++   +Q+
Sbjct  605  MTSGVGTLLWTAPEIIEGKKYSEKADIYSLGVVLSEMDTCEAPFADVTSDKGERLPGMQL  664

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
               V  G++  +    CP  L +    ++  C +L P
Sbjct  665  AQLVRLGKIRVSLRKDCPPNLRK----LVMECTQLDP  697

>SPRG_07851
Length=393

 Score = 94.7 bits (234),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 63/99 (64%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSD-VVTAEGKKPKPVQ  59
            MTAGVGT  W APE+  G+RY ++AD+YSFG+VLSELDT  +PF D  V A G+K  P  
Sbjct  277  MTAGVGTALWAAPEVFLGRRYDDKADVYSFGIVLSELDTGNIPFVDHPVFANGRKVDPTT  336

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +L  V     +PTFS  CP+ +E    ++ + C   +PS
Sbjct  337  VLKLVTMEHATPTFSPSCPAAIE----ALAKRCLSFEPS  371

>SDRG_00886
Length=494

 Score = 94.4 bits (233),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 59/81 (73%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   Y E AD+YSFGV+LSELD+ K+P+SDVVT+ G+      I
Sbjct  380  MTAGIGTYRWMAPEVLQDGHYDESADMYSFGVILSELDSHKLPYSDVVTSTGRPLTDTAI  439

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V+ G+L PTFSD  PS L
Sbjct  440  MAKVMLGQLRPTFSDVSPSWL  460

>PPTG_09207
Length=655

 Score = 94.7 bits (234),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MTAGVGT  W+APEI  G+ +YTE  D+YSFG++LSELDT ++PF D  T+ G     + 
Sbjct  542  MTAGVGTARWLAPEIARGEDKYTEAVDVYSFGIILSELDTHQLPFGDAKTSAGAPLNDMA  601

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            IL  V  G L  T S  CPS LE    ++ RSC  L P+
Sbjct  602  ILQGVSSGTLQVTLSPTCPSNLE----ALARSCMNLDPA  636

>PHYCA_505050
Length=382

 Score = 93.6 bits (231),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 63/98 (64%), Gaps = 7/98 (7%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APEILEGKRY E++D++SFGVVLSE+DTC +P+     +   K + +QI
Sbjct  223  MTNGIGTILWSAPEILEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMRSMQI  279

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H V +G+L P F D CP  +      + + C  L P+
Sbjct  280  VHLVSEGKLLPNFRDDCPPAIR----DLAQRCLNLDPA  313

>PHALS_12946
Length=676

 Score = 94.4 bits (233),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 3/81 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APEILEGKRY E +D++SFGVVLSE+DTC +P+         K + +QI
Sbjct  562  MTNGIGTILWTAPEILEGKRYDETSDLWSFGVVLSEIDTCALPYG---FTRHTKMQSIQI  618

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +H+V  G+L PTF D CP  +
Sbjct  619  VHFVSKGQLLPTFQDDCPKEI  639

>SDRG_03655
Length=364

 Score = 93.2 bits (230),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 63/99 (64%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSD-VVTAEGKKPKPVQ  59
            MTAGVGT  W APE+  G+RY ++AD+YSFG+VLSELDT  +PF D  V A G+K  P  
Sbjct  248  MTAGVGTALWAAPEVFLGRRYDDKADVYSFGIVLSELDTGNIPFVDHPVFANGRKVDPTT  307

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +L  V     +P+FS  CP+ +E    ++ + C   +PS
Sbjct  308  VLKLVTMEHATPSFSPSCPAAIE----ALAKRCLSFEPS  342

>CCA15252
Length=146

 Score = 88.6 bits (218),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 55/98 (56%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M AGVGT   IAPE   G RYT+  D+YS GVVL ELDTCK PF D     G K + V  
Sbjct  40   MKAGVGTALGIAPEFNMGGRYTKLVDVYSLGVVLKELDTCKNPFHDAANTNGSKIQDVTT  99

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L P+ S+ CP+    ++  +  +C    PS
Sbjct  100  LQLVSSGQLKPSISESCPA----SIVKLAEACLTFHPS  133

>PHYSO_518438
Length=241

 Score = 90.9 bits (224),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 0/76 (0%)

Query  7    TPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHWVLD  66
            +P+W APE+L G+ YT +AD+++FGV+L+ELDT   PF D V+  G K KP+Q+L+ V+ 
Sbjct  140  SPFWSAPEVLCGRPYTAKADVFAFGVLLTELDTATAPFHDAVSPAGTKLKPIQVLNEVMQ  199

Query  67   GRLSPTFSDKCPSRLE  82
            G L P+FS  CP R+ 
Sbjct  200  GTLRPSFSAHCPRRIR  215

>SPRG_06057
Length=687

 Score = 94.0 bits (232),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/93 (51%), Positives = 64/93 (69%), Gaps = 6/93 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKK-PKPVQ  59
            MTA +GT  WIAPEIL+G RY+E AD+YSFGV+LSE+DT + P+ + V+  G   PKPV 
Sbjct  571  MTAEIGTIAWIAPEILKGDRYSESADMYSFGVLLSEVDTGESPYGNAVSTNGTALPKPV-  629

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSC  92
            I   V++G L P+F+D+CP      V S+ + C
Sbjct  630  IAMMVIEGELRPSFTDECPPE----VLSIAQRC  658

>PHYSO_522417
Length=1838

 Score = 93.2 bits (230),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 64/98 (65%), Gaps = 7/98 (7%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APE+LEGKRY E++D++SFGVVLSE+DTC +P+     +   K + +QI
Sbjct  612  MTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRNAKMRSMQI  668

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H V +G+L P F D CP  +     ++ + C  L P+
Sbjct  669  VHLVSEGKLLPNFRDDCPPAIR----ALAQRCLSLDPA  702

>PHYRA_40242
Length=90

 Score = 85.9 bits (211),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 42/44 (95%), Gaps = 0/44 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPF  44
           MTAGVGTPYW APEILEGKRYTE+ADIYSFGVVLSELDT K+P+
Sbjct  47  MTAGVGTPYWTAPEILEGKRYTEKADIYSFGVVLSELDTGKIPY  90

>PITG_17575
Length=792

 Score = 92.8 bits (229),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 55/74 (74%), Gaps = 0/74 (0%)

Query  8    PYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHWVLDG  67
            PYW APE+L G+ YT ++D+Y+FGV+L+ELDT   PF D V+  G K KP+QIL+ V+ G
Sbjct  692  PYWSAPEVLRGRPYTAKSDVYAFGVLLTELDTATAPFHDAVSPIGTKLKPIQILNEVMQG  751

Query  68   RLSPTFSDKCPSRL  81
             L P+FS +CP R+
Sbjct  752  TLRPSFSPECPRRI  765

>HYAP_05922
Length=783

 Score = 92.8 bits (229),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 3/78 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APE+LEGKRY E++D++SFGVVLSE+DTC +P+     +   K + +QI
Sbjct  607  MTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMRSMQI  663

Query  61   LHWVLDGRLSPTFSDKCP  78
            +H V +G+L P+F D CP
Sbjct  664  VHLVSEGKLLPSFRDDCP  681

>PHYCA_570506
Length=351

 Score = 91.7 bits (226),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT +WIAPE+L G+ Y E+AD++SFGVVLSELDT   P+     + G K +  +I
Sbjct  242  MTAGMGTSFWIAPEVLRGRDYDEKADVFSFGVVLSELDTDDYPYWSAANSPGSKLQEGEI  301

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            L  V  G+L P FS  CP+ + R
Sbjct  302  LQLVAAGKLRPAFSRSCPASILR  324

>PITG_06480
Length=1856

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 3/78 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APE+LEGKRY E++D++SFGVVLSE+DTC +P+     +   K + +QI
Sbjct  609  MTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMRSMQI  665

Query  61   LHWVLDGRLSPTFSDKCP  78
            +H V +G+L P F D CP
Sbjct  666  VHLVSEGKLLPNFRDDCP  683

>PHYKE_2575
Length=274

 Score = 89.7 bits (221),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 0/65 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT YW APE+L G++Y+E+AD+YS GVVL+ELDT ++PF D  T++G K + + I
Sbjct  94   MTSGVGTAYWTAPEVLAGQKYSEKADVYSLGVVLAELDTGELPFYDARTSDGDKMEVIHI  153

Query  61   LHWVL  65
            LH V+
Sbjct  154  LHLVV  158

>H257_17420
Length=423

 Score = 91.7 bits (226),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 0/79 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W APE+   K+Y ++AD+YS GVVLSELDTC +PF+D    +  K   + +
Sbjct  307  MTAGVGTALWAAPEVFMAKKYNDRADVYSLGVVLSELDTCAIPFADQAIGKNGKLDGMAV  366

Query  61   LHWVLDGRLSPTFSDKCPS  79
            +  V   R  PTFS+ CP+
Sbjct  367  IKLVTQKRAKPTFSESCPA  385

>PYAR_26845
Length=115

 Score = 85.5 bits (210),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 0/81 (0%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MT+GVGT  W APE+L G RYTE+ADIYS+G+VLSELDTC  P+S        K K +Q+
Sbjct  1   MTSGVGTLLWTAPEVLRGDRYTEKADIYSYGIVLSELDTCLPPYSLNEEVAQSKQKSMQL  60

Query  61  LHWVLDGRLSPTFSDKCPSRL  81
           L  +  G++ P F +  P  L
Sbjct  61  LPLIRTGQIKPQFRENVPPAL  81

>PHYRA_77379
Length=773

 Score = 91.7 bits (226),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 64/98 (65%), Gaps = 7/98 (7%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APE+LEGKRY E++D++SFGVVLSE+DTC +P+     +   K + +Q+
Sbjct  603  MTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMRSMQV  659

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H V +G+L P F D CP  +     ++ + C  L P+
Sbjct  660  VHLVSEGKLLPNFRDDCPPAIR----ALAQRCLSLDPA  693

>PPTG_14170
Length=768

 Score = 91.7 bits (226),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 56/78 (72%), Gaps = 3/78 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W APE+LEGKRY E++D++SFGVVLSE+DTC +P+     +   K + +QI
Sbjct  609  MTNGIGTILWSAPEVLEGKRYDEKSDLFSFGVVLSEIDTCALPYG---FSRHAKMRSMQI  665

Query  61   LHWVLDGRLSPTFSDKCP  78
            +H V +G+L P F D CP
Sbjct  666  VHLVSEGKLLPNFRDDCP  683

>SDRG_12761
Length=733

 Score = 91.3 bits (225),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 59/79 (75%), Gaps = 2/79 (3%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKK-PKPVQ  59
            MTA +GT  WIAPEIL+G RY+E AD+YSFGV++SE+DT + P+ + V+  G   PKPV 
Sbjct  617  MTAEIGTIAWIAPEILKGDRYSESADMYSFGVLVSEVDTGESPYGNAVSTNGTALPKPV-  675

Query  60   ILHWVLDGRLSPTFSDKCP  78
            I   V++G L P+F+D+CP
Sbjct  676  IAMMVIEGELRPSFTDECP  694

>SPRG_03078
Length=494

 Score = 91.3 bits (225),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   Y E AD+YSFGV+L ELD+ K+P+SD VT+ G+      I
Sbjct  380  MTAGIGTYRWMAPEVLQDGHYDESADMYSFGVILFELDSHKLPYSDAVTSTGRPLTDTAI  439

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V+ G L PTFSD  PS L
Sbjct  440  MAKVMLGHLRPTFSDASPSWL  460

>H310_09502
Length=420

 Score = 90.5 bits (223),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W APE+   K+Y ++AD+YS GVVLSELDTC +PF+D    +  K   + +
Sbjct  304  MTAGVGTALWAAPEVFMAKKYNDRADVYSLGVVLSELDTCAIPFADQAIGKNGKLDGMAV  363

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V   R  PTFS +CP
Sbjct  364  IKLVTQKRAKPTFSPQCP  381

>PHYSO_516459
Length=516

 Score = 90.9 bits (224),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 1/79 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPF-SDVVTAEGKKPKPVQ  59
            MTAGVGT +WIAPE+L G+ Y E ADIYSFGVVLSE+DT   PF +D   +   K +  +
Sbjct  379  MTAGVGTSFWIAPEVLLGRDYDEAADIYSFGVVLSEIDTDDYPFWNDENKSNRGKIQEAE  438

Query  60   ILHWVLDGRLSPTFSDKCP  78
            IL  V +G+L P+FS  CP
Sbjct  439  ILSLVAEGKLRPSFSSDCP  457

>PHYSO_486489
Length=796

 Score = 90.9 bits (224),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 57/80 (71%), Gaps = 0/80 (0%)

Query  4    GVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHW  63
            GVGT  W APE+L G +Y+E+AD+YS GVVL+ELDT ++PF D  T++G K + + IL  
Sbjct  675  GVGTANWTAPEVLAGYKYSEKADVYSLGVVLTELDTGELPFYDARTSDGDKMEAIHILSL  734

Query  64   VLDGRLSPTFSDKCPSRLER  83
            V+ G+L P+F+  CP  + +
Sbjct  735  VVSGKLQPSFTLDCPEDVRK  754

>H310_00232
Length=690

 Score = 90.9 bits (224),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 61/82 (74%), Gaps = 2/82 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKK-PKPVQ  59
            MTA VGT  WIAPE+L+G++Y+  AD+YSFGV++SE+D    P+S +VT  G + PKPV 
Sbjct  574  MTAEVGTIAWIAPEVLKGQKYSVSADMYSFGVLMSEVDMGISPYSHLVTNGGSQLPKPV-  632

Query  60   ILHWVLDGRLSPTFSDKCPSRL  81
            I   V+DG L PTFS++CP+ +
Sbjct  633  IAMKVMDGELRPTFSNQCPAEV  654

>SPRG_09123
Length=206

 Score = 87.0 bits (214),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 1/83 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVV-TAEGKKPKPVQ  59
            MT+ +GT  WIAPE+L G RYTE+ADIYSFGV+LSELDTC++P+S++   ++  +    +
Sbjct  93   MTSNIGTVAWIAPEVLTGGRYTEKADIYSFGVLLSELDTCEVPYSNMSGKSKDAQFSNAR  152

Query  60   ILHWVLDGRLSPTFSDKCPSRLE  82
            I   V +G L P FSD+ P  + 
Sbjct  153  IAMMVSEGTLRPAFSDRIPEAIH  175

>PHYRA_77380
Length=690

 Score = 90.5 bits (223),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APEIL G+ Y+E+AD+YS+ +VLSELDTC  PF+       +    +Q+
Sbjct  570  MTNGVGTLLWTAPEILRGETYSEKADVYSYAIVLSELDTCLPPFALNSEVSERHLTTMQL  629

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H    G++SP   D CPS L++    +  +C   +PS
Sbjct  630  MHLATSGQVSPQLRDDCPSSLQQ----LTAACASFEPS  663

>PPTG_17293
Length=417

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 59/78 (76%), Gaps = 2/78 (3%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE++ G++Y E+ADI+SFGVVLSELD+  +P+++  T + ++P  + I
Sbjct  306  MTAGIGTSLWMAPEMMTGEKYDEKADIFSFGVVLSELDSNALPYAN--TGKNRQPSDLAI  363

Query  61   LHWVLDGRLSPTFSDKCP  78
            L  V+ G+L  +FS+ CP
Sbjct  364  LQLVMQGKLRVSFSETCP  381

>PHYSO_260691
Length=486

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT +WIAPE+L G+ Y E+AD++SFGVVLSELDT   P+ D       K +  +I
Sbjct  355  MTAGMGTSFWIAPEVLNGQDYDERADVFSFGVVLSELDTDDYPYWDAANQPRSKLQEGEI  414

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            L  V  G+L P+FS  CP+ +
Sbjct  415  LQLVATGQLRPSFSSSCPAAI  435

>CCI43480
Length=704

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 0/69 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  WIAPE++ G  YTE AD+YS GVVL+ELDTCK PF D V   G K + V I
Sbjct  591  MTAGVGTARWIAPEVILGGHYTELADVYSLGVVLTELDTCKNPFHDAVNTNGSKMQDVTI  650

Query  61   LHWVLDGRL  69
            L  V  G+L
Sbjct  651  LQLVSSGQL  659

>PHYRA_72889
Length=365

 Score = 89.4 bits (220),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 0/79 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT +WIAPE+L G+ Y E+AD++SFGVVLSELDT   P+ +     G K +  +I
Sbjct  232  MTAGMGTSFWIAPEVLRGQDYNEKADVFSFGVVLSELDTNDYPYWNATNPPGGKLQEGEI  291

Query  61   LHWVLDGRLSPTFSDKCPS  79
            L  V  G++ P+FS +CP+
Sbjct  292  LLLVAAGQMRPSFSTECPA  310

>SPRG_05981
Length=710

 Score = 90.1 bits (222),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W+APE+++G  Y E  DIYSFG VLSE+DTC +P+ D     G K +   I
Sbjct  589  MTAGVGTCRWMAPEVIQGAHYDEAVDIYSFGCVLSEMDTCNVPYFDATHTNGSKLQDHAI  648

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V+ G L P+F+  CP  +
Sbjct  649  MAGVVQGTLKPSFTKDCPKEI  669

>SPRG_07856
Length=416

 Score = 89.4 bits (220),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W APE+  GK+Y ++ADIYS GVVLSELDTC +PF+D    +  K   + +
Sbjct  298  MTAGVGTALWAAPEVFMGKKYNDRADIYSLGVVLSELDTCAIPFADQAIGKNGKLDGMAV  357

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V   R  PTFS +CP
Sbjct  358  IKLVTQKRAKPTFSVECP  375

>PHYKE_9073
Length=275

 Score = 87.8 bits (216),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MT  +GT  WIAPE+L G+ RY+   D+YSFGV+LSELD+  +PF+DV  + G+     +
Sbjct  107  MTRSIGTSRWIAPEVLAGEARYSAAVDVYSFGVILSELDSHDLPFADVSLSNGEPLSENR  166

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            IL  +  G L P+ SD+CP    R V  ++  C  L+P+
Sbjct  167  ILELLQSGALHPSLSDRCP----RGVAMLMFECLTLEPT  201

>SDRG_05454
Length=704

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W+APE+++G  Y E  DIYSFG VLSE+DTC +P+ D     G K +   I
Sbjct  583  MTAGVGTCRWMAPEVIQGAHYDEAVDIYSFGCVLSEMDTCNVPYFDATHTNGSKLQDHAI  642

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V+ G L P+F+  CP  +
Sbjct  643  MAGVVQGTLKPSFTKDCPKEI  663

>PITG_09620
Length=117

 Score = 83.6 bits (205),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 56/98 (57%), Gaps = 5/98 (5%)

Query  1   MTAGVGTPYWIAPEILEGKR-YTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
           MT GVGT  W+APE++ G R Y + +DI++ GVV+SELDT  +P+ D   A G     V 
Sbjct  1   MTRGVGTGRWLAPEVITGNRNYDQTSDIFALGVVMSELDTHMLPYEDARGAGGNPLADVA  60

Query  60  ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
           IL  V  G+L PTFS  CP+ L      + R C    P
Sbjct  61  ILQLVASGKLLPTFSSMCPAELH----DLARRCMAFNP  94

>PYIR_21456
Length=398

 Score = 89.0 bits (219),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/89 (43%), Positives = 63/89 (71%), Gaps = 2/89 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDT-CKMPFSDVVTAEGKKPKPVQ  59
            + AG G  +W APE+L G+RY+E++DIY+FGV+LSE+DT   +P+++  + + ++ +P Q
Sbjct  283  VAAGDGNAFWTAPEVLSGRRYSEKSDIYAFGVLLSEIDTNGNLPYANTKSEDRQQLRPFQ  342

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSM  88
            +L+ V  G+L P FS  CP R+ R + +M
Sbjct  343  VLNLVASGKLRPAFSPNCPVRV-REIAAM  370

>PITG_17495
Length=529

 Score = 89.4 bits (220),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 60/99 (61%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MT GVGT  W+APEI  G+ +YTE  D+YSFG++LSELDT  +PF+D  T+ G     + 
Sbjct  414  MTVGVGTARWLAPEIARGEDKYTEAVDVYSFGIILSELDTHHLPFADARTSSGAPLNDMA  473

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            IL  V  G L    S  CP +LE    ++ RSC  L P+
Sbjct  474  ILQGVSSGALQVALSPTCPPKLE----ALARSCMHLDPA  508

>PHYSO_520489
Length=608

 Score = 89.4 bits (220),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 59/79 (75%), Gaps = 2/79 (3%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W+APE++ G++Y+E+AD++SFGVVLSELD+  +P+++    +G++   + +
Sbjct  507  MTAGVGTSLWMAPEMMTGEKYSEKADMFSFGVVLSELDSNALPYANA--GKGRQGSDLVV  564

Query  61   LHWVLDGRLSPTFSDKCPS  79
            L  V+ G+L   FSD CPS
Sbjct  565  LQLVMQGKLQVEFSDSCPS  583

>H310_04787
Length=576

 Score = 89.4 bits (220),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTA +GT  WIAPEI+ G  YTE+ADIYSFGV+L+ELD C +P+S+V  A G      ++
Sbjct  463  MTAEIGTLAWIAPEIMLGGHYTERADIYSFGVILNELDLCDLPYSNVTDARGAAISHTRL  522

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
               V  G+++P FS +CP  +++    M   C R  P+
Sbjct  523  GVLVAQGKVAPQFSPQCPPWVQQ----MGGECLRFDPT  556

>PYAR_22562
Length=113

 Score = 83.2 bits (204),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 61/97 (63%), Gaps = 4/97 (4%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MT  VG+  WIAPE++ G  Y E+AD++SFG+VL+ELD+ ++P+ + +T +G+K     +
Sbjct  1   MTTNVGSSLWIAPEVMMGNNYNEKADVFSFGIVLTELDSLQLPYYNALTPDGRKMPDAAV  60

Query  61  LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
           LH V  G+L   FS    S   +++  + R+C  + P
Sbjct  61  LHLVTMGKLQAEFS----SMSRKDMMLLGRACLAMDP  93

>H257_03172
Length=596

 Score = 89.0 bits (219),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 6/99 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTA +GT  WIAPEI+ G  YTE+ADIYSFGV+L+ELD C +P+S+V  + G      ++
Sbjct  483  MTAEIGTLAWIAPEIMLGGHYTEKADIYSFGVLLNELDLCDLPYSNVADSRGAGISHTRL  542

Query  61   LHWVLDGRLSPTFSDKC-PSRLERNVCSMIRSCGRLQPS  98
               V  G++SP FS +C P  LE     M + C R  PS
Sbjct  543  GVLVAQGKVSPQFSPQCIPWVLE-----MGQDCLRFDPS  576

>PHYSO_337950
Length=575

 Score = 89.0 bits (219),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 53/81 (65%), Gaps = 21/81 (26%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGTPYW APEILEGKRYTE+ADIYSF                     G++ KP+QI
Sbjct  487  MTAGVGTPYWTAPEILEGKRYTEKADIYSF---------------------GQENKPIQI  525

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            L  V+ G+L P+FSDKCP R+
Sbjct  526  LTDVMVGKLRPSFSDKCPPRI  546

>SPRG_15954
Length=1032

 Score = 89.0 bits (219),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 50/105 (48%), Positives = 59/105 (56%), Gaps = 16/105 (15%)

Query  1    MTAGVGTPYWIAPEIL-------EGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGK  53
            MT+  GTPYWIAPE+L       EG+ YT  ADIYSFGVVL+ELDT  +P+ DVV     
Sbjct  899  MTSNAGTPYWIAPEVLRDPEHAGEGRIYTTAADIYSFGVVLTELDTRDVPYHDVV-----  953

Query  54   KPKPVQILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
             PK   IL  VL G L PT S  CP  L     ++   C    P+
Sbjct  954  GPKRGSILSKVLAGELRPTMSATCPRWLH----TLANQCMAFDPT  994

>CCI10439
Length=402

 Score = 87.8 bits (216),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 5/94 (5%)

Query  5    VGTPYWIAPEILEGKRY-TEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHW  63
            VG+  WIAPE+L GK   TE ADIYS G++L ELDT   PFSD+++A+      +Q+LH 
Sbjct  293  VGSCRWIAPEVLVGKNACTEAADIYSLGIILLELDTLDFPFSDLLSADRSPVPEIQVLHL  352

Query  64   VLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +  G +SPT S  CP+ L    C +I  C R  P
Sbjct  353  IASGAMSPTLSSSCPTSL----CRVIERCTRPDP  382

>PHYCA_505173
Length=128

 Score = 82.8 bits (203),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 2/98 (2%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDV-VTAEGKKPKPVQ  59
           MTAGVGT  W+APE++ G+RY E+AD++SFG+VLSELD+ K+P++   +T  G+      
Sbjct  1   MTAGVGTSLWMAPEVMMGERYDEKADLFSFGIVLSELDSHKLPYASAKITETGRVIPDTA  60

Query  60  ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
           IL  V  GRLS  F+      LE  V  + ++C   +P
Sbjct  61  ILQLVSSGRLSVDFTPPASPALEAMV-HLGKACVAFEP  97

>H310_09505
Length=427

 Score = 87.8 bits (216),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W APE+   K+Y ++AD+YS GVVLSELDTC +P++D    +  K   + +
Sbjct  309  MTAGVGTALWAAPEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAVGKNGKLDGMAV  368

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V   +  PTFS+ CP
Sbjct  369  VKLVTQQKAKPTFSESCP  386

>SPRG_03075
Length=565

 Score = 88.2 bits (217),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   Y E AD++SFGV+LSELDT ++P++D V   G+      I
Sbjct  450  MTAGIGTYRWMAPEVLQEGHYAESADMFSFGVILSELDTHQLPYADKVNGSGRPYTDTAI  509

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +  V+ G L P+FS+ CP R  R++ S    C  L+P
Sbjct  510  MAKVMTGELRPSFSESCP-RWYRDLGS---CCMALKP  542

>PHALS_04459
Length=515

 Score = 88.2 bits (217),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W+APE++ G  Y  +ADI+SFGV+LSELD   MP+++V  A G++P    +
Sbjct  396  MTNAVGTSLWMAPEVMMGGHYDGKADIFSFGVLLSELDRHDMPYANVKNASGRRPTDSVL  455

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G+L   FSD CP +    V ++ + C  + P+
Sbjct  456  LQMVAGGKLQVQFSDNCPEQ----VLTLAKECISVDPT  489

>PHALS_05836
Length=732

 Score = 88.2 bits (217),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 5/98 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVT-AEGKKPKPVQ  59
            MTAG+GT +WIAPE+L GK Y E+ADIYS G+VLSE+DT   P+ +     +G K   + 
Sbjct  597  MTAGIGTSFWIAPEVLLGKDYDERADIYSLGIVLSEIDTEDYPYWNAKNPPKGGKAMEIA  656

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            IL  V  G L P F++ CP  + R    + ++C  L P
Sbjct  657  ILRMVAAGELIPEFTESCPQEVLR----LAKACLSLNP  690

>PYAP_25223
Length=135

 Score = 82.8 bits (203),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 60/99 (61%), Gaps = 6/99 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMP-FSDVVTAEGKKPKPVQ  59
            MTAGVG+  WIAPE+L G RY E+ADI+SFGVVLSELDT + P F     + G K     
Sbjct  19   MTAGVGSSLWIAPEVLIGDRYDEKADIFSFGVVLSELDTHQSPYFHAKEGSSGVKLPETA  78

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            IL  V+ GRLS  FSD      +  + ++ R C  + P+
Sbjct  79   ILQQVMLGRLSVAFSDP-----DAQLANLGRECVAIDPN  112

>SDRG_00196
Length=642

 Score = 87.8 bits (216),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APE+L+G+ Y+  AD+YSFGVVLSELDT  +P+++V+   G+      +
Sbjct  518  MTCGVGTSRWTAPEVLQGQYYSSAADVYSFGVVLSELDTHALPYAEVLGPNGQPLSEATL  577

Query  61   LHWVLDGRLSPTFSDKCP  78
            +H V  G L+PTF   CP
Sbjct  578  VHRVCAGELAPTFRASCP  595

>PPTG_00076
Length=744

 Score = 87.8 bits (216),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 57/82 (70%), Gaps = 1/82 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPF-SDVVTAEGKKPKPVQ  59
            MTAGVGT +WIAPE+L G+ Y E ADI+SFGVVLSE+DT   P+ +D   +   K +  +
Sbjct  610  MTAGVGTSFWIAPEVLLGRDYDEAADIFSFGVVLSEIDTDDYPYWNDENPSNHGKIQEAE  669

Query  60   ILHWVLDGRLSPTFSDKCPSRL  81
            IL  V +G+L P+FS+ CP  +
Sbjct  670  ILSLVAEGKLRPSFSNDCPKAI  691

>PPTG_14169
Length=687

 Score = 87.8 bits (216),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 59/98 (60%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APEIL G+ Y+E+AD+YS+ +VLSELDTC  PF+       ++   +Q+
Sbjct  567  MTNGVGTLLWTAPEILRGEAYSEKADVYSYAIVLSELDTCLPPFTLNTEVSERRLTTMQL  626

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H    G +SP   D CP  L++    +  +C   +P+
Sbjct  627  MHLATSGEVSPQLRDDCPISLQQ----LTAACASFEPN  660

>PHYRA_84550
Length=1132

 Score = 87.8 bits (216),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 0/78 (0%)

Query  4    GVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHW  63
              G P+W APE+L G++ T ++D+Y+FGV+L+ELDT K PF D  +  G   KP+Q+L+ 
Sbjct  302  ATGAPFWSAPEVLRGEQLTTKSDVYAFGVLLTELDTAKAPFHDAWSPIGTTLKPIQVLNE  361

Query  64   VLDGRLSPTFSDKCPSRL  81
            V+ G L P+FS  CP R+
Sbjct  362  VMQGTLRPSFSPDCPRRV  379

 Score = 79.0 bits (193),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 0/71 (0%)

Query  9     YWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHWVLDGR  68
             +WIAPE+L+G  Y+  ADI+SFGV+L+ELDTC+ P+ D  + +G       +L  V +GR
Sbjct  1032  FWIAPEVLQGAPYSPAADIFSFGVLLAELDTCESPYYDARSPDGSTLDQEAVLAIVAEGR  1091

Query  69    LSPTFSDKCPS  79
             L P+FS +CP+
Sbjct  1092  LRPSFSAECPT  1102

>SPRG_05680
Length=339

 Score = 86.7 bits (213),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+ VGT  W APE+L+G RY  +AD+YSFG+VL+ELD+ K+P++DV    G       +
Sbjct  210  MTSAVGTFRWTAPEVLQGARYDTKADMYSFGMVLTELDSHKVPYADVRNGRGHAMGSFTL  269

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            L+ V+ G + P+FS  CP  L
Sbjct  270  LYHVMRGEMQPSFSASCPEWL  290

>SDRG_01022
Length=765

 Score = 87.8 bits (216),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 6/100 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGK--KPKPV  58
            MTA +GT  WIAPE+L G RYTE+ADIYSFGV+++ELDT  +P+S+V    G        
Sbjct  643  MTAEIGTSAWIAPEVLMGVRYTEKADIYSFGVLMAELDTGVVPYSEVYLEPGSTLTLARA  702

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +I   V  G LSPTF++ CP    R V  + R C    PS
Sbjct  703  RIAMLVASGELSPTFTETCP----RQVVYVARKCLSHDPS  738

>HYAP_07454
Length=545

 Score = 87.8 bits (216),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MT  +GT  WIAPE+L G  RY+   DIYSFGV+LSELD+ ++PFS+V  + G+      
Sbjct  380  MTRSIGTNRWIAPEVLSGDARYSTAVDIYSFGVILSELDSHELPFSEVTLSNGQSLPESA  439

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +L  +  G + P+ SD+CP    R V +++  C  L+PS
Sbjct  440  VLELLRTGAIRPSLSDRCP----REVATLVMECLTLEPS  474

>PITG_17840
Length=513

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 1/79 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPF-SDVVTAEGKKPKPVQ  59
            MTAGVGT +WIAPE+L G+ Y E ADI+SFGVVLSE+DT   P+ +D   +   K +  +
Sbjct  379  MTAGVGTSFWIAPEVLLGRDYDEAADIFSFGVVLSEIDTDDYPYWNDENPSNRGKIQEAE  438

Query  60   ILHWVLDGRLSPTFSDKCP  78
            IL  V +G+L P+FS  CP
Sbjct  439  ILSLVAEGKLRPSFSKDCP  457

>H257_06723
Length=724

 Score = 87.8 bits (216),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 60/82 (73%), Gaps = 2/82 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKK-PKPVQ  59
            MTA VGT  WIAPE+L+G +Y   AD+YSFGV+LSE+DT   P+S +VT  G + PKP+ 
Sbjct  608  MTAEVGTIAWIAPEVLKGSKYAVSADMYSFGVLLSEVDTGISPYSHLVTNGGSQLPKPM-  666

Query  60   ILHWVLDGRLSPTFSDKCPSRL  81
            I   V+DG L PTFS +CP+++
Sbjct  667  IAMKVMDGELRPTFSPQCPAQV  688

>PPTG_07736
Length=431

 Score = 87.0 bits (214),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 64/99 (65%), Gaps = 6/99 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVV-TAEGKKPKP-V  58
            MTAGVGT +W+APE++ G+RY E+AD++SFGVVLSELDT ++P+S     +E  +P P  
Sbjct  311  MTAGVGTSFWMAPEVVMGERYGEKADVFSFGVVLSELDTHELPYSHAKENSETSRPLPDT  370

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
             +L  VL GRL   FS   P  +      + R C +++P
Sbjct  371  AVLQLVLMGRLQVQFSGVGPIEMTE----LARQCLQIEP  405

>PHYRA_75791
Length=1071

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 1/79 (1%)

Query  1     MTAGVGTPYWIAPEILEGKR-YTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
             MTAG+GT  W+APEI+ G   Y + ADI++FGV+LSE DT  +P+ D V   G   + V 
Sbjct  955   MTAGIGTRRWLAPEIISGSSDYDQSADIFAFGVLLSEFDTHALPYDDAVGNNGNALEDVT  1014

Query  60    ILHWVLDGRLSPTFSDKCP  78
             IL  +  G L PTFSD CP
Sbjct  1015  ILQMIASGNLRPTFSDTCP  1033

>SPRG_11390
Length=655

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APE+L+G+ Y+  AD+YSFGVVLSELDT  +P++DV+   G+      +
Sbjct  531  MTCGVGTSRWTAPEVLQGQYYSSAADVYSFGVVLSELDTHALPYADVLGPNGQPLAEATL  590

Query  61   LHWVLDGRLSPTFSDKCPS  79
            +  V  G L+PTF   CP+
Sbjct  591  VQRVCAGELTPTFQASCPA  609

>SPRG_05677
Length=327

 Score = 86.3 bits (212),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W APE+L+GK Y E+ADIYSFG++L+ELDT  +P++D+V   G+      I
Sbjct  213  MTNAVGTYRWTAPEVLKGKHYDERADIYSFGMILTELDTHALPYADMVNERGQALGNFTI  272

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            ++ V+ G + PT S  C   L   V   I     ++PS
Sbjct  273  MYKVMQGTILPTLSPTCSPWLRDLVYECIAHDASMRPS  310

>SDRG_07151
Length=658

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 1/99 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W APE+L+GK Y  +ADIYSFG+VL+EL+T  MP++D   A G+      I
Sbjct  543  MTNAVGTYRWTAPEVLKGKHYDTKADIYSFGMVLAELETHAMPYADFTNARGEPLGNFAI  602

Query  61   LH-WVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            ++  V+ G+++PT S  CP  LE  V + I     L+P+
Sbjct  603  MYKVVMQGKIAPTLSSDCPPWLETLVLACIAHSPALRPT  641

>SDRG_07165
Length=722

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/82 (48%), Positives = 56/82 (68%), Gaps = 0/82 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+ VGT  W APE+L+G RY  +ADIYSFG+VL+ELD+ K+P++DV    G+      +
Sbjct  592  MTSAVGTFRWTAPEVLQGARYDTKADIYSFGMVLTELDSRKVPYADVRNGRGQAMGSFTL  651

Query  61   LHWVLDGRLSPTFSDKCPSRLE  82
            L+ V+ G + P+FS  CP  L+
Sbjct  652  LYHVMRGEMQPSFSSACPEWLK  673

>SDRG_12347
Length=541

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 1/83 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVV-TAEGKKPKPVQ  59
            MT+ +GT  WIAPE+L G RYTE+ADIYSFGV+LSELDTC++P+S++   ++  +    +
Sbjct  428  MTSNIGTVAWIAPEVLTGGRYTEKADIYSFGVLLSELDTCEVPYSNMSGKSKDAQFSNAR  487

Query  60   ILHWVLDGRLSPTFSDKCPSRLE  82
            I   V +G L P FSD+ P  + 
Sbjct  488  IAMMVSEGTLRPAFSDRIPEAIH  510

>H257_17421
Length=406

 Score = 87.0 bits (214),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W APE+   K+Y ++AD+YS GVVLSELDTC +P++D    +  K   + +
Sbjct  288  MTAGVGTALWAAPEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAV  347

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V   +  PTFS  CP  +
Sbjct  348  IKLVTQQKAKPTFSRSCPEEV  368

>SDRG_00883
Length=571

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 63/97 (65%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   Y E AD++SFGV+LSELDT ++P++D V + G+      I
Sbjct  456  MTAGIGTYRWMAPEVLQEGHYAESADMFSFGVILSELDTHQLPYADKVNSSGRPYTDTAI  515

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +  V+ G L P+FS  CP R  R++ S    C  L+P
Sbjct  516  MAKVMTGELRPSFSGSCP-RWYRDLGS---CCMALKP  548

>CCA19851
Length=401

 Score = 86.7 bits (213),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 5/94 (5%)

Query  5    VGTPYWIAPEILEGKR-YTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHW  63
            VG+  WIAPEIL GK   TE ADIYS G++L ELDT   PFSD+++++      +Q+LH 
Sbjct  292  VGSCRWIAPEILLGKNANTEAADIYSLGIILVELDTLDFPFSDLLSSDRNPVPEIQVLHL  351

Query  64   VLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +  G LSPT S  CP+ L    C +I  C R  P
Sbjct  352  IASGALSPTLSSSCPTSL----CRVIEQCTRPDP  381

>PITG_06481
Length=658

 Score = 87.4 bits (215),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APEIL G+ Y+E+AD+YS+ +VLSELDTC  PF+       ++   +Q+
Sbjct  538  MTNGVGTLLWTAPEILRGEAYSEKADVYSYAIVLSELDTCLPPFTLNTEVSERRLTTMQL  597

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H    G +SP   + CP+ L++    +  +C   +P+
Sbjct  598  MHLATSGEVSPQLREDCPASLQQ----LTAACASFEPN  631

>SDRG_01024
Length=726

 Score = 87.4 bits (215),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 64/100 (64%), Gaps = 6/100 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGK--KPKPV  58
            MTA +GT  WIAPE+L+G RYTE+ADIYSFGV++SELDT ++P++++    G        
Sbjct  596  MTAEIGTAAWIAPEVLKGVRYTEKADIYSFGVMMSELDTTEIPYANLFLEPGSTLTLART  655

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +I   V++G L P F  +CP+++ R    + R C    P+
Sbjct  656  RIAMLVVNGELRPRFRAQCPNKIAR----VARRCLAFDPA  691

>PHYCA_5374
Length=806

 Score = 87.4 bits (215),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 5/84 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGK-----KP  55
            MTA +GT  WIAPE+L G+RY+E+AD+YSFGV+L+ELDTC+ P+S+ V  E       K 
Sbjct  625  MTAEIGTISWIAPEVLRGERYSEKADVYSFGVILTELDTCRRPYSEGVPNEDNRGGNIKH  684

Query  56   KPVQILHWVLDGRLSPTFSDKCPS  79
               +I   V  G+L PT S  CP+
Sbjct  685  TNARIAVLVSAGKLRPTLSSDCPN  708

>H310_01860
Length=746

 Score = 87.4 bits (215),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 60/98 (61%), Gaps = 10/98 (10%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+ VGT  WIAPE+L  + Y+E+ADIYSFGV+LSELDT  +P+SD    E       QI
Sbjct  637  MTSNVGTARWIAPEVLINEDYSEKADIYSFGVLLSELDTHAIPYSDSTLEER------QI  690

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +  V   RL PTFS  CP +++     + R C +  PS
Sbjct  691  MQMVAVNRLRPTFSPNCPEQIQH----LARHCMQADPS  724

>H257_04203
Length=526

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W+APE+L+   YT  AD+YSFGV++SELDT  +P+SD   A GK      I
Sbjct  410  MTMGVGTYRWMAPELLQDSHYTVAADMYSFGVLVSELDTHCIPYSDQTNARGKPLADTTI  469

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+ G L+PTFS KCP
Sbjct  470  MAQVMRGTLAPTFSTKCP  487

>H310_11716
Length=643

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 4/95 (4%)

Query  3    AGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILH  62
             G GT  WIAPE+L G+R+T+ AD+Y+FG+VLSELD+ ++P++   TA G     V IL 
Sbjct  523  GGFGTSRWIAPEVLSGERFTKAADVYAFGIVLSELDSHQIPYAHARTASGNDLTNVAILS  582

Query  63   WVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
             V+ G ++P F D CP +    V  + R C    P
Sbjct  583  QVVKGTMTPEFQDTCPDQ----VLHLARYCLHPNP  613

>SPRG_03077
Length=507

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   Y E AD++SFGV+LSEL T ++P+SD V   G+      I
Sbjct  389  MTAGIGTYRWMAPEVLQDGHYAESADMFSFGVILSELSTHRLPYSDYVNGSGRPYTDTAI  448

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+ G   PTF+D CP
Sbjct  449  MARVMMGDFQPTFADDCP  466

>SPRG_07855
Length=420

 Score = 86.7 bits (213),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W APE+   K+Y ++AD+YS GVVLSELDTC +P++D    +  K   + +
Sbjct  302  MTAGVGTALWAAPEVFLAKKYNDRADVYSLGVVLSELDTCAIPYADQAIGKNGKLDGMAV  361

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V   +  PTFS  CP
Sbjct  362  IKLVTQQKAKPTFSPSCP  379

>PPTG_00069
Length=765

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPK--PV  58
            MTAG+GT +WIAPE+L G+ Y EQADIYSFGVVLSE+DT   PF +    +G + K    
Sbjct  630  MTAGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPFWNDANRDGPRGKLQEA  689

Query  59   QILHWVLDGRLSPTFSDKCPS  79
             IL  V  G   P FS  CP+
Sbjct  690  DILRQVATGNKRPQFSTNCPA  710

>SDRG_07159
Length=972

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W APE+L+GK Y  +ADIYSFG++L+ELDT  +P++D+V   G+      I
Sbjct  851  MTNAVGTYRWTAPEVLKGKHYDTKADIYSFGMILTELDTHAVPYADMVNDRGQALGNFTI  910

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            ++ V+ G++ PT S+ CP  L
Sbjct  911  MYKVMQGKIKPTLSESCPDWL  931

>PYAP_25222
Length=114

 Score = 81.3 bits (199),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 60/97 (62%), Gaps = 7/97 (7%)

Query  1   MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
           MTAGVG+  W+APE++ G+RY E+ADI+SFGVVLSE+DT ++P+      + K P+   I
Sbjct  1   MTAGVGSSLWMAPEVMMGERYNEKADIFSFGVVLSEIDTHQLPYFQ--AKQAKMPEAA-I  57

Query  61  LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
           +  V+ GRL+  F+D     L      + R C  + P
Sbjct  58  MQQVMLGRLTVAFTDNAHPEL----AQLGRDCVAVNP  90

>PHYSO_499386
Length=490

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%), Gaps = 6/100 (6%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVT-AEGKKPKPV  58
            MTAGVGT  W+APEI  G+ +YTE  D+YSFG++LSELDT ++PF+D  T   G     +
Sbjct  376  MTAGVGTTRWLAPEIARGEGKYTEAVDVYSFGIILSELDTHQLPFADAKTRGTGAPLNDM  435

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
             IL  V  G L  T S  CP    RN+ ++ R C  L PS
Sbjct  436  AILQGVSSGELLVTMSPTCP----RNLEALARRCMSLDPS  471

>SPRG_09616
Length=327

 Score = 85.9 bits (211),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/98 (43%), Positives = 59/98 (60%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W APE+L+GK Y E+ADIYSFG++L+ELDT  +P++D+V   G+      I
Sbjct  213  MTNAVGTYRWTAPEVLKGKHYDERADIYSFGMILTELDTHALPYADMVNDRGQALGNFTI  272

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            ++ V+ G + PT S  C   L   V   I     ++PS
Sbjct  273  MYKVMQGTILPTLSPTCSPWLRDLVYECIAHEASMRPS  310

>SDRG_01023
Length=769

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 2/81 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEG--KKPKPV  58
            MTA +GT  WIAPE+L+G RYTE+ADIYSFGV+++ELDT ++P+S+V    G        
Sbjct  633  MTAEIGTSAWIAPEVLKGVRYTEKADIYSFGVLMAELDTAEVPYSNVYLEPGCTLALARA  692

Query  59   QILHWVLDGRLSPTFSDKCPS  79
            +I   V  G L PTF+D CPS
Sbjct  693  RIAMLVATGDLVPTFTDACPS  713

>SPRG_09620
Length=965

 Score = 87.0 bits (214),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W APE+L+GK Y  +ADIYSFG++L+ELDT  +P++D+V   G+      I
Sbjct  844  MTNAVGTYRWTAPEVLKGKHYDTKADIYSFGMILTELDTHAVPYADMVNDRGQALGNFTI  903

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            ++ V+ G++ PT S+ CP  L
Sbjct  904  MYKVMQGKIKPTLSETCPDWL  924

>SPRG_05673
Length=965

 Score = 86.7 bits (213),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W APE+L+GK Y  +ADIYSFG++L+ELDT  +P++D+V   G+      I
Sbjct  844  MTNAVGTYRWTAPEVLKGKHYDTKADIYSFGMILTELDTHAVPYADMVNDRGQALGNFTI  903

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            ++ V+ G++ PT S+ CP  L
Sbjct  904  MYKVMQGKIKPTLSETCPDWL  924

>H257_15213
Length=206

 Score = 83.6 bits (205),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT  W+APEIL    YT+ ADIYSFGV+LSELD   +P+SD VT +G       I
Sbjct  85   MTIGIGTYRWMAPEILSDSHYTQAADIYSFGVILSELDMHIVPYSDQVTTKGNPINDTSI  144

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V+ G + PTFS   P  L
Sbjct  145  MGRVMQGTIQPTFSALFPPAL  165

>PHYCA_553853
Length=513

 Score = 86.7 bits (213),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPF-SDVVTAEGKKPKPVQ  59
            MTAGVGT +WIAPE+L G+ Y E ADI+SFGVVLSE+DT   P+ +D   +   + +  +
Sbjct  379  MTAGVGTSFWIAPEVLLGRDYDEAADIFSFGVVLSEIDTDDYPYWNDENQSNRGRIQEAE  438

Query  60   ILHWVLDGRLSPTFSDKCP  78
            IL  V +G+L P FS+ CP
Sbjct  439  ILSLVAEGKLRPDFSEDCP  457

>SPRG_18782
Length=783

 Score = 86.7 bits (213),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 2/81 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEG--KKPKPV  58
            MTA +GT  WIAPE+L+G RYTE+ADIYSFGV+++ELDT  +P+S V    G        
Sbjct  643  MTAEIGTSAWIAPEVLKGVRYTEKADIYSFGVLMAELDTGVVPYSTVYLEPGCTLALARA  702

Query  59   QILHWVLDGRLSPTFSDKCPS  79
            +I   V  G LSPTF+D CPS
Sbjct  703  RIAMLVASGELSPTFTDACPS  723

>CCI47779
Length=1184

 Score = 86.7 bits (213),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 15/108 (14%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKK------  54
            MT+GVGT  W APE+L G +YTE+AD+YSFG+VLSELDTC  P+      E  +      
Sbjct  610  MTSGVGTFLWTAPEVLRGDKYTEKADVYSFGIVLSELDTCYPPYHFTPELEHLRNSSCEQ  669

Query  55   -----PKPVQILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
                  + +++L  +  G++SP FS+ CP  LER    + RSC  L P
Sbjct  670  TLVLDKEGIELLPMLSSGKVSPRFSEDCPPALER----LARSCLALDP  713

>H310_12939
Length=559

 Score = 86.7 bits (213),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVT-AEGKKPKPVQ  59
            MT+ +GT  WIAPE+L G RYTE+ADIYSFGV+LSELDTC+ P+S+++  ++       +
Sbjct  446  MTSNIGTVAWIAPEVLSGGRYTEKADIYSFGVLLSELDTCESPYSNMMNKSKDASFSNAR  505

Query  60   ILHWVLDGRLSPTFSDKCPSRL  81
            I   V +G L P F+++ P +L
Sbjct  506  IALMVSEGTLKPDFTNRMPDQL  527

>PHALS_02513
Length=320

 Score = 85.5 bits (210),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKP-VQ  59
            +TAGVGT  W APE++ G  Y+EQAD+YSFGVVLSELDT ++PF +  +  G    P + 
Sbjct  204  LTAGVGTVRWTAPEVMLGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGASGAPDMA  263

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            I+  V  G L P+F+  CP  + R    + R+C +  P+
Sbjct  264  IVIKVAKGELRPSFAPDCPDVILR----IARACLQFDPA  298

>PYVX_17944
Length=704

 Score = 86.7 bits (213),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 64/119 (54%), Gaps = 25/119 (21%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFS---------------  45
            MT GVGT  W APE+LEG +Y E+ADI+SFG+VLSE+DTC +P+                
Sbjct  537  MTNGVGTILWSAPEVLEGNQYDEKADIFSFGIVLSEIDTCALPYGFTKDRGAGGGGGNGA  596

Query  46   ------DVVTAEGKKPKPVQILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
                   +      K K +QI+H V +G+L PTF D CP  L     S+ + C RL  +
Sbjct  597  GGGLAGPLAGPAAGKMKSMQIVHLVSEGKLLPTFRDDCPPAL----VSLAQRCLRLDSA  651

>PYIW_27949
Length=113

 Score = 80.9 bits (198),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 1/82 (1%)

Query  1   MTAGVGTPYWIAPEILEGKR-YTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
           MTAGVGT  W+APE++ G   Y   ADI+SFG VL+ELD+ K+P+ +V  A G K   V 
Sbjct  1   MTAGVGTGKWLAPEVISGNSDYGPPADIFSFGAVLTELDSHKLPYDEVRGANGGKLVDVA  60

Query  60  ILHWVLDGRLSPTFSDKCPSRL  81
           +L  V  G+++P F+  CP ++
Sbjct  61  LLQMVASGQVTPGFTSSCPDKI  82

>PHYRA_81631
Length=634

 Score = 86.3 bits (212),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 6/97 (6%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDV-VTAEGKKPKPV  58
            MTAGVGT  W+APEI  G+ +YTE  D+YSFG++LSELDT ++PF+D      G     +
Sbjct  519  MTAGVGTTRWLAPEIARGEEKYTEAVDVYSFGIILSELDTHQLPFADAKARGSGAPLNDM  578

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRL  95
             IL  V  G L  T S +CP    RN+ ++ RSC  L
Sbjct  579  AILQGVSSGELQVTLSAECP----RNLQALARSCMNL  611

>PHALS_00564
Length=122

 Score = 80.9 bits (198),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 4/102 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVV---TAE-GKKPK  56
            MTAGVGT  W+APE++ GKRY   ADI+SFGVVLSELD+ + P++ V+   T+E G+K  
Sbjct  1    MTAGVGTRRWMAPEVMMGKRYDTSADIFSFGVVLSELDSHQPPYARVIEFMTSESGEKVT  60

Query  57   PVQILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
              ++   V  GR+   FS K P+ L     + +    R +PS
Sbjct  61   ETRLAEMVATGRIRIEFSSKAPAALVNLGLACVNLDSRARPS  102

>PYVX_17951
Length=675

 Score = 86.3 bits (212),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 0/83 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APEIL G+ Y+E+AD+YS+G+VLSELDTC  PFS       ++   +Q+
Sbjct  560  MTSGVGTLLWTAPEILRGEPYSEKADVYSYGIVLSELDTCLPPFSLNDEVSRQRLTTMQL  619

Query  61   LHWVLDGRLSPTFSDKCPSRLER  83
            +H V   +L+P F   CPS + +
Sbjct  620  IHLVTCSKLAPEFRSDCPSAITK  642

>PITG_17832
Length=767

 Score = 86.3 bits (212),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPK--PV  58
            MTAG+GT +WIAPE+L G+ Y EQADIYSFGVVLSE+DT   PF +    +G + K    
Sbjct  632  MTAGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPFWNDANRDGPRGKLQEA  691

Query  59   QILHWVLDGRLSPTFSDKCPS  79
             IL  V  G   P FS  CP+
Sbjct  692  DILRQVATGNKRPHFSTNCPA  712

>PHYKE_2403
Length=532

 Score = 86.3 bits (212),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W+APE++ G RY  +AD++SFGV+LSE+DT +MP+++V    G+KP    I
Sbjct  413  MTNAVGTSLWMAPEVMMGGRYDCKADVFSFGVLLSEIDTHQMPYANVKNPSGRKPTEAAI  472

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            L  V  G L   FS KCP    + +  +  +C  L P
Sbjct  473  LQMVAIGTLRVHFSPKCP----KAILKLAEACISLDP  505

>SDRG_11990
Length=885

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W+APEIL+   YT   DIYSFG++LSELDT  +P++D+ +A+GK      I
Sbjct  774  MTIGVGTYRWMAPEILKENLYTVAVDIYSFGMILSELDTHHIPYADLTSAKGKPLVDTAI  833

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +  V+ G +SP+F   CPS L       I S    +PS
Sbjct  834  MGMVIQGTISPSFRPDCPSWLHALALRCIASSPDDRPS  871

 Score = 79.3 bits (194),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W+APEIL+  +YT  AD+YSFG++LSEL+T  +P+SD     G+      I
Sbjct  274  MTVGVGTYRWMAPEILKYNQYTVAADVYSFGIILSELNTHVVPYSDRTNDRGQGLVDTAI  333

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V++  + PTF+ +CP
Sbjct  334  MSMVINDEIRPTFTPECP  351

>H257_18403
Length=715

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 10/97 (10%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+ VGT  WIAPE+L  + Y+E+ADIYSFGV+LSELDT  +P+SD    E       QI
Sbjct  606  MTSNVGTARWIAPEVLINEDYSEKADIYSFGVLLSELDTHAIPYSDSTLEER------QI  659

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +  V   RL PTFS  CP +++     + R+C +  P
Sbjct  660  MQLVAVNRLRPTFSPDCPEQIQH----LARACMQADP  692

>PITG_08898
Length=678

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 6/84 (7%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APE+L G+RY+E+ADIYSFGVVL+ELDTC  P++    ++G+K K    
Sbjct  565  MTSGVGTLLWTAPEVLRGERYSEKADIYSFGVVLAELDTCLPPYA---YSQGRKNKGKND  621

Query  61   LHWV---LDGRLSPTFSDKCPSRL  81
            + WV     GR SP F   CP  L
Sbjct  622  MDWVPLIASGRASPPFRPDCPRAL  645

>PHYCA_503452
Length=435

 Score = 85.9 bits (211),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 65/99 (66%), Gaps = 6/99 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVV-TAEGKKPKP-V  58
            MTAGVGT +W+APE++ G++Y E+AD++SFGVVLSELDT ++P+S     +E  +P P  
Sbjct  315  MTAGVGTSFWMAPEVVMGEQYGEKADVFSFGVVLSELDTHELPYSHAKENSETGRPLPDT  374

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
             +L  VL GRL   FS   PS +      + + C +++P
Sbjct  375  AVLQLVLMGRLQVQFSGVGPSEMTE----LAQQCLQIEP  409

>H257_12976
Length=557

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKP-KPVQ  59
            MT+ +GT  WIAPE+L G RYTE+ADIYSFGV+LSELDT ++P+++++    +      +
Sbjct  439  MTSNIGTVAWIAPEVLTGGRYTEKADIYSFGVLLSELDTLQVPYAEMLGKSKENGFSNAR  498

Query  60   ILHWVLDGRLSPTFSDKCPSRLER  83
            +   V +G L PTF+D  PS+L +
Sbjct  499  LAMMVSEGALQPTFTDGIPSQLHQ  522

>HYAP_05921
Length=565

 Score = 85.9 bits (211),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APEIL G+ Y+E+AD+YS+ +VLSELDTC  PF+       ++   +Q+
Sbjct  441  MTNGVGTLLWTAPEILRGEAYSEKADVYSYAIVLSELDTCLPPFALNAEVRERRLTSMQL  500

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H    G +SP   + CP  L++    +  +C    PS
Sbjct  501  MHLATSGEISPQLREDCPVPLQQ----LTAACASFDPS  534

>PPTG_06246
Length=674

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 6/84 (7%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT+GVGT  W APE+L G+RY+E+ADIYSFGVVL+ELDTC  P++    ++G+K K    
Sbjct  561  MTSGVGTLLWTAPEVLRGERYSEKADIYSFGVVLAELDTCMPPYA---YSQGRKNKGKND  617

Query  61   LHWV---LDGRLSPTFSDKCPSRL  81
            + WV     GR SP F   CP  L
Sbjct  618  MDWVPLIASGRASPPFRPDCPRAL  641

>SPRG_00235
Length=482

 Score = 85.9 bits (211),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 6/100 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGK--KPKPV  58
            MTA +GT  WIAPE+L+G RYTE+ADIYSFGV++SELDT ++P++++    G        
Sbjct  352  MTAEIGTAAWIAPEVLKGVRYTEKADIYSFGVMMSELDTTEIPYANLFLEPGSTLTLART  411

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +I   V++G L P F  +CP ++ R    + R C    P+
Sbjct  412  RIAMLVVNGELRPGFRAQCPHQIAR----VARRCLAFDPA  447

>PYU1_G013198
Length=351

 Score = 85.1 bits (209),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKR-YTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MT GVGT  W+APE++ GK  Y + ADIY+FGVVLSE+DT  +P+ ++    G +   V 
Sbjct  234  MTTGVGTGKWLAPEVISGKSDYDQSADIYAFGVVLSEIDTHAVPYEELRGTSGNQLAEVA  293

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            IL  V  G L P+FS+ CP     N+  +   C   +P+
Sbjct  294  ILQLVAKGELVPSFSETCP----ENIKELAARCLSFEPT  328

>PHYCA_105110
Length=327

 Score = 84.7 bits (208),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 55/81 (68%), Gaps = 0/81 (0%)

Query  2    TAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQIL  61
            T  + +P+W APE+L G  ++++ADIYS GVV+ ELDT + P+++ +TA G +  P+QIL
Sbjct  210  TLRLNSPFWTAPEVLMGGAHSDEADIYSLGVVIMELDTHQSPYANTMTARGSRMPPLQIL  269

Query  62   HWVLDGRLSPTFSDKCPSRLE  82
              ++ G L PT S  CP  ++
Sbjct  270  QHIMSGHLKPTLSPNCPGEIK  290

>PHYSO_515605
Length=773

 Score = 85.9 bits (211),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 2/83 (2%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPK--PV  58
            MTAG+GT +WIAPE+L G+ Y EQADIYSFGVVLSE+DT   P+ +    +G + K    
Sbjct  635  MTAGIGTSFWIAPEVLLGRDYNEQADIYSFGVVLSEIDTDDYPYWNDANRDGARGKLEEA  694

Query  59   QILHWVLDGRLSPTFSDKCPSRL  81
             IL  V  G   P FS  CP+ +
Sbjct  695  DILRQVAKGNKRPQFSPNCPAAI  717

>PHALS_04784
Length=808

 Score = 85.9 bits (211),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 5/84 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ-  59
            MTA +GT  WIAPE+L G+RY+E+AD+YSFGV+++ELDTC+ P+S+ V  +  +   V+ 
Sbjct  630  MTAEIGTISWIAPEVLRGERYSEKADVYSFGVIMTELDTCRRPYSEGVLNDDNRGGNVKH  689

Query  60   ----ILHWVLDGRLSPTFSDKCPS  79
                I   V  G+L PT S  CP+
Sbjct  690  TNARIAVLVSAGKLRPTLSSDCPN  713

>PITG_08890
Length=521

 Score = 85.9 bits (211),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W+APE++ G  Y  +AD+YSFGV+LSELDT  MP+++V    G+KP    I
Sbjct  402  MTNAVGTSLWMAPEVMMGGHYDGKADVYSFGVLLSELDTHFMPYANVRNPSGRKPTEAAI  461

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            L  V  G L   FS  CP  L     ++  +C  ++P
Sbjct  462  LQMVAVGTLQVEFSRNCPVEL----LTLAHACISVEP  494

>PITG_10675
Length=521

 Score = 85.9 bits (211),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MT  +GT  WIAPE+L G  RY+   DIYSFGV+LSELD+ ++PFS+V  + G+      
Sbjct  359  MTRSIGTSRWIAPEVLSGDARYSTAVDIYSFGVILSELDSHELPFSEVTLSNGQPLPESA  418

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +L  +  G + P+ SD+CP    R V  ++  C  L+P+
Sbjct  419  VLELLRTGAIHPSLSDRCP----RGVAMLMMECLTLEPT  453

>PHYSO_354036
Length=437

 Score = 85.5 bits (210),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 66/99 (67%), Gaps = 6/99 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVV-TAEGKKPKP-V  58
            MTAGVGT +W+APE++ G++Y  +AD++SFGVVLSELDT ++P+S     +E  +P P  
Sbjct  317  MTAGVGTSFWMAPEVVLGEQYGAKADVFSFGVVLSELDTHELPYSHAKENSETGRPLPDA  376

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
             +L  VL GRL   FSD  P+ + +    + + C +++P
Sbjct  377  AVLQLVLMGRLQVQFSDVGPTEMTQ----LAQQCLQMEP  411

>H310_08166
Length=348

 Score = 84.7 bits (208),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 0/81 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            M+  VGT  W APE+L+GK YT +AD+YSFG+VLSELDT  +P+  +V A+G++     I
Sbjct  233  MSNAVGTYRWTAPEVLQGKYYTVKADVYSFGMVLSELDTHVVPYFGMVNAKGQELGNFTI  292

Query  61   LHWVLDGRLSPTFSDKCPSRL  81
            +  V++G + P FS  CP  L
Sbjct  293  MFQVMNGAIKPAFSTTCPPWL  313

>SPRG_12231
Length=306

 Score = 84.3 bits (207),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 5/98 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKP-KPVQ  59
            MT GVGT  W+APE+L+  RY+  AD+YSFG++LSE+DT  +P+ D++  E   P     
Sbjct  191  MTIGVGTYRWMAPEVLQENRYSVAADVYSFGILLSEVDTHAIPYMDMIQPETGNPLMDTA  250

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            IL  V+ GRL PT S  CP     ++ ++ + C    P
Sbjct  251  ILAQVVQGRLRPTLSPTCP----EDIAALAQRCLAFDP  284

>PHYCA_118938
Length=979

 Score = 85.9 bits (211),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 45/98 (46%), Positives = 57/98 (58%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT +WIAPE+L G+ Y E+ADIYSFGVVLSE+DT   PF +       K +  +I
Sbjct  623  MTVGIGTSFWIAPEVLLGRDYDERADIYSFGVVLSEIDTDDYPFWNAQHPPQGKAEENEI  682

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G   P FSD CP  +       +RS    +PS
Sbjct  683  LRLVARGAKRPAFSDDCPPGILELAARCLRSDPDERPS  720

>PPTG_06258
Length=528

 Score = 85.5 bits (210),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT  VGT  W+APE++ G  Y  +AD+YSFGV+LSELDT  MP+++V    G+KP    I
Sbjct  409  MTNAVGTSLWMAPEVMMGGHYDGKADVYSFGVLLSELDTHFMPYANVRNPSGRKPTEAAI  468

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            L  V  G L   FS  CP  L     ++  +C  ++P
Sbjct  469  LQMVAVGNLQVEFSRDCPVEL----LTLAHACISVEP  501

>PHYCA_129660
Length=289

 Score = 84.0 bits (206),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 62/98 (63%), Gaps = 6/98 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAGVGT  W+APEI+ G++Y E+AD++SF VVLSELD+  +P++ +   +  +   V I
Sbjct  176  MTAGVGTSLWMAPEIMAGEKYDEKADMFSFAVVLSELDSHVLPYTKL--RQETRASDVAI  233

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  VL G+    FSD CPS    ++ ++  +C    P+
Sbjct  234  LQLVLQGKTQIDFSDACPS----SIAALGMACAAKDPT  267

>PPTG_14140
Length=477

 Score = 85.5 bits (210),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 0/75 (0%)

Query  7    TPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQILHWVLD  66
            TP+W APE+L G   + +ADIYS GVV++ELDT + PFS  +TA G +  P+Q+L  ++ 
Sbjct  365  TPFWTAPEVLAGGAPSRKADIYSLGVVIAELDTHRSPFSSALTARGSRMPPLQVLQHIVS  424

Query  67   GRLSPTFSDKCPSRL  81
            G L P  S  CPS +
Sbjct  425  GHLKPNLSPTCPSEI  439

>PHYKE_5057
Length=357

 Score = 84.7 bits (208),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKP-VQ  59
            +TAGVGT  W APE++ G  Y+EQAD+YSFGVVLSELDT ++PF +  +  G    P + 
Sbjct  240  LTAGVGTVRWTAPEVMLGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAAGAPDMA  299

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            I+  V  G L P+F+  CP  + R    + R+C +  P+
Sbjct  300  IVIKVAKGELRPSFAPDCPDVILR----IARACLQFDPA  334

>PHYCA_507990
Length=235

 Score = 83.2 bits (204),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGK-RYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQ  59
            MT  +GT  WIAPE+L G  +Y+   D+YSFGV+LSELD+ ++PFS++  + G+      
Sbjct  70   MTRSIGTSRWIAPEVLSGDAQYSTAVDMYSFGVILSELDSHELPFSEITLSNGQPLPESA  129

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +L  +  G ++P  SD+CP    R V  ++  C  L+P+
Sbjct  130  VLELLRTGAINPALSDRCP----RGVAMLMMECLTLEPT  164

>PHYCA_105269
Length=652

 Score = 85.5 bits (210),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT GVGT  W APEIL G+ Y+E+AD+YS+ +VLSELDTC  P++       +    +Q+
Sbjct  532  MTNGVGTLLWTAPEILRGEAYSEKADVYSYAIVLSELDTCLPPYTLNTEVSERNFTTMQL  591

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            +H    G++SP   D CP+ L++    +  +C    P+
Sbjct  592  IHLATSGQVSPKLRDDCPAPLQQ----LTTACASFDPT  625

>PHALS_07056
Length=1216

 Score = 85.5 bits (210),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 4/98 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT +WIAPE+L G+ Y E+ADIYSFGVVLSE+DT   P+ +       K +  +I
Sbjct  898  MTVGIGTSFWIAPEVLLGRDYDERADIYSFGVVLSEIDTDDYPYWNAQNPPQGKAQENEI  957

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G   P+FS+ CP    R +  +   C R  P+
Sbjct  958  LRLVARGVKRPSFSENCP----REIHELATRCLRADPA  991

>PITG_00643
Length=896

 Score = 85.5 bits (210),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 43/98 (44%), Positives = 57/98 (58%), Gaps = 0/98 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MT G+GT +WIAPE+L G+ Y E+ADIYSFGVVLSE+DT   P+ +       K +  +I
Sbjct  575  MTVGIGTSFWIAPEVLLGRDYDERADIYSFGVVLSEIDTDDYPYWNAQHPPQGKAQENEI  634

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            L  V  G   P FSD CP  +       +R+    +PS
Sbjct  635  LRLVARGAKRPVFSDDCPPAILELAARCLRADPNERPS  672

>PPTG_11181
Length=359

 Score = 84.7 bits (208),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKP-VQ  59
            +TAGVGT  W APE++ G  Y+EQAD+YSFGVVLSELDT ++PF +  +  G    P + 
Sbjct  242  LTAGVGTVRWTAPEVMLGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAGGAPDMA  301

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            I+  V  G L P+F+  CP  + R    + R+C +  P+
Sbjct  302  IVIKVAKGELRPSFAPDCPDVILR----IARACLQFDPA  336

>HYAP_08539
Length=620

 Score = 85.5 bits (210),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 60/100 (60%), Gaps = 6/100 (6%)

Query  1    MTAGVGTPYWIAPEILEGKR-YTEQADIYSFGVVLSELDTCKMPFSDVVT-AEGKKPKPV  58
            MTAGVGT  W+APEI+ G R YTE  DIYSFGV+LSELDT ++PFS   +   G     +
Sbjct  506  MTAGVGTTRWLAPEIVRGDREYTEAVDIYSFGVILSELDTHELPFSSAKSRGTGAPLNDM  565

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
             IL  +  G+L  + S  CP    +N+  + R C  L P+
Sbjct  566  TILQGISSGKLQASLSASCP----QNLQELARKCMSLDPA  601

>SDRG_01027
Length=754

 Score = 85.5 bits (210),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 6/99 (6%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKP--KPV  58
            MTA +GT  WIAPE+L+G RY+E+ADIYSFGV+LSELDT ++P+S V    G        
Sbjct  636  MTAEIGTAAWIAPEVLKGIRYSEKADIYSFGVLLSELDTAEVPYSHVYLEPGSTITLART  695

Query  59   QILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +I   V++G ++P F+ +CPS     +  + R C    P
Sbjct  696  RIAMMVVNGEIAPRFTLQCPS----GIYEIARQCLSYNP  730

>PHYRA_74873
Length=363

 Score = 84.7 bits (208),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 5/99 (5%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKP-VQ  59
            +TAGVGT  W APE++ G  Y+EQAD+YSFGVVLSELDT ++PF +  +  G    P + 
Sbjct  246  LTAGVGTVRWTAPEVMLGDNYSEQADVYSFGVVLSELDTREIPFEEKSSKTGAAGAPDMA  305

Query  60   ILHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQPS  98
            I+  V  G L P+F+  CP  + R    + R+C +  P+
Sbjct  306  IVIKVAKGELRPSFAPDCPDVILR----IARACLQFDPA  340

>SDRG_00885
Length=517

 Score = 85.5 bits (210),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 0/78 (0%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   Y E AD++SFGV+LSEL T ++P+S+ V   G+      I
Sbjct  399  MTAGIGTYRWMAPEVLQDGHYAESADMFSFGVILSELSTHQLPYSNYVNGSGRPYTDTAI  458

Query  61   LHWVLDGRLSPTFSDKCP  78
            +  V+ G   PTF+D CP
Sbjct  459  MARVMMGDFQPTFADDCP  476

>H310_07796
Length=489

 Score = 85.1 bits (209),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 59/97 (61%), Gaps = 4/97 (4%)

Query  1    MTAGVGTPYWIAPEILEGKRYTEQADIYSFGVVLSELDTCKMPFSDVVTAEGKKPKPVQI  60
            MTAG+GT  W+APE+L+   YTE  D++SFGV+LSELDT  +P+SD+   +G       I
Sbjct  377  MTAGIGTYRWMAPEVLQDGHYTELTDLFSFGVILSELDTEILPYSDLRNDKGNPLTDTAI  436

Query  61   LHWVLDGRLSPTFSDKCPSRLERNVCSMIRSCGRLQP  97
            +  V+ G L P F+ +CP        ++ R+C  L P
Sbjct  437  MAKVMSGELRPQFTSQCPEWF----VTLGRNCTALHP  469

Lambda      K        H        a         alpha
   0.320    0.136    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3415733190

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40