Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PITG_0000221091095777e-78
PITG_1758114075182894727e-61
PHYCA_108925140751391043899e-49
PPTG_0681714075362963877e-46
PHYSO_48527557265188802713e-30
PHYSO_44725514075184912695e-30
PHYSO_31923749789154742344e-25
PPTG_2202126660509831826e-16
PPTG_0985716440446501817e-16
PITG_059495035562911669e-14
PPTG_1297422374255901639e-14
PPTG_018545035553881651e-13
PHYSO_38357154256135901543e-13
PHYCA_11616942017100711514e-13
PHYCA_12379042632131811516e-13
PITG_1997215738433911571e-12
PHYSO_5169427569357871553e-12
PITG_091237569915911553e-12
PHYSO_49666110385211901496e-12
PHYCA_12327742576195761471e-11
PITG_1278010385282761482e-11
PYIW_23936164132505841492e-11
PITG_1277310379293761482e-11
PPTG_1297122371305921454e-11
PHYSO_44481415738297901437e-11
PHYCA_11129941545195741401e-10
PHYCA_13041843252484801421e-10
PHYSO_42092255337210891382e-10
PHYSO_44022055744149671362e-10
PHYSO_30138148627378701368e-10
PHYCA_13255350354541021333e-09
PHYSO_34000837183484891324e-09
PPTG_21307260131687881324e-09
PHYCA_4930610385224671279e-09
PHYSO_25309846183558681183e-07
PHYCA_12991643181339881174e-07
PHYSO_55831560848236641155e-07
PHYSO_29338347867385871148e-07
PHYSO_51774559361257871085e-06
PPTG_072052030710847820.007
PHALS_025821606675141760.11
SDRG_06163351085230644.9
PYAR_187191517057382645.1
PITG_210411644047412645.3
PYAR_13274574113446636.3
PYAP_135549693238259628.8
SDRG_0765116221110282629.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PITG_00002

Length=109
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PITG_00002                                                            226        7e-78
PITG_17581                                                            186        7e-61
PHYCA_108925                                                          154        9e-49
PPTG_06817                                                            153        7e-46
PHYSO_485275                                                          108        3e-30
PHYSO_447255                                                          108        5e-30
PHYSO_319237                                                          94.7       4e-25
PPTG_22021                                                            74.7       6e-16
PPTG_09857                                                            74.3       7e-16
PITG_05949                                                            68.6       9e-14
PPTG_12974                                                            67.4       9e-14
PPTG_01854                                                            68.2       1e-13
PHYSO_383571                                                          63.9       3e-13
PHYCA_116169                                                          62.8       4e-13
PHYCA_123790                                                          62.8       6e-13
PITG_19972                                                            65.1       1e-12
PHYSO_516942                                                          64.3       3e-12
PITG_09123                                                            64.3       3e-12
PHYSO_496661                                                          62.0       6e-12
PHYCA_123277                                                          61.2       1e-11
PITG_12780                                                            61.6       2e-11
PYIW_23936                                                            62.0       2e-11
PITG_12773                                                            61.6       2e-11
PPTG_12971                                                            60.5       4e-11
PHYSO_444814                                                          59.7       7e-11
PHYCA_111299                                                          58.5       1e-10
PHYCA_130418                                                          59.3       1e-10
PHYSO_420922                                                          57.8       2e-10
PHYSO_440220                                                          57.0       2e-10
PHYSO_301381                                                          57.0       8e-10
PHYCA_132553                                                          55.8       3e-09
PHYSO_340008                                                          55.5       4e-09
PPTG_21307                                                            55.5       4e-09
PHYCA_49306                                                           53.5       9e-09
PHYSO_253098                                                          50.1       3e-07
PHYCA_129916                                                          49.7       4e-07
PHYSO_558315                                                          48.9       5e-07
PHYSO_293383                                                          48.5       8e-07
PHYSO_517745                                                          46.2       5e-06
PPTG_07205                                                            36.2       0.007
PHALS_02582                                                           33.9       0.11 
SDRG_06163                                                            29.3       4.9  
PYAR_18719                                                            29.3       5.1  
PITG_21041                                                            29.3       5.3  
PYAR_13274                                                            28.9       6.3  
PYAP_13554                                                            28.5       8.8  
SDRG_07651                                                            28.5       9.7  

>PITG_00002
Length=109

 Score = 226 bits (577),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%), Gaps = 0/109 (0%)

Query  1    MHRSGSARKAQGLGLRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMP  60
            MHRSGSARKAQGLGLRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMP
Sbjct  1    MHRSGSARKAQGLGLRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMP  60

Query  61   AKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPLCILS  109
            AKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPLCILS
Sbjct  61   AKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPLCILS  109

>PITG_17581
Length=182

 Score = 186 bits (472),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)

Query  17   ESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNG  76
            +SLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNG
Sbjct  81   DSLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNG  140

Query  77   IGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            IGQSARRNTGIVLKKRLMNPVDESQMVP+
Sbjct  141  IGQSARRNTGIVLKKRLMNPVDESQMVPV  169

>PHYCA_108925
Length=139

 Score = 154 bits (389),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 88/104 (85%), Gaps = 4/104 (4%)

Query  5    GSARKAQGLGLRE---SLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPA  61
            GSA K QGLGLR    SLQ TF DGTSDL F +EELQDL  ET ALRPCYLRGTTDVMPA
Sbjct  10   GSAGKVQGLGLRGGGRSLQVTFEDGTSDLPFGTEELQDLAPETDALRPCYLRGTTDVMPA  69

Query  62   KMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            ++RALHIAAHGHFNGIGQ ARRNT IVLKK LMNPVDESQMVP+
Sbjct  70   EIRALHIAAHGHFNGIGQPARRNT-IVLKKHLMNPVDESQMVPV  112

>PPTG_06817
Length=362

 Score = 153 bits (387),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 78/96 (81%), Gaps = 0/96 (0%)

Query  13   LGLRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHG  72
            LG    LQ TFAD T DLAF SEE QDL LETYALRPCYLRGTTDVMPA+MRALH AAH 
Sbjct  107  LGKSGVLQVTFADATRDLAFGSEEFQDLALETYALRPCYLRGTTDVMPAEMRALHNAAHD  166

Query  73   HFNGIGQSARRNTGIVLKKRLMNPVDESQMVPLCIL  108
            HFNG+GQSARR+T  VLKK  MNPVDESQMVP+  L
Sbjct  167  HFNGVGQSARRSTATVLKKISMNPVDESQMVPVYNL  202

>PHYSO_485275
Length=188

 Score = 108 bits (271),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 59/80 (74%), Gaps = 0/80 (0%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            LQ TF DGTS+L +  EE QDLVLETYALRPC  R   DVMPA+MRA+H A H HFNGIG
Sbjct  83   LQVTFVDGTSELPYGKEEQQDLVLETYALRPCSGRSVADVMPAEMRAIHNAVHDHFNGIG  142

Query  79   QSARRNTGIVLKKRLMNPVD  98
            Q ARR++  VL+K  M  +D
Sbjct  143  QPARRSSSTVLRKVDMAEID  162

>PHYSO_447255
Length=184

 Score = 108 bits (269),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            L  TF   T D  F  EEL DL LETYALRPC+  G  DVMPA+M+++H A H HFNG G
Sbjct  85   LHVTFTTETCDDPFVMEELHDLPLETYALRPCFQIGVADVMPAEMKSIHTAVHAHFNGSG  144

Query  79   QSARRNTGIVLKKRLMNPVDESQMVPLCILS  109
            Q+ARR++  +L+K  MN ++ESQ+VPL  L+
Sbjct  145  QTARRSSATILRKVSMNLINESQVVPLFNLA  175

>PHYSO_319237
Length=154

 Score = 94.7 bits (234),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 53/74 (72%), Gaps = 0/74 (0%)

Query  18   SLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGI  77
            +LQ TF + T +L +   E+QDL LETYALRPC+LR   + MP +MRALH     HFNGI
Sbjct  76   TLQVTFNNETLELEYREGEIQDLALETYALRPCWLRSVMETMPGEMRALHDTVQDHFNGI  135

Query  78   GQSARRNTGIVLKK  91
            GQ+ARR++  VLKK
Sbjct  136  GQAARRSSATVLKK  149

>PPTG_22021
Length=509

 Score = 74.7 bits (182),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 0/83 (0%)

Query  23   FADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSAR  82
            F D +  + F+  ELQDL + +YALRPC+     DVM A+MR  ++ A  +F G G  A 
Sbjct  118  FGDESDSVPFNPNELQDLAVPSYALRPCHRAPVADVMGAEMRQRYLVALNNFAGSGSRAS  177

Query  83   RNTGIVLKKRLMNPVDESQMVPL  105
            RN+  +L+K     +DESQ++PL
Sbjct  178  RNSSSILRKIDAPDIDESQLIPL  200

>PPTG_09857
Length=446

 Score = 74.3 bits (181),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)

Query  59   MPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPLCIL  108
            MPA++RALH AAH HFNG+GQ  RR+T  VLKK  MNPVDESQM P+  L
Sbjct  1    MPAEIRALHNAAHDHFNGVGQPVRRSTATVLKKISMNPVDESQMAPVYNL  50

>PITG_05949
Length=562

 Score = 68.6 bits (166),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 0/91 (0%)

Query  15   LRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHF  74
            LR +L   F      +A     +QD+ +E Y LRPC  RG   +MP +++  H   +  F
Sbjct  167  LRGTLDVNFDGVELQVAHKPNSIQDVAVEIYVLRPCGGRGVGLIMPLELKQRHEKIYNKF  226

Query  75   NGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            NG+GQ A R++  +L +    P+DES++VPL
Sbjct  227  NGVGQPAVRDSTALLAEVGSTPIDESKLVPL  257

>PPTG_12974
Length=255

 Score = 67.4 bits (163),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 28/90 (31%)

Query  16   RESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFN  75
            R +LQ TF+DGTS+L F  +E+QD  LETY LRPC                         
Sbjct  87   RGTLQFTFSDGTSELDFREDEIQDFALETYGLRPC-------------------------  121

Query  76   GIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
               Q+AR ++  VLKK  M PVDESQ +PL
Sbjct  122  ---QAARTSSAKVLKKLSMTPVDESQDIPL  148

>PPTG_01854
Length=553

 Score = 68.2 bits (165),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 0/88 (0%)

Query  18   SLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGI  77
            ++   F D T  + + ++ LQD+ +E YALRPC   GT+ VMP +++ +H   +  FNG 
Sbjct  113  TVDVNFGDSTETVPYQADNLQDVSVEIYALRPCASCGTSAVMPRELKQIHEKVYKKFNGA  172

Query  78   GQSARRNTGIVLKKRLMNPVDESQMVPL  105
             Q A RN   ++    + PV E+ ++P+
Sbjct  173  DQIAVRNVDELVVDARVKPVSEAAILPI  200

>PHYSO_383571
Length=135

 Score = 63.9 bits (154),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 0/90 (0%)

Query  16   RESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFN  75
            R  L    + G  D A++ E LQDL +E YA+R C  + T   MPA+MRA+H AA+  F+
Sbjct  38   RCVLHVASSAGNFDFAYNKELLQDLAVEPYAMRLCEGQSTLSSMPAEMRAIHEAAYSAFH  97

Query  76   GIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
              G+ A R+   V  K  +  V+E+ +VP+
Sbjct  98   ARGRGALRSLEAVCNKIGVAAVEETGVVPV  127

>PHYCA_116169
Length=100

 Score = 62.8 bits (151),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (61%), Gaps = 0/71 (0%)

Query  35   EELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLM  94
            + LQDL +  YALRPC L GT+ +MP + + +H   + +FNG  Q A RN   ++    M
Sbjct  1    DNLQDLSVGIYALRPCALCGTSAIMPREQKQIHEKVYKYFNGTDQVAVRNVHDLVVDSRM  60

Query  95   NPVDESQMVPL  105
             P+DE  ++P+
Sbjct  61   EPIDEPAVLPI  71

>PHYCA_123790
Length=131

 Score = 62.8 bits (151),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 0/81 (0%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            L   F   T ++ +     + L +E YAL PC+    + VMP +MRA+H++   HFNG G
Sbjct  50   LSVIFGKETLEIPYDEGAFEVLDVEAYALHPCFHLAVSHVMPREMRAMHVSVTNHFNGRG  109

Query  79   QSARRNTGIVLKKRLMNPVDE  99
            ++A RN+ ++ +      +DE
Sbjct  110  RNATRNSKVIFRGVAQEALDE  130

>PITG_19972
Length=433

 Score = 65.1 bits (157),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 0/91 (0%)

Query  15   LRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHF  74
            LR +L   F      +A     +QD+ +E Y LRPC  RG   +MP +++  H   +  F
Sbjct  169  LRGTLDVNFDGVELQVAHKPNSIQDVAVEIYVLRPCGGRGVGLIMPLELKQRHEKIYNKF  228

Query  75   NGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            +G+GQ A R++  +L +    P+DES++VPL
Sbjct  229  SGVGQLAVRDSTALLAEVGSTPIDESKLVPL  259

>PHYSO_516942
Length=357

 Score = 64.3 bits (155),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 50/87 (57%), Gaps = 0/87 (0%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            L   F    + L F S+  QD+ +E YAL+PC  + T+ VM  +MR +H   +  FNGI 
Sbjct  112  LDVNFRGAETSLKFVSDTTQDVAVEIYALQPCAGQSTSFVMAREMRQIHDKVYNKFNGID  171

Query  79   QSARRNTGIVLKKRLMNPVDESQMVPL  105
            Q A R+   +L+    + +DE+Q++PL
Sbjct  172  QPAIRDATQLLEGVRSDELDEAQILPL  198

>PITG_09123
Length=915

 Score = 64.3 bits (155),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (55%), Gaps = 0/91 (0%)

Query  15   LRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHF  74
            LR +L   F      +A     +QD+ +E Y LRPC  RG   +MP +++  H   +  F
Sbjct  566  LRGTLDVNFDGVELQVAHKPNSIQDVAVEIYVLRPCGGRGVGLIMPLELKQRHEKIYNKF  625

Query  75   NGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            NG+GQ A R++  +L +     +DES++VPL
Sbjct  626  NGVGQPAVRDSTALLAEVGSTSIDESKLVPL  656

>PHYSO_496661
Length=211

 Score = 62.0 bits (149),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 1/90 (1%)

Query  16   RESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFN  75
            R SL   F +GT  +A     + D+V+E YALRPC  +  +  MP ++R  H   +  FN
Sbjct  63   RGSLDVNF-NGTVVIAHEPIAVLDVVVEIYALRPCMGKSVSLSMPQELRQKHEQVYNKFN  121

Query  76   GIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            G+GQ A R +  +L++     +DE+Q++PL
Sbjct  122  GVGQVAVRESTPILEEVGAKRLDETQLLPL  151

>PHYCA_123277
Length=195

 Score = 61.2 bits (147),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 46/76 (61%), Gaps = 0/76 (0%)

Query  34   SEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRL  93
            S+  QD+ +E YALRPC  RG + +MP +++ +H   +  FNGI Q+A R+   +     
Sbjct  65   SDSFQDIPVEIYALRPCAQRGASAIMPGELKRIHQEMYQKFNGIDQAAVRDVNELTTDAR  124

Query  94   MNPVDESQMVPLCILS  109
             + VDE+ ++P+  +S
Sbjct  125  TSGVDEATVLPIFDVS  140

>PITG_12780
Length=282

 Score = 61.6 bits (148),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)

Query  30   LAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVL  89
            +A     +QD+ +E Y LRPC  RG   +MP +++  H   +  FNG+GQ A R++  +L
Sbjct  112  VAHKPNSIQDVAVEIYVLRPCGGRGVGLIMPLELKQRHEKIYNKFNGVGQPAVRDSTALL  171

Query  90   KKRLMNPVDESQMVPL  105
             +     +DES++VPL
Sbjct  172  AEVGSTSIDESKLVPL  187

>PYIW_23936
Length=505

 Score = 62.0 bits (149),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 0/84 (0%)

Query  22   TFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSA  81
            TF  G SD+A+    LQDL +ETYA++ C  R  T +MPA+M+  H  A   FN  G+  
Sbjct  31   TFEAGMSDIAYDEAYLQDLAVETYAMQLCKDRPVTLMMPAQMKDTHERAFSIFNTRGKRG  90

Query  82   RRNTGIVLKKRLMNPVDESQMVPL  105
             R+ G +  K  +   DE   VPL
Sbjct  91   VRDLGAICTKLKLPDRDEGGYVPL  114

>PITG_12773
Length=293

 Score = 61.6 bits (148),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 0/76 (0%)

Query  30   LAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVL  89
            +A     +QD+ +E Y LRPC  RG   +MP +++  H   +  FNG+GQ A R++  +L
Sbjct  123  VAHKPNSIQDVAVEIYVLRPCGGRGVGLIMPLELKQRHEKIYNKFNGVGQPAVRDSTALL  182

Query  90   KKRLMNPVDESQMVPL  105
             +     +DES++VPL
Sbjct  183  AEVGSTSIDESKLVPL  198

>PPTG_12971
Length=305

 Score = 60.5 bits (145),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 55/92 (60%), Gaps = 5/92 (5%)

Query  17   ESLQA--TFA-DGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGH  73
            E+LQ   TFA +G   L   ++ LQD+ +E YALRPC   GT+ VMP +++ +H   +  
Sbjct  69   EALQGPGTFATEGRQSLG--ADNLQDVSVEIYALRPCASCGTSAVMPRELKQIHEKVYKK  126

Query  74   FNGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            FNG  Q A RN   ++    + PV+E+ ++P+
Sbjct  127  FNGADQIALRNVDELVVDARVKPVNEAVILPI  158

>PHYSO_444814
Length=297

 Score = 59.7 bits (143),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 0/90 (0%)

Query  16   RESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFN  75
            R SL   F      +A     + D+ +E YALRPC  +  + +MP ++R  H   +  FN
Sbjct  109  RGSLDVNFNGTVVVIAHEPIAVLDVAVEIYALRPCMGKSVSLIMPQELRQKHEQVYNKFN  168

Query  76   GIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            G+GQ A R +  +L++     +DE+Q++PL
Sbjct  169  GVGQVAVRESTPILEEVGAKHLDETQLLPL  198

>PHYCA_111299
Length=195

 Score = 58.5 bits (140),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 2/74 (3%)

Query  4    SGSARKAQGLGLRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKM  63
            +G  R  Q L  +  L   F D +S ++F+  ELQDL + +Y LRPC+     DVMP +M
Sbjct  37   TGYTRVQQKLTGK--LFVCFGDESSSVSFNPAELQDLPVPSYTLRPCFGAPVADVMPMEM  94

Query  64   RALHIAAHGHFNGI  77
            R  H  A  HFN I
Sbjct  95   RKRHSDALNHFNVI  108

>PHYCA_130418
Length=484

 Score = 59.3 bits (142),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 0/80 (0%)

Query  26   GTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNT  85
            G  +  +  E LQDL  ETYA+R C  + +  +M A+MRA+H AA   F+  G++A R+ 
Sbjct  118  GNFEFPYDEELLQDLAAETYAMRLCEGQSSLSLMAAEMRAVHEAAFEAFHAGGRAASRSV  177

Query  86   GIVLKKRLMNPVDESQMVPL  105
              + +K  ++PV E+  VPL
Sbjct  178  EAICRKIGVDPVPETGAVPL  197

>PHYSO_420922
Length=210

 Score = 57.8 bits (138),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 49/89 (55%), Gaps = 0/89 (0%)

Query  17   ESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNG  76
            E LQ       + + + S   QD+ +E YAL+PC  + T+ VM  +M+ +H   +  FNG
Sbjct  53   ELLQEELTPRATSVKYVSSTTQDVAVEIYALQPCAGQSTSFVMAGEMKQIHDKVYNKFNG  112

Query  77   IGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            I Q A R+   +L     + +DE++++PL
Sbjct  113  IDQPAARDATQLLDGIRSDELDETKILPL  141

>PHYSO_440220
Length=149

 Score = 57.0 bits (136),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 0/67 (0%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            L  +F +    + F   E++ L    YAL PC  R   D+MPA+MRA+H AA  HF G+G
Sbjct  83   LHISFGEDVEPVPFKEHEIEALEYAPYALPPCNNRRIIDLMPAEMRAIHAAALNHFKGVG  142

Query  79   QSARRNT  85
              A R +
Sbjct  143  CRATRRS  149

>PHYSO_301381
Length=378

 Score = 57.0 bits (136),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 0/70 (0%)

Query  36   ELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMN  95
            E++ L    Y LRPC  R   D+MPA+MRA+H AA  HF G+G  A R +  +L+K    
Sbjct  117  EIEALEYAPYTLRPCNNRPIIDLMPAEMRAIHAAALNHFKGVGCRATRRSKSILEKLQAP  176

Query  96   PVDESQMVPL  105
             +DE   + L
Sbjct  177  LMDEDSTIVL  186

>PHYCA_132553
Length=454

 Score = 55.8 bits (133),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 8/102 (8%)

Query  12   GLGLRESLQATFADGTSDLAFSSEE--------LQDLVLETYALRPCYLRGTTDVMPAKM  63
            GL +    + T   G  D+ F +EE        L  +  E YALRPC  + T+ VM A+M
Sbjct  65   GLVVGYKWEPTTQRGWLDVNFENEEASVVYAPVLLRMSPEVYALRPCSNQSTSLVMAAEM  124

Query  64   RALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            +  H   +  FNG+ Q+A R++  +L       +DES+++PL
Sbjct  125  KKTHEELYKMFNGLDQTAVRDSKTLLTAVKGKTIDESKVIPL  166

>PHYSO_340008
Length=3484

 Score = 55.5 bits (132),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 47/89 (53%), Gaps = 0/89 (0%)

Query  16    RESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFN  75
             R SL   F      +A     + D+ +E YALRPC  +  + +MP ++R  H      FN
Sbjct  3356  RGSLDVNFNGTVVVIAHEPIAVLDVAVEIYALRPCMGKSVSLIMPQELRLKHEQVCNKFN  3415

Query  76    GIGQSARRNTGIVLKKRLMNPVDESQMVP  104
             G+GQ A R +  +L++     +DE+Q++P
Sbjct  3416  GVGQVAVRESTPILEEVGAKRLDETQLLP  3444

>PPTG_21307
Length=1687

 Score = 55.5 bits (132),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 0/88 (0%)

Query  18   SLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGI  77
            +L  TF   +  + F  + ++ L +  YALRPC       ++   MR  H +   HF G 
Sbjct  129  TLHITFRSESESIPFREDAIEVLPIPIYALRPCLGIPVLTLIETDMRNRHASVLNHFMGT  188

Query  78   GQSARRNTGIVLKKRLMNPVDESQMVPL  105
            G  A RN+  +L+K    PV+E+Q +PL
Sbjct  189  GCRATRNSSNILRKVGAVPVEEAQHIPL  216

>PHYCA_49306
Length=224

 Score = 53.5 bits (127),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 0/67 (0%)

Query  43   ETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQM  102
            E YALRPC  + T+ VM A+M+ +H   +  FNG+ Q+A R++  +L       +DES++
Sbjct  91   EVYALRPCSNQSTSLVMAAEMKKMHEELYKMFNGLDQTAVRDSKTLLTAVKGKAIDESKV  150

Query  103  VPLCILS  109
            +PL  ++
Sbjct  151  IPLLDIT  157

>PHYSO_253098
Length=558

 Score = 50.1 bits (118),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 0/68 (0%)

Query  42   LETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQ  101
            +ETYA+R C  + T   MPA+MRA+H AA+  F+  G+ A R+   +  K  +  V+E+ 
Sbjct  74   VETYAMRLCEGQSTLSTMPAEMRAIHEAAYSAFHARGRGALRSLEAICNKIGVAAVEETG  133

Query  102  MVPLCILS  109
            +VP+  +S
Sbjct  134  VVPVFDIS  141

>PHYCA_129916
Length=339

 Score = 49.7 bits (117),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/88 (31%), Positives = 41/88 (47%), Gaps = 16/88 (18%)

Query  18   SLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGI  77
            ++   F D T  + + +  LQDL  E YALRPC L                  +  FNG 
Sbjct  113  TVDVNFGDTTESVPYQAGNLQDLSAEIYALRPCAL----------------CVYKKFNGT  156

Query  78   GQSARRNTGIVLKKRLMNPVDESQMVPL  105
             Q+A R+   ++    M P+DES ++P+
Sbjct  157  DQAAVRSVHDLVVDSRMKPIDESAVLPI  184

>PHYSO_558315
Length=236

 Score = 48.9 bits (115),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 0/64 (0%)

Query  46   ALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            ++R C  + T  VMPA+MR++H  A+  F+G G+SA R    +  K  +  VDES +VPL
Sbjct  80   SMRLCEGKPTLSVMPAEMRSIHEVAYKLFHGRGRSAVRAVTTICNKLEIENVDESGVVPL  139

Query  106  CILS  109
              +S
Sbjct  140  FDIS  143

>PHYSO_293383
Length=385

 Score = 48.5 bits (114),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            L   F DG +D+ F    L DL  ET ALRP         +P  + A     + +FNGIG
Sbjct  114  LHLVFCDGGADIPFDERMLLDLAPETNALRP---------VPVVLEA-----YKYFNGIG  159

Query  79   QSARRNTGIVLKKRLMNPVDESQMVPL  105
            + + R +  +L       VDES  +PL
Sbjct  160  RRSSRKSATILSSLHYPAVDESSHIPL  186

>PHYSO_517745
Length=257

 Score = 46.2 bits (108),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIG  78
            L   F    + L F S+  QD+ +E YA           VM  +MR +H   +  FNGI 
Sbjct  112  LDVNFRGVETSLKFVSDTTQDVAVEIYAF----------VMAGEMRQIHDKVYNKFNGID  161

Query  79   QSARRNTGIVLKKRLMNPVDESQMVPL  105
            Q A R+   +L+    + +DE++++PL
Sbjct  162  QPAIRDATQLLEGVRSDELDEARILPL  188

>PPTG_07205
Length=108

 Score = 36.2 bits (82),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 28/47 (60%), Gaps = 0/47 (0%)

Query  59   MPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPL  105
            M A+M+      +  FNGI  +A R++ ++L +     +DES+++PL
Sbjct  1    MAAEMKKTREILYKQFNGIDLNAIRDSTVLLTEVKETAIDESKIIPL  47

>PHALS_02582
Length=751

 Score = 33.9 bits (76),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  56   TDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNP  96
             DV+P +  A  +A HG F+G+GQ+  +  G    +R   P
Sbjct  62   NDVVPHRQEAFELANHGIFDGLGQNHPQKAGNSYARRQPQP  102

>SDRG_06163
Length=852

 Score = 29.3 bits (64),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  19   LQATFADGTSDLAFSSEELQDLVLETYALR  48
            LQ   AD  + LA    ELQ LVLET A R
Sbjct  566  LQTALADEQARLAAKEAELQKLVLETQATR  595

>PYAR_18719
Length=573

 Score = 29.3 bits (64),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 37/82 (45%), Gaps = 13/82 (16%)

Query  13   LGLRESLQATFADGTSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHG  72
            + L +++ A ++D TSD   ++  L +  L+   L    +   +D  P +          
Sbjct  110  MPLEQAMDALYSDNTSDCRHNAGTLLEGCLDAAVLH--VIHKKSDAQPRR----------  157

Query  73   HFNGIGQSARRNTGIVLKKRLM  94
             + GI   A RNTG+  KKR M
Sbjct  158  -YLGINWIALRNTGVFAKKRDM  178

>PITG_21041
Length=474

 Score = 29.3 bits (64),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)

Query  94   MNPVDESQMVPL  105
            MNPVDESQMVP+
Sbjct  1    MNPVDESQMVPV  12

>PYAR_13274
Length=1134

 Score = 28.9 bits (63),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query  34   SEELQDLVLETYALRPCYLRGTTDVMPAKMRALH-IAAHGHFNGIG  78
            SE L   VL  Y +  C +  T D +      LH +AAHGH  G+G
Sbjct  495  SERLGLQVLNRYCVNECLIESTGDTL------LHLVAAHGHSTGLG  534

>PYAP_13554
Length=382

 Score = 28.5 bits (62),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 30/59 (51%), Gaps = 0/59 (0%)

Query  51   YLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTGIVLKKRLMNPVDESQMVPLCILS  109
            YL+ T D     MR + ++++G F+   + AR  T IV+       ++ +QM P   LS
Sbjct  243  YLKATLDGGFPGMRFVLVSSYGSFDIYSKRARAGTPIVISAANTIGLNATQMNPGLYLS  301

>SDRG_07651
Length=1102

 Score = 28.5 bits (62),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query  27   TSDLAFSSEELQDLVLETYALRPCYLRGTTDVMPAKMRALHIAAHGHFNGIGQSARRNTG  86
            T  LA S +E+ +L   T++ RP Y  G  + +PA    L +A       +   A R   
Sbjct  40   TEWLAISKKEVCELCGYTFSFRPLYADGCPETLPAGELFLSLAIVALKKWL-PLAIRAIL  98

Query  87   IVLKKRLMNPVDESQMVPLCIL  108
            +V+   L+ P   S +  L +L
Sbjct  99   VVIAWALVAPWCTSWLYRLWLL  120

Lambda      K        H        a         alpha
   0.320    0.133    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3310172460

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40