Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_554653102202207344e-98
PPTG_16671102092245007e-63
PHYCA_104436101812194691e-58
PHYRA_78819102002204354e-53
HYAP_01509102082173322e-37
PPTG_07275203391842042929e-32
PITG_0001210185582683e-28
PHALS_10836102042062652e-27
PHYCA_97367203391911032073e-19
PYVX_1586910331941634e-12
CCI42021333887651722.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_554653

Length=221
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_554653                                                          287        4e-98
PPTG_16671                                                            197        7e-63
PHYCA_104436                                                          185        1e-58
PHYRA_78819                                                           172        4e-53
HYAP_01509                                                            132        2e-37
PPTG_07275                                                            117        9e-32
PITG_00012                                                            107        3e-28
PHALS_10836                                                           106        2e-27
PHYCA_97367                                                           84.3       3e-19
PYVX_15869                                                            67.4       4e-12
CCI42021                                                              32.3       2.5  

>PHYSO_554653
Length=220

 Score = 287 bits (734),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 220/220 (100%), Positives = 220/220 (100%), Gaps = 0/220 (0%)

Query  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGs  60
            MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGS
Sbjct  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGS  60

Query  61   nppsrlppsfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEE  120
            NPPSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEE
Sbjct  61   NPPSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEE  120

Query  121  DERQVQFLFYGGSDpptptgggAYPSGYRSDMISKYIQPTEpispasiasprisHEMPCF  180
            DERQVQFLFYGGSDPPTPTGGGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMPCF
Sbjct  121  DERQVQFLFYGGSDPPTPTGGGAYPSGYRSDMISKYIQPTEPISPASIASPRISHEMPCF  180

Query  181  FSPRTTPTSPMSAPIYSPHLFKITEQRTRNAEYYRRYTSR  220
            FSPRTTPTSPMSAPIYSPHLFKITEQRTRNAEYYRRYTSR
Sbjct  181  FSPRTTPTSPMSAPIYSPHLFKITEQRTRNAEYYRRYTSR  220

>PPTG_16671
Length=209

 Score = 197 bits (500),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 155/224 (69%), Gaps = 19/224 (8%)

Query  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGs  60
            MGLS+FF  +WD V  PFEDCTSCCDVLDPDYYRKTSPGVRR+PQMFNRW+HDVK+++  
Sbjct  1    MGLSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITP  60

Query  61   nppsrlppsfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEE  120
            + P    P F+ S V +  H  +T               SSGS S S S SPS+YSYEEE
Sbjct  61   SRPPSSLPPFASSQVGTREHQSKT-------------LSSSGSRSGSNSDSPSNYSYEEE  107

Query  121  DERQVQFLFYGGSDpptptgggA-YPSGYRSDMISKYIQPTEpispasiasprisHEMPC  179
            DERQVQFLFYGGSDPPTPT  G  Y +GYRSDMIS Y++P  P +          HEMPC
Sbjct  108  DERQVQFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRIN--HEMPC  165

Query  180  FFSPRTTPT-SPMSAPIYSPHLFKITEQRT--RNAEYYRRYTSR  220
            FFSPR TP  SPMSAPIYSPHLFKI+EQRT  R+  YY    SR
Sbjct  166  FFSPRDTPLQSPMSAPIYSPHLFKISEQRTSRRSTGYYSMRYSR  209

>PHYCA_104436
Length=181

 Score = 185 bits (469),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 133/219 (61%), Gaps = 45/219 (21%)

Query  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGs  60
            MG+S FFR +WDLVR PFEDCTSCCDVLDPDYYRKTSPGVRR+PQMFNRW+    +DV S
Sbjct  1    MGVSGFFRYIWDLVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWE----YDVQS  56

Query  61   nppsrlppsfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEE  120
               S        S     +++                                   YEEE
Sbjct  57   KTLSSSGSRSGSSANSPLNYS-----------------------------------YEEE  81

Query  121  DERQVQFLFYGGSDpptptgggA-YPSGYRSDMISKYIQPTEpispasiasprisHEMPC  179
            DERQVQFLFYGGSDPPTP   G  + +GYRSDMIS Y++P  P +          HEMPC
Sbjct  82   DERQVQFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRIS--HEMPC  139

Query  180  FFSPRTTPT-SPMSAPIYSPHLFKITEQRT--RNAEYYR  215
            FFSPR TP  SPMSAPIYSPHLFKI EQRT  R+A YYR
Sbjct  140  FFSPRNTPIQSPMSAPIYSPHLFKIAEQRTTRRSAGYYR  178

>PHYRA_78819
Length=200

 Score = 172 bits (435),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 149/220 (68%), Gaps = 23/220 (10%)

Query  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGs  60
            MG+SEFF  +WDL+R PFE+CTSCCDVLDP+YYRKTSPGVRR+PQMFNR++ DVK+D   
Sbjct  1    MGVSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDF--  57

Query  61   nppsrlppsfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEE  120
               S+  P  S  P  S+SHA  TQRS  S  S S S+                   EEE
Sbjct  58   ---SKSRPPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYE-----------EEE  103

Query  121  DERQVQFLFYGGSDpptptgggAYPSGYRSDMISKYIQPTEpispasiasprisHEMPCF  180
            +ER VQFLFYGGSDPPTPT  G  P GYRSDMIS Y++P  P + AS       HEMPCF
Sbjct  104  EERHVQFLFYGGSDPPTPTSAGG-PGGYRSDMISNYVEPISPAAFASPRIN---HEMPCF  159

Query  181  FSPRTTPT-SPMSAPIYSPHLFKITEQRTRN-AEYYRRYT  218
            FSPR TP  SPMSAPIYSPHLFKI EQR R+ A +Y RY+
Sbjct  160  FSPRNTPAQSPMSAPIYSPHLFKIAEQRHRHSAGHYSRYS  199

>HYAP_01509
Length=208

 Score = 132 bits (332),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 121/217 (56%), Gaps = 17/217 (8%)

Query  1    MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGs  60
            MG+SE    +   V  PF DC+SC DVLD  YY KTSPGV  +PQMFNRW++DVK   G 
Sbjct  1    MGVSEVLYAIGHFVCRPFSDCSSCVDVLDRSYYSKTSPGVYASPQMFNRWENDVKH--GY  58

Query  61   nppsrlppsfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEE  120
                 LP      P   +   G T+RS +S +     S S+     S          EEE
Sbjct  59   TRSRPLPSRLPPPPPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFED-------EEE  111

Query  121  DERQVQFLFYGGSD--pptptgggAYPSGYRSDMISKYIQPTEpispasiasprisHEMP  178
             +R+VQFLFYGGSD   PT  GG A  +GYRSDMIS  +  T   SP         HE+P
Sbjct  112  RDRRVQFLFYGGSDPPTPTSRGGLAASTGYRSDMISDAVSLTSIRSPQIN------HEIP  165

Query  179  CFFSPRTTPTSPMSAPIYSPHLFKITEQRTRNAEYYR  215
            CFFSPR TP S +SA +YSPH+FKITEQ+ R     R
Sbjct  166  CFFSPRDTPRSSVSASMYSPHVFKITEQKQRRNARLR  202

>PPTG_07275
Length=184

 Score = 117 bits (292),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 115/204 (56%), Gaps = 35/204 (17%)

Query  10   LWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNR--WDHDVKFDVGsnppsrlp  67
            +WD +R PFEDC S CDVLDP YY KTSPGVRR P  F+R  W++D+K+D   + P    
Sbjct  1    MWDFLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFSLSRPPPSF  60

Query  68   psfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEEDERQVQF  127
             S           +GR Q                    +      +S  +EEE+E+QVQF
Sbjct  61   QSS---------SSGRMQ---------------FTLSRSRSQSRSASVLHEEEEEQQVQF  96

Query  128  LFYGGSDpptptgggAY-PSGYRSDMISKYIQPTEpispasiasprisHEMPCFFSPRTT  186
            LFYGGSD  TP   G    SGYRSD+I   ++            PRISHE+PCFFSPR T
Sbjct  97   LFYGGSDISTPVSVGKLCSSGYRSDVICTPMR-------LVSQPPRISHEIPCFFSPRDT  149

Query  187  PT-SPMSAPIYSPHLFKITEQRTR  209
            P  SPMSAPIYSPHLF+I EQR R
Sbjct  150  PMMSPMSAPIYSPHLFQINEQRWR  173

>PITG_00012
Length=185

 Score = 107 bits (268),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 0/58 (0%)

Query  1   MGLSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDV  58
           MGLSEFF  +WD V  PFEDCTSCCDVLDPDYYRKTSPGV R+PQMFNRW+H VK+++
Sbjct  1   MGLSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNI  58

 Score = 95.5 bits (236),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 72/103 (70%), Gaps = 7/103 (7%)

Query  123  RQVQFLFYGGSDpptptggg-AYPSG-YRSDMISKYIQPTEpispasiasprisHEMPCF  180
            RQVQFLFYGGSDPPTPT  G  YPSG YRSDMIS Y++P  P +          HEMPCF
Sbjct  85   RQVQFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRIS--HEMPCF  142

Query  181  FSPRTTPT-SPMSAPIYSPHLFKITEQRT--RNAEYYRRYTSR  220
            FSPR TP  SPMSAPIYSPHLFKI+EQR   R+  YY    SR
Sbjct  143  FSPRNTPLQSPMSAPIYSPHLFKISEQRMSRRSTGYYNMRYSR  185

>PHALS_10836
Length=204

 Score = 106 bits (265),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 109/206 (53%), Gaps = 18/206 (9%)

Query  3    LSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGsnp  62
            +S F R LWDLV  PFE C +CCDVLDP YYRK SPG RR PQMFN WD+    D  +  
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDN----DKNTLT  56

Query  63   psrlppsfsfspvisssHAGRTQRsftspaslsgsspssgsgsasrsqspssysYEEEDE  122
            PS    SF      +  ++ R           +     S S S S S +PS  ++EEE E
Sbjct  57   PSYPTSSFPTLSSSNLEYSCRAN--------DNKFITLSTSRSRSVSSTPSESAHEEEGE  108

Query  123  RQVQFLFYGGSDpptptgggAYPSGYRSDMISKYIQPTEpispasiasprisHEMPCFFS  182
             Q+ FLFYGGSD        A    YR D+IS   +PT      SI SPRI H+MPCFFS
Sbjct  109  NQLHFLFYGGSD---SLSPKAVGKRYRRDIISDCQEPTS--PVVSIESPRIDHKMPCFFS  163

Query  183  PRTTPTS-PMSAPIYSPHLFKITEQR  207
                P   PMS  IYS +L    +Q+
Sbjct  164  STIAPLQFPMSDSIYSANLLGDIDQQ  189

>PHYCA_97367
Length=191

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 68/103 (66%), Gaps = 13/103 (13%)

Query  119  EEDERQVQFLFYGGSDpptptgggAYPSGYRSDMISKYIQPTEpispasiasprisHEMP  178
            EEDE Q+QFLFY GSD  T     +  SGYRSD IS+ +QP           PR+SHE+P
Sbjct  97   EEDE-QIQFLFYSGSDISTSDRLCS--SGYRSDAISRPLQPI-------TEPPRLSHEIP  146

Query  179  CFFSPRTTP-TSPMSAPIYSPHLFKITEQRTRNAEYYRRYTSR  220
            CFFSPR  P  +PMSAPIYSPHLF I+EQR R+    R Y++R
Sbjct  147  CFFSPRDAPLMAPMSAPIYSPHLFMISEQRGRSPS--RHYSNR  187

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 6/63 (10%)

Query  1   MGLSEFFRDLWDLVRSPFEDCTSCC----DVLDPDYYRKTSPGVRRTPQMFN--RWDHDV  54
           MG+S+FF+D+WD V  PFEDC SC     +VLDP YY KTSPGVRRTP  F+  RWD+D+
Sbjct  1   MGVSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDL  60

Query  55  KFD  57
           K+D
Sbjct  61  KYD  63

>PYVX_15869
Length=331

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 5/94 (5%)

Query  117  YEEEDERQVQFLFYGGSDppt-ptgggAYPSGYRSDMISKYIQPT---Epispasiaspr  172
            Y++  ++  QFLFY GSDP T  +   A  +G ++D IS Y  PT   EP     +ASPR
Sbjct  228  YDDPYDQPTQFLFYCGSDPLTPTSAQLAARNGLKTDTISGYT-PTAGAEPQVHTPLASPR  286

Query  173  isHEMPCFFSPRTTPTSPMSAPIYSPHLFKITEQ  206
            ISH++P FFSPR  PTSP +AP+YSPHLF+ITE+
Sbjct  287  ISHQIPVFFSPRNAPTSPAAAPLYSPHLFRITER  320

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (53%), Gaps = 0/55 (0%)

Query  3    LSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFD  57
            LS ++      +R PF DC + CD+  P      SPGV   PQ F R D D+K+D
Sbjct  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYD  195

>CCI42021
Length=876

 Score = 32.3 bits (72),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  5    EFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVK  55
            E+ R+  +    PF +    CD++D +Y ++T   V ++P +F   D  VK
Sbjct  116  EYAREGIEWTPIPFFNNKVVCDLMDANYIKQTRQAVAQSPGIFLVLDDTVK  166

Lambda      K        H        a         alpha
   0.325    0.140    0.459    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11011317900

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40