Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_5302544084770703623e-46
PHYSO_3836375425781653122e-38
PHYSO_5495619761361671917e-18
PHYCA_5098209761786671891e-17
HYAP_126609761786671891e-17
PHYKE_108159761786671892e-17
PITG_119139761786671892e-17
PHYRA_781939761786671892e-17
PPTG_031219761786671892e-17
PYVX_181219761633671882e-17
PHALS_020799761786671882e-17
PYAR_1993084937625671873e-17
PYAP_2223884937633671855e-17
H310_10060146805187671761e-16
H257_18082146805187671761e-16
PYU1_G00154084937633671812e-16
PYIW_2214484937633671812e-16
PYIR_2438784937633671812e-16
CCI460919761787671751e-15
CCA208289761787671751e-15
SDRG_057779761786671715e-15
SPRG_10476127526270671677e-15
H257_188859761786671681e-14
SDRG_05778127526618671627e-14
SPRG_104779761762671627e-14
SDRG_05816127542479671628e-14
SPRG_10519127542782671619e-14
H257_00007127542787671611e-13
H310_14759127542787671601e-13
CCA149671520391431671204e-08
PYIW_26567165855564671196e-08
CCA16151152456643671187e-08
PPTG_02120753451001671187e-08
PYVX_2298180377612671188e-08
H257_129589267649671171e-07
CCI43221160520660671171e-07
SPRG_00068122115643671171e-07
PITG_112479265653671161e-07
PITG_112529270654671161e-07
PYIR_1673893996555671161e-07
PYU1_G00409793996663671161e-07
PITG_112499267653671161e-07
PYIR_158599262626671152e-07
PYIR_1585797291577671152e-07
PYIW_1687397291496671152e-07
PYU1_G01392797291649671152e-07
PHYSO_4860859265653671152e-07
PHYSO_48001056986653671152e-07
HYAP_0154075345634671152e-07
PHYKE_70169270650671152e-07
PHYSO_4856149267653671152e-07
PITG_112449262663671152e-07
PHYRA_724639262658671152e-07
PPTG_021229262657671152e-07
PHYCA_1044449270644671152e-07
PYAP_1733497291650671152e-07
PPTG_1969024837566671152e-07
PHYCA_10442940847645671152e-07
PHYCA_53291256986626671152e-07
PHYCA_10433569035656671152e-07
PHYSO_4827939270658671142e-07
PHYCA_1044659267653671142e-07
PYVX_156419262629671142e-07
PHYSO_3447059262798671142e-07
PYAR_1448756986467671143e-07
PHYKE_297775345220671123e-07
CCI40247152456643671133e-07
SDRG_03564478658671133e-07
PYU1_G0139319262663671134e-07
SDRG_11473122115636671124e-07
PYAP_1923599439643671124e-07
CCI402499267660671124e-07
CCA161539267663671124e-07
SPRG_00333478615671124e-07
HYAP_01005478660671124e-07
HYAP_0100493996660671124e-07
PITG_00527478656671124e-07
PHYRA_71042478654671124e-07
PHALS_00833478652671125e-07
PHYKE_7992478657671125e-07
PHYSO_286376478660671125e-07
PHYCA_510696478659671125e-07
PPTG_08245478658671125e-07
PYVX_16738478658671116e-07
PYIR_16737478511671116e-07
H310_095579267644671117e-07
PYAR_183544781084671117e-07
PYAP_173339262657671109e-07
PYIW_21755478658671109e-07
PYU1_G004098478656671091e-06
PYIW_168769262643671091e-06
HYAP_015379270651671091e-06
PHALS_127909265214561081e-06
PHYRA_4188868719586671091e-06
SPRG_045339267652671091e-06
PHALS_098029270651671091e-06
PHYRA_7241556986655671091e-06
SDRG_118999267652671081e-06
PYAP_13341478657671081e-06
PYIW_1714512728443581081e-06
PHYRA_716559270653671081e-06
H310_09434478658671081e-06
PYAR_1980792621613671081e-06
PHALS_0066729702142571051e-06
CCI4598212728661581082e-06
PYIR_1969712728608581072e-06
H310_02610148347650671072e-06
PHYRA_478659267381671072e-06
PHYRA_4787369035396671072e-06
CCA2151412728659581072e-06
H257_0127712728652581062e-06
PYVX_1505112728632601053e-06
CCA24936478661641054e-06
SPRG_0229412728634581054e-06
PYU1_G00375412728650581054e-06
HYAP_0681812728316601054e-06
SDRG_1104312728649581045e-06
PITG_1578612728633581045e-06
PHYCA_54113412728633581045e-06
PPTG_1827412728648581045e-06
CCI50234478665641046e-06
PHYSO_50048012728633581046e-06
PHALS_0761612728677581037e-06
PHYRA_7112312728633601038e-06
PHYKE_900812728650601038e-06
PYAR_2218812728634581011e-05
H310_0663112728651581011e-05
PYAP_197381272864858993e-05
HYAP_015115698620644958e-05
H257_1677514607929167913e-04
H257_1732214834760643860.001
PHYSO_3428175311818968750.047
PYAR_2214010464635363720.11
PHYSO_3396666941958567670.67
SDRG_10038309756550660.90
PHYCA_1320154341415135650.91
SPRG_15695309758150651.0
PYIW_191653097112449632.1
H310_1254513066343456622.9
SDRG_0649111499261330622.9
H257_07650309756350623.0
H310_12765309756050623.1
PYVX_23790748546138623.1
SPRG_1591411499171030605.3
CCI4519616099313642595.7
SPRG_2072813432543832605.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_530254

Length=71
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_530254                                                          144        3e-46
PHYSO_383637                                                          124        2e-38
PHYSO_549561                                                          78.2       7e-18
PHYCA_509820                                                          77.4       1e-17
HYAP_12660                                                            77.4       1e-17
PHYKE_10815                                                           77.4       2e-17
PITG_11913                                                            77.4       2e-17
PHYRA_78193                                                           77.4       2e-17
PPTG_03121                                                            77.4       2e-17
PYVX_18121                                                            77.0       2e-17
PHALS_02079                                                           77.0       2e-17
PYAR_19930                                                            76.6       3e-17
PYAP_22238                                                            75.9       5e-17
H310_10060                                                            72.4       1e-16
H257_18082                                                            72.4       1e-16
PYU1_G001540                                                          74.3       2e-16
PYIW_22144                                                            74.3       2e-16
PYIR_24387                                                            74.3       2e-16
CCI46091                                                              72.0       1e-15
CCA20828                                                              72.0       1e-15
SDRG_05777                                                            70.5       5e-15
SPRG_10476                                                            68.9       7e-15
H257_18885                                                            69.3       1e-14
SDRG_05778                                                            67.0       7e-14
SPRG_10477                                                            67.0       7e-14
SDRG_05816                                                            67.0       8e-14
SPRG_10519                                                            66.6       9e-14
H257_00007                                                            66.6       1e-13
H310_14759                                                            66.2       1e-13
CCA14967                                                              50.8       4e-08
PYIW_26567                                                            50.4       6e-08
CCA16151                                                              50.1       7e-08
PPTG_02120                                                            50.1       7e-08
PYVX_22981                                                            50.1       8e-08
H257_12958                                                            49.7       1e-07
CCI43221                                                              49.7       1e-07
SPRG_00068                                                            49.7       1e-07
PITG_11247                                                            49.3       1e-07
PITG_11252                                                            49.3       1e-07
PYIR_16738                                                            49.3       1e-07
PYU1_G004097                                                          49.3       1e-07
PITG_11249                                                            49.3       1e-07
PYIR_15859                                                            48.9       2e-07
PYIR_15857                                                            48.9       2e-07
PYIW_16873                                                            48.9       2e-07
PYU1_G013927                                                          48.9       2e-07
PHYSO_486085                                                          48.9       2e-07
PHYSO_480010                                                          48.9       2e-07
HYAP_01540                                                            48.9       2e-07
PHYKE_7016                                                            48.9       2e-07
PHYSO_485614                                                          48.9       2e-07
PITG_11244                                                            48.9       2e-07
PHYRA_72463                                                           48.9       2e-07
PPTG_02122                                                            48.9       2e-07
PHYCA_104444                                                          48.9       2e-07
PYAP_17334                                                            48.9       2e-07
PPTG_19690                                                            48.9       2e-07
PHYCA_104429                                                          48.9       2e-07
PHYCA_532912                                                          48.9       2e-07
PHYCA_104335                                                          48.9       2e-07
PHYSO_482793                                                          48.5       2e-07
PHYCA_104465                                                          48.5       2e-07
PYVX_15641                                                            48.5       2e-07
PHYSO_344705                                                          48.5       2e-07
PYAR_14487                                                            48.5       3e-07
PHYKE_2977                                                            47.8       3e-07
CCI40247                                                              48.1       3e-07
SDRG_03564                                                            48.1       3e-07
PYU1_G013931                                                          48.1       4e-07
SDRG_11473                                                            47.8       4e-07
PYAP_19235                                                            47.8       4e-07
CCI40249                                                              47.8       4e-07
CCA16153                                                              47.8       4e-07
SPRG_00333                                                            47.8       4e-07
HYAP_01005                                                            47.8       4e-07
HYAP_01004                                                            47.8       4e-07
PITG_00527                                                            47.8       4e-07
PHYRA_71042                                                           47.8       4e-07
PHALS_00833                                                           47.8       5e-07
PHYKE_7992                                                            47.8       5e-07
PHYSO_286376                                                          47.8       5e-07
PHYCA_510696                                                          47.8       5e-07
PPTG_08245                                                            47.8       5e-07
PYVX_16738                                                            47.4       6e-07
PYIR_16737                                                            47.4       6e-07
H310_09557                                                            47.4       7e-07
PYAR_18354                                                            47.4       7e-07
PYAP_17333                                                            47.0       9e-07
PYIW_21755                                                            47.0       9e-07
PYU1_G004098                                                          46.6       1e-06
PYIW_16876                                                            46.6       1e-06
HYAP_01537                                                            46.6       1e-06
PHALS_12790                                                           46.2       1e-06
PHYRA_41888                                                           46.6       1e-06
SPRG_04533                                                            46.6       1e-06
PHALS_09802                                                           46.6       1e-06
PHYRA_72415                                                           46.6       1e-06
SDRG_11899                                                            46.2       1e-06
PYAP_13341                                                            46.2       1e-06
PYIW_17145                                                            46.2       1e-06
PHYRA_71655                                                           46.2       1e-06
H310_09434                                                            46.2       1e-06
PYAR_19807                                                            46.2       1e-06
PHALS_00667                                                           45.1       1e-06
CCI45982                                                              46.2       2e-06
PYIR_19697                                                            45.8       2e-06
H310_02610                                                            45.8       2e-06
PHYRA_47865                                                           45.8       2e-06
PHYRA_47873                                                           45.8       2e-06
CCA21514                                                              45.8       2e-06
H257_01277                                                            45.4       2e-06
PYVX_15051                                                            45.1       3e-06
CCA24936                                                              45.1       4e-06
SPRG_02294                                                            45.1       4e-06
PYU1_G003754                                                          45.1       4e-06
HYAP_06818                                                            45.1       4e-06
SDRG_11043                                                            44.7       5e-06
PITG_15786                                                            44.7       5e-06
PHYCA_541134                                                          44.7       5e-06
PPTG_18274                                                            44.7       5e-06
CCI50234                                                              44.7       6e-06
PHYSO_500480                                                          44.7       6e-06
PHALS_07616                                                           44.3       7e-06
PHYRA_71123                                                           44.3       8e-06
PHYKE_9008                                                            44.3       8e-06
PYAR_22188                                                            43.5       1e-05
H310_06631                                                            43.5       1e-05
PYAP_19738                                                            42.7       3e-05
HYAP_01511                                                            41.2       8e-05
H257_16775                                                            39.7       3e-04
H257_17322                                                            37.7       0.001
PHYSO_342817                                                          33.5       0.047
PYAR_22140                                                            32.3       0.11 
PHYSO_339666                                                          30.4       0.67 
SDRG_10038                                                            30.0       0.90 
PHYCA_132015                                                          29.6       0.91 
SPRG_15695                                                            29.6       1.0  
PYIW_19165                                                            28.9       2.1  
H310_12545                                                            28.5       2.9  
SDRG_06491                                                            28.5       2.9  
H257_07650                                                            28.5       3.0  
H310_12765                                                            28.5       3.1  
PYVX_23790                                                            28.5       3.1  
SPRG_15914                                                            27.7       5.3  
CCI45196                                                              27.3       5.7  
SPRG_20728                                                            27.7       5.9  

>PHYSO_530254
Length=70

 Score = 144 bits (362),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)

Query  1   IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
           IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT
Sbjct  1   IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60

Query  61  TISSNRGCRS  70
           TISSNRGCRS
Sbjct  61  TISSNRGCRS  70

>PHYSO_383637
Length=81

 Score = 124 bits (312),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)

Query  1   IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
           IYKGGGVGVASNNKLG+LNVWDLMPVKRSEPLIAV FEIDVNGMLNV AHDKKP ARA+T
Sbjct  17  IYKGGGVGVASNNKLGELNVWDLMPVKRSEPLIAVTFEIDVNGMLNVSAHDKKPGARADT  76

Query  61  TISSN  65
           TISSN
Sbjct  77  TISSN  81

>PHYSO_549561
Length=361

 Score = 78.2 bits (191),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  207  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  266

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  267  TISNNRG  273

>PHYCA_509820
Length=786

 Score = 77.4 bits (189),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>HYAP_12660
Length=786

 Score = 77.4 bits (189),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>PHYKE_10815
Length=786

 Score = 77.4 bits (189),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>PITG_11913
Length=786

 Score = 77.4 bits (189),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>PHYRA_78193
Length=786

 Score = 77.4 bits (189),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>PPTG_03121
Length=786

 Score = 77.4 bits (189),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>PYVX_18121
Length=633

 Score = 77.0 bits (188),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  +   KR EP + V FEID NG+LNV A DKK  ARA T
Sbjct  479  IYEGERACVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAET  538

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  539  TISNNRG  545

>PHALS_02079
Length=786

 Score = 77.0 bits (188),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGAKAET  691

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  692  TISNNRG  698

>PYAR_19930
Length=625

 Score = 76.6 bits (187),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+ N+  +   KR EP + V FEID NG+LNV A DKK  ARA T
Sbjct  524  IYEGERAHVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAET  583

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  584  TISNNRG  590

>PYAP_22238
Length=633

 Score = 75.9 bits (185),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V +NNKLG+ N+  +   KR EP + V FEID NG+LNV A DKK  ARA T
Sbjct  479  IYEGERACVDANNKLGEFNISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAET  538

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  539  TISNNRG  545

>H310_10060
Length=187

 Score = 72.4 bits (176),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 0/67 (0%)

Query  1   IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
           IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  33  IYEGERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSAKDKKTHAKAET  92

Query  61  TISSNRG  67
           TISSN G
Sbjct  93  TISSNGG  99

>H257_18082
Length=187

 Score = 72.4 bits (176),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 0/67 (0%)

Query  1   IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
           IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  33  IYEGERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSAKDKKTHAKAET  92

Query  61  TISSNRG  67
           TISSN G
Sbjct  93  TISSNGG  99

>PYU1_G001540
Length=633

 Score = 74.3 bits (181),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 43/67 (64%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G     A NNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  ARA T
Sbjct  479  IYEGERASTAVNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAET  538

Query  61   TISSNRG  67
            TIS N G
Sbjct  539  TISQNAG  545

>PYIW_22144
Length=633

 Score = 74.3 bits (181),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 44/67 (66%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G     A NNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  ARA T
Sbjct  479  IYEGERASTAVNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAET  538

Query  61   TISSNRG  67
            TIS+N G
Sbjct  539  TISNNAG  545

>PYIR_24387
Length=633

 Score = 74.3 bits (181),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/67 (57%), Positives = 44/67 (66%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G     A NNKLG+ N+  L   KR EP + V FEID NG+LNV A DKK  ARA T
Sbjct  479  IYEGERASTAVNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTGARAET  538

Query  61   TISSNRG  67
            TIS+N G
Sbjct  539  TISNNAG  545

>CCI46091
Length=787

 Score = 72.0 bits (175),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+  +  +   +R EP + V FEID NG+LNV A DKK  A+A T
Sbjct  633  IYEGERACVDSNNKLGEFTISGIERARRGEPQVKVTFEIDANGILNVSATDKKTGAKAET  692

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  693  TISNNRG  699

>CCA20828
Length=787

 Score = 72.0 bits (175),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V SNNKLG+  +  +   +R EP + V FEID NG+LNV A DKK  A+A T
Sbjct  633  IYEGERACVDSNNKLGEFTISGIERARRGEPQVKVTFEIDANGILNVSATDKKTGAKAET  692

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  693  TISNNRG  699

>SDRG_05777
Length=786

 Score = 70.5 bits (171),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 44/67 (66%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  L   KR EP + V FEID NG+LNV A DKK +A+A T
Sbjct  633  IYEGERACVDHNNKLGEFTISGLERAKRGEPQVEVTFEIDANGILNVSARDKKTNAKAET  692

Query  61   TISSNRG  67
            TIS+N G
Sbjct  693  TISNNHG  699

>SPRG_10476
Length=270

 Score = 68.9 bits (167),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 44/67 (66%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+LNV A DKK +A+A T
Sbjct  117  IYEGERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTNAKAET  176

Query  61   TISSNRG  67
            TIS+N G
Sbjct  177  TISNNHG  183

>H257_18885
Length=786

 Score = 69.3 bits (168),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+LNV A DKK  A+A T
Sbjct  632  IYEGERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSAKDKKTHAKAET  691

Query  61   TISSNRG  67
            TISSN G
Sbjct  692  TISSNGG  698

>SDRG_05778
Length=618

 Score = 67.0 bits (162),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+LNV A DKK +A+A T
Sbjct  465  IYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAET  524

Query  61   TISSNRG  67
            TI++N G
Sbjct  525  TINNNNG  531

>SPRG_10477
Length=762

 Score = 67.0 bits (162),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+LNV A DKK +A+A T
Sbjct  609  IYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAET  668

Query  61   TISSNRG  67
            TI++N G
Sbjct  669  TINNNNG  675

>SDRG_05816
Length=479

 Score = 67.0 bits (162),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            I++G    V  NNKLG+  +  +   KR EP I V FEID NG+L+V A DKK  A+  T
Sbjct  325  IFEGERACVVDNNKLGEFEISGIERAKRGEPQIEVTFEIDANGILHVSARDKKTGAKNAT  384

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  385  TISNNRG  391

>SPRG_10519
Length=782

 Score = 66.6 bits (161),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 43/67 (64%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            I++G    V  NNKLG+  +  +   KR EP I V FEID NG+L+V A DKK  A+  T
Sbjct  628  IFEGERACVVDNNKLGEFEISGIERAKRGEPQIEVTFEIDANGILHVSARDKKTGAKNAT  687

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  688  TISNNRG  694

>H257_00007
Length=787

 Score = 66.6 bits (161),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+L+V   DKK  A+  T
Sbjct  633  IYEGERASVVDNNKLGEFEITGIERAKRGEPKLEVTFEIDANGILHVSCKDKKTGAKNQT  692

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  693  TISNNRG  699

>H310_14759
Length=787

 Score = 66.2 bits (160),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY+G    V  NNKLG+  +  +   KR EP + V FEID NG+L+V   DKK  A+  T
Sbjct  633  IYEGERASVVDNNKLGEFEITGIERAKRGEPKLEVTFEIDANGILHVSCKDKKTGAKNQT  692

Query  61   TISSNRG  67
            TIS+NRG
Sbjct  693  TISNNRG  699

>CCA14967
Length=1431

 Score = 50.8 bits (120),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K  +     
Sbjct  457  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGILNVSAVEKSTNKENKI  516

Query  61   TISSNRG  67
            TI++++G
Sbjct  517  TITNDKG  523

>PYIW_26567
Length=564

 Score = 50.4 bits (119),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G    V  N+ LGK ++  + P  R  P I V FEID NG+L V A DK        
Sbjct  469  VYEGERTLVKDNHLLGKFDLTGIPPAPRGIPQIEVTFEIDANGILQVSAEDKGTGKAEKI  528

Query  61   TISSNRG  67
            TI++ +G
Sbjct  529  TITAEKG  535

>CCA16151
Length=643

 Score = 50.1 bits (118),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G       N+ LGK N+ ++ P+ R  P I V FE+D NG+L+V A +K        
Sbjct  448  VYEGERTMTRDNHLLGKFNLEEIPPMPRGVPQIEVTFEVDANGILSVTAVEKSTGKENKI  507

Query  61   TISSNRG  67
            TI++++G
Sbjct  508  TITNDKG  514

>PPTG_02120
Length=1001

 Score = 50.1 bits (118),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  792  VFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  851

Query  61   TISSNRG  67
            TI++++G
Sbjct  852  TITNDKG  858

>PYVX_22981
Length=612

 Score = 50.1 bits (118),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  L P+ R  P I V F+ID NG+LNV A +K        
Sbjct  409  VFEGERTMTRDNNLLGKFNLDALPPMPRGVPQIDVTFDIDANGILNVTAVEKSTGKENKI  468

Query  61   TISSNRG  67
            TI++++G
Sbjct  469  TITNDKG  475

>H257_12958
Length=649

 Score = 49.7 bits (117),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G  V    NN LGK ++  L P+ R  P + V F+ID NG+LNV A +K        
Sbjct  445  VFEGERVMTKDNNLLGKFSLDGLPPMPRGMPQVDVTFDIDANGILNVSAVEKSTGKENKI  504

Query  61   TISSNRG  67
            TI++++G
Sbjct  505  TITNDKG  511

>CCI43221
Length=660

 Score = 49.7 bits (117),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K  +     
Sbjct  445  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGILNVSAIEKSTNKENKI  504

Query  61   TISSNRG  67
            TI++++G
Sbjct  505  TITNDKG  511

>SPRG_00068
Length=643

 Score = 49.7 bits (117),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G     A NN LGK ++  + P+ R  P + V F+ID NG+LNV A +K        
Sbjct  444  VYEGERSMTADNNLLGKFSLDGIPPMPRGVPQVDVTFDIDANGILNVSAVEKSTGKENKI  503

Query  61   TISSNRG  67
            TI++++G
Sbjct  504  TITNDKG  510

>PITG_11247
Length=653

 Score = 49.3 bits (116),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PITG_11252
Length=654

 Score = 49.3 bits (116),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  446  VFEGERTMTRDNHHLGKFNLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PYIR_16738
Length=555

 Score = 49.3 bits (116),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G    V  N+ LGK ++  + P  R  P I V FE+D NG+L V A DK        
Sbjct  351  VYEGERALVKDNHLLGKFDLTGIPPAPRGVPQIQVTFEVDANGILQVSAEDKGTGKAEKI  410

Query  61   TISSNRG  67
            TI++ +G
Sbjct  411  TITAEKG  417

>PYU1_G004097
Length=663

 Score = 49.3 bits (116),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G    V  N  LGK ++  L P  R  P I V FEID NG+L V A DK        
Sbjct  472  VFEGERTLVKHNRLLGKFDLAGLPPAPRGVPQIEVTFEIDANGILQVSAQDKGTGKTEKI  531

Query  61   TISSNRG  67
            TI++ +G
Sbjct  532  TITAEKG  538

>PITG_11249
Length=653

 Score = 49.3 bits (116),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PYIR_15859
Length=626

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  423  VFEGERTMTRDNHSLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  482

Query  61   TISSNRG  67
            TI++++G
Sbjct  483  TITNDKG  489

>PYIR_15857
Length=577

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  371  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  430

Query  61   TISSNRG  67
            TI++++G
Sbjct  431  TITNDKG  437

>PYIW_16873
Length=496

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  288  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  347

Query  61   TISSNRG  67
            TI++++G
Sbjct  348  TITNDKG  354

>PYU1_G013927
Length=649

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYSO_486085
Length=653

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYSO_480010
Length=653

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>HYAP_01540
Length=634

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  408  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  467

Query  61   TISSNRG  67
            TI++++G
Sbjct  468  TITNDKG  474

>PHYKE_7016
Length=650

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P++R  P I V F+ID NG+LNV A +K        
Sbjct  448  VFEGERTMTRDNHLLGKFNLDGIPPMRRGIPQIDVTFDIDANGILNVSAVEKSTGKENKI  507

Query  61   TISSNRG  67
            TI++++G
Sbjct  508  TITNDKG  514

>PHYSO_485614
Length=653

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PITG_11244
Length=663

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYRA_72463
Length=658

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  447  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  506

Query  61   TISSNRG  67
            TI++++G
Sbjct  507  TITNDKG  513

>PPTG_02122
Length=657

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYCA_104444
Length=644

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 40/67 (60%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P++R  P I V F++DVNG+LNV A +K        
Sbjct  447  VFEGERSLTQDNHLLGKFNLDGIPPMQRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  506

Query  61   TISSNRG  67
            TI++++G
Sbjct  507  TITNDKG  513

>PYAP_17334
Length=650

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAIEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PPTG_19690
Length=566

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  446  VFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYCA_104429
Length=645

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  434  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  493

Query  61   TISSNRG  67
            TI++++G
Sbjct  494  TITNDKG  500

>PHYCA_532912
Length=626

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  417  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  476

Query  61   TISSNRG  67
            TI++++G
Sbjct  477  TITNDKG  483

>PHYCA_104335
Length=656

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  447  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  506

Query  61   TISSNRG  67
            TI++++G
Sbjct  507  TITNDKG  513

>PHYSO_482793
Length=658

 Score = 48.5 bits (114),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  446  VFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYCA_104465
Length=653

 Score = 48.5 bits (114),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  447  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  506

Query  61   TISSNRG  67
            TI++++G
Sbjct  507  TITNDKG  513

>PYVX_15641
Length=629

 Score = 48.5 bits (114),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  422  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  481

Query  61   TISSNRG  67
            TI++++G
Sbjct  482  TITNDKG  488

>PHYSO_344705
Length=798

 Score = 48.5 bits (114),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  587  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  646

Query  61   TISSNRG  67
            TI++++G
Sbjct  647  TITNDKG  653

>PYAR_14487
Length=467

 Score = 48.5 bits (114),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  260  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  319

Query  61   TISSNRG  67
            TI++++G
Sbjct  320  TITNDKG  326

>PHYKE_2977
Length=220

 Score = 47.8 bits (112),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1   IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
           +++G       NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  1   VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  60

Query  61  TISSNRG  67
           TI++++G
Sbjct  61  TITNDKG  67

>CCI40247
Length=643

 Score = 48.1 bits (113),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G       N+ LGK N+  + P+ R  P I V FE+D NG+L+V A +K        
Sbjct  448  VYEGERSMTRDNHLLGKFNLEGIPPMPRGVPQIEVTFEVDANGILSVTAVEKSTGKENKI  507

Query  61   TISSNRG  67
            TI++++G
Sbjct  508  TITNDKG  514

>SDRG_03564
Length=658

 Score = 48.1 bits (113),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G       N+ LGK  +  + P  R  P I V FE+D NG+L V A DK        
Sbjct  469  VYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKAEKI  528

Query  61   TISSNRG  67
            TI++ +G
Sbjct  529  TITAEKG  535

>PYU1_G013931
Length=663

 Score = 48.1 bits (113),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  452  VFEGERAMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  511

Query  61   TISSNRG  67
            TI++++G
Sbjct  512  TITNDKG  518

>SDRG_11473
Length=636

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G     A N+ LGK ++  + P+ R  P + V F+ID NG+LNV A +K        
Sbjct  443  VYEGERSMTADNHLLGKFSLDGIPPMPRGVPQVDVTFDIDANGILNVSAVEKSTGKENKI  502

Query  61   TISSNRG  67
            TI++++G
Sbjct  503  TITNDKG  509

>PYAP_19235
Length=643

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK ++  + P+ R +P I V F+ID NG+LNV A +K        
Sbjct  445  VFEGERSMTKDNNLLGKFSLDGIPPMPRGKPEIEVTFDIDANGILNVSAVEKSTGKDNKI  504

Query  61   TISSNRG  67
            TI++++G
Sbjct  505  TITNDKG  511

>CCI40249
Length=660

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V ++ID NG+LNV A +K        
Sbjct  442  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANGILNVSAVEKSTGKENKI  501

Query  61   TISSNRG  67
            TI++++G
Sbjct  502  TITNDKG  508

>CCA16153
Length=663

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK N+  + P+ R  P I V ++ID NG+LNV A +K        
Sbjct  442  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANGILNVSAVEKSTGKENKI  501

Query  61   TISSNRG  67
            TI++++G
Sbjct  502  TITNDKG  508

>SPRG_00333
Length=615

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G       N+ LGK  +  + P  R  P I V FE+D NG+L V A DK        
Sbjct  426  VYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKAEKI  485

Query  61   TISSNRG  67
            TI++ +G
Sbjct  486  TITAEKG  492

>HYAP_01005
Length=660

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  468  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>HYAP_01004
Length=660

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  468  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>PITG_00527
Length=656

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  467  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  526

Query  61   TISSNRG  67
            TI++ +G
Sbjct  527  TITAEKG  533

>PHYRA_71042
Length=654

 Score = 47.8 bits (112),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  464  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  523

Query  61   TISSNRG  67
            TI++ +G
Sbjct  524  TITAEKG  530

>PHALS_00833
Length=652

 Score = 47.8 bits (112),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  467  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  526

Query  61   TISSNRG  67
            TI++ +G
Sbjct  527  TITAEKG  533

>PHYKE_7992
Length=657

 Score = 47.8 bits (112),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  467  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  526

Query  61   TISSNRG  67
            TI++ +G
Sbjct  527  TITAEKG  533

>PHYSO_286376
Length=660

 Score = 47.8 bits (112),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  468  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>PHYCA_510696
Length=659

 Score = 47.8 bits (112),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  467  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  526

Query  61   TISSNRG  67
            TI++ +G
Sbjct  527  TITAEKG  533

>PPTG_08245
Length=658

 Score = 47.8 bits (112),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  468  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVSAEDKGTGKAETI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>PYVX_16738
Length=658

 Score = 47.4 bits (111),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK      + 
Sbjct  467  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVGAEDKGTGKAESI  526

Query  61   TISSNRG  67
            TI++ +G
Sbjct  527  TITAEKG  533

>PYIR_16737
Length=511

 Score = 47.4 bits (111),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  321  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVGAEDKGTGKAEKI  380

Query  61   TISSNRG  67
            TI++ +G
Sbjct  381  TITAEKG  387

>H310_09557
Length=644

 Score = 47.4 bits (111),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +Y+G       N+ LGK ++  L P+ R  P + V F+ID NG+LNV A +K        
Sbjct  444  VYEGERTMTHDNHLLGKFSLDGLPPMPRGVPQVDVTFDIDANGILNVSAVEKSTGKENKI  503

Query  61   TISSNRG  67
            TI++++G
Sbjct  504  TITNDKG  510

>PYAR_18354
Length=1084

 Score = 47.4 bits (111),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V+FE+D NG+L V A DK        
Sbjct  469  VFEGERSMTKDNRMLGKFELTGLPPAPRGVPQIEVSFELDANGILQVGAEDKGTGKAEKI  528

Query  61   TISSNRG  67
            TI++++G
Sbjct  529  TITADKG  535

>PYAP_17333
Length=657

 Score = 47.0 bits (110),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK ++  L P+ R  P I V F+ID NG+LNV A +K        
Sbjct  447  VFEGERTMTRDNHLLGKFSLDGLPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  506

Query  61   TISSNRG  67
            TI++++G
Sbjct  507  TITNDKG  513

>PYIW_21755
Length=658

 Score = 47.0 bits (110),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  468  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVGAEDKGTGKAEKI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>PYU1_G004098
Length=656

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V FEID NG+L V A DK        
Sbjct  467  VFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGILQVGAEDKGTGKAEKI  526

Query  61   TISSNRG  67
            TI++ +G
Sbjct  527  TITAEKG  533

>PYIW_16876
Length=643

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK ++  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  446  VFEGERTMTRDNHSLGKFSLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>HYAP_01537
Length=651

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK ++  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  446  VFEGERAMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHALS_12790
Length=214

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  12  NNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
           NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        TI++++G
Sbjct  5   NNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

>PHYRA_41888
Length=586

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  386  VFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  445

Query  61   TISSNRG  67
             I++++G
Sbjct  446  IITNDKG  452

>SPRG_04533
Length=652

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK ++  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  445  VFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  504

Query  61   TISSNRG  67
            TI++++G
Sbjct  505  TITNDKG  511

>PHALS_09802
Length=651

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK ++  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  446  VFEGERTMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
            TI++++G
Sbjct  506  TITNDKG  512

>PHYRA_72415
Length=655

 Score = 46.6 bits (109),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  447  VFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  506

Query  61   TISSNRG  67
            TI++++G
Sbjct  507  TITNDKG  513

>SDRG_11899
Length=652

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK ++  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  445  VFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  504

Query  61   TISSNRG  67
            TI++++G
Sbjct  505  TITNDKG  511

>PYAP_13341
Length=657

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N  LGK  +  L P  R  P I V+FE+D NG+L V A DK        
Sbjct  468  VFEGERTMTKDNRLLGKFELTGLPPAPRGVPQIEVSFELDANGILQVGAEDKGTGKAEKI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>PYIW_17145
Length=443

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  264  ADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG  321

>PHYRA_71655
Length=653

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F++DVNG+LNV A +K        
Sbjct  446  VFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGILNVSAVEKSTGKENKI  505

Query  61   TISSNRG  67
             I++++G
Sbjct  506  IITNDKG  512

>H310_09434
Length=658

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK  +  + P  R  P I V FE+D NG+L V A DK        
Sbjct  468  VFEGERAMTKDNHILGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKAEKI  527

Query  61   TISSNRG  67
            TI++ +G
Sbjct  528  TITAEKG  534

>PYAR_19807
Length=1613

 Score = 46.2 bits (108),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK ++  L P+ R  P I V F+ID NG+LNV A +K        
Sbjct  436  VFEGERTMTRDNHLLGKFSLDALPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  495

Query  61   TISSNRG  67
            TI++++G
Sbjct  496  TITNDKG  502

>PHALS_00667
Length=142

 Score = 45.1 bits (105),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (60%), Gaps = 0/57 (0%)

Query  11  SNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            NN LGK N+  + P+ R  P I V F+ID NG+LNV A +K        TI++++G
Sbjct  4   DNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

>CCI45982
Length=661

 Score = 46.2 bits (108),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  476  ADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG  533

>PYIR_19697
Length=608

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  427  ADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG  484

>H310_02610
Length=650

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK ++  + P+ R  P + V F+ID NG+LNV A +K        
Sbjct  445  VFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQVDVTFDIDANGILNVSAIEKSTGKENKI  504

Query  61   TISSNRG  67
            TI++++G
Sbjct  505  TITNDKG  511

>PHYRA_47865
Length=381

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  169  VFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  228

Query  61   TISSNRG  67
            TI++++G
Sbjct  229  TITNDKG  235

>PHYRA_47873
Length=396

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/67 (36%), Positives = 38/67 (57%), Gaps = 0/67 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       N+ LGK N+  + P+ R  P I V F+ID NG+LNV A +K        
Sbjct  188  VFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  247

Query  61   TISSNRG  67
            TI++++G
Sbjct  248  TITNDKG  254

>CCA21514
Length=659

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  475  ADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQNIIIQSSGG  532

>H257_01277
Length=652

 Score = 45.4 bits (106),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 32/58 (55%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++ ++ P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  468  ADNKLLGNFDLQNIPPAPRGIPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  525

>PYVX_15051
Length=632

 Score = 45.1 bits (105),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)

Query  9    VASNNKL-GKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            +AS+NKL G  ++  + P  R  P I VAF+ID NG++NV A DK  +   +  I S+ G
Sbjct  449  MASDNKLLGNFDLVGIPPAPRGVPQIEVAFDIDANGIVNVSARDKATNKEQSIVIQSSGG  508

>CCA24936
Length=661

 Score = 45.1 bits (105),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/64 (38%), Positives = 34/64 (53%), Gaps = 1/64 (2%)

Query  5    GGVGVASNNKL-GKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTIS  63
            G   +A +N+L GK  +  + P  R  P I V FE+D NG+L V A DK        TI+
Sbjct  473  GERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKAEKVTIT  532

Query  64   SNRG  67
            + +G
Sbjct  533  AEKG  536

>SPRG_02294
Length=634

 Score = 45.1 bits (105),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++ ++ P  R  P I V+F+ID NG++NV A DK      +  I S+ G
Sbjct  452  ADNKSLGNFDLQNIPPAPRGIPQIEVSFDIDANGIVNVSARDKATGKEQSIVIQSSGG  509

>PYU1_G003754
Length=650

 Score = 45.1 bits (105),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  470  ADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG  527

>HYAP_06818
Length=316

 Score = 45.1 bits (105),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 1/60 (2%)

Query  9    VASNNKL-GKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            +AS+NKL G  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  131  MASDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  190

>SDRG_11043
Length=649

 Score = 44.7 bits (104),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++ ++ P  R  P I V+F+ID NG++NV A DK      +  I S+ G
Sbjct  467  ADNKSLGNFDLQNIPPAPRGIPQIEVSFDIDANGIVNVSARDKATGKEQSIVIQSSGG  524

>PITG_15786
Length=633

 Score = 44.7 bits (104),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  451  ADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  508

>PHYCA_541134
Length=633

 Score = 44.7 bits (104),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  451  ADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  508

>PPTG_18274
Length=648

 Score = 44.7 bits (104),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  467  ADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  524

>CCI50234
Length=665

 Score = 44.7 bits (104),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/64 (38%), Positives = 34/64 (53%), Gaps = 1/64 (2%)

Query  5    GGVGVASNNKL-GKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTIS  63
            G   +A +N+L GK  +  + P  R  P I V FE+D NG+L V A DK        TI+
Sbjct  477  GERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKAEKITIT  536

Query  64   SNRG  67
            + +G
Sbjct  537  AEKG  540

>PHYSO_500480
Length=633

 Score = 44.7 bits (104),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  451  ADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  508

>PHALS_07616
Length=677

 Score = 44.3 bits (103),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 31/58 (53%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  495  ADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  552

>PHYRA_71123
Length=633

 Score = 44.3 bits (103),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (2%)

Query  9    VASNNKL-GKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            +A++NKL G  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  449  MATDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  508

>PHYKE_9008
Length=650

 Score = 44.3 bits (103),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (2%)

Query  9    VASNNKL-GKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            +A++NKL G  ++  + P  R  P I V+F+ID NG++NV A DK      N  I S+ G
Sbjct  466  MATDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARDKATGKEQNIVIQSSGG  525

>PYAR_22188
Length=634

 Score = 43.5 bits (101),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 30/58 (52%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V F+ID NG++NV A DK      +  I S+ G
Sbjct  427  ADNKSLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSARDKSTGKEQSIVIQSSGG  484

>H310_06631
Length=651

 Score = 43.5 bits (101),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++ ++ P  R  P I V+F+ID NG++NV A DK      +  I S+ G
Sbjct  468  ADNKLLGNFDLQNIPPAPRGIPQIEVSFDIDANGIVNVGARDKATGKEQSIVIQSSGG  525

>PYAP_19738
Length=648

 Score = 42.7 bits (99),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 30/58 (52%), Gaps = 0/58 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            A N  LG  ++  + P  R  P I V F+ID NG++NV A DK      +  I S+ G
Sbjct  469  ADNKLLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSARDKSTGKEQSIVIQSSGG  526

>HYAP_01511
Length=206

 Score = 41.2 bits (95),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGM  44
            ++KG      +NN LGK N+ D+ P+ R  P + V+F+ID NG+
Sbjct  131  VFKGKRYMTRNNNLLGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174

>H257_16775
Length=291

 Score = 39.7 bits (91),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 2/67 (3%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            +++G       NN LGK +   + P+ R  P + V F+ID NG+LNV   +K  S     
Sbjct  113  VFEGERSMTRDNNLLGKFSFDGIPPMHRGVPQVDVTFDIDANGILNVSTIEK--STGKEI  170

Query  61   TISSNRG  67
            TI++ +G
Sbjct  171  TITNAKG  177

>H257_17322
Length=606

 Score = 37.7 bits (86),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/43 (40%), Positives = 26/43 (60%), Gaps = 0/43 (0%)

Query  25   PVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSNRG  67
            P+ R  P + V F+ID NG+LNV A +K        TI++++G
Sbjct  426  PMPRGVPHVDVTFDIDANGILNVSAIEKSTGKENKITITNDKG  468

>PHYSO_342817
Length=189

 Score = 33.5 bits (75),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 28/68 (41%), Gaps = 11/68 (16%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            IY G    V  NNK+G+ N+  L   KR EP  A  F I           +K PS     
Sbjct  98   IYDGERACVKPNNKVGEFNISGLERTKRGEPQYAGEFHI-----------EKDPSGNYKL  146

Query  61   TISSNRGC  68
             I +N G 
Sbjct  147  FIDNNSGT  154

>PYAR_22140
Length=353

 Score = 32.3 bits (72),  Expect = 0.11, Method: Composition-based stats.
 Identities = 20/63 (32%), Positives = 32/63 (51%), Gaps = 1/63 (2%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVN-GMLNVPAHDKKPSARAN  59
            +++G  +   +N+ LG+L +  L P     P I V FEIDV+  M+ + A     +   N
Sbjct  204  VFEGERILTKNNHFLGQLKLKGLSPAPPGVPRIEVQFEIDVDYDMMVISAQAMGSTLSEN  263

Query  60   TTI  62
             TI
Sbjct  264  VTI  266

>PHYSO_339666
Length=585

 Score = 30.4 bits (67),  Expect = 0.67, Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (6%)

Query  2    YKGGGVGVASNNKLGKLNV--WDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARAN  59
            ++G    VA+N  L +  +    + P + SE  I VA ++D NG L V A +K       
Sbjct  415  FEGEATTVATNRLLCEFEMDGITMTPGRLSE--IEVAIDVDANGSLTVSAVEKSTGKEKK  472

Query  60   TTISSNR  66
             TI+ +R
Sbjct  473  ITINCSR  479

>SDRG_10038
Length=565

 Score = 30.0 bits (66),  Expect = 0.90, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 0/50 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAH  50
            IY+G       N  L  L +  + P+++  P I V+F +    +L V AH
Sbjct  444  IYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNVTRKSVLTVKAH  493

>PHYCA_132015
Length=151

 Score = 29.6 bits (65),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  3    KGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAF  37
            + G VG+A NN    LN+W+ + +  +EP + V F
Sbjct  76   RFGVVGLAPNNLNQALNIWERIGILEAEPFMQVNF  110

>SPRG_15695
Length=581

 Score = 29.6 bits (65),  Expect = 1.0, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 0/50 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAH  50
            IY+G       N  L  L +  + P+++  P I V+F +    +L V AH
Sbjct  460  IYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNVTRKSVLTVKAH  509

>PYIW_19165
Length=1124

 Score = 28.9 bits (63),  Expect = 2.1, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 24/49 (49%), Gaps = 0/49 (0%)

Query  1     IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPA  49
             +Y+G  V    N  L  L+V  +    +SE  I V F +   G+L++ A
Sbjct  1001  VYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTKGVLSITA  1049

>H310_12545
Length=434

 Score = 28.5 bits (62),  Expect = 2.9, Method: Composition-based stats.
 Identities = 15/56 (27%), Positives = 26/56 (46%), Gaps = 0/56 (0%)

Query  10   ASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANTTISSN  65
            A N  L  LN W  + V+  E    + FE+ ++ + NVP ++         T+ S+
Sbjct  207  AENGMLRSLNTWKQVAVRFDECTKELVFEMSLSFIFNVPINELCAGLNTAITVRSD  262

>SDRG_06491
Length=2613

 Score = 28.5 bits (62),  Expect = 2.9, Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  23    LMPVKRSEPLIAVAFEIDVNGMLNVPAHDK  52
             L+P++ SEP + +  +I VNG++N   H K
Sbjct  2548  LLPLRLSEPRVDMLLDIRVNGVVNGQLHVK  2577

>H257_07650
Length=563

 Score = 28.5 bits (62),  Expect = 3.0, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 0/50 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAH  50
            +Y+G  V    N  L  L +  + P  + E  + V+F +   G L V AH
Sbjct  442  VYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNVTRKGQLTVKAH  491

>H310_12765
Length=560

 Score = 28.5 bits (62),  Expect = 3.1, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 0/50 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVNGMLNVPAH  50
            +Y+G  V    N  L  L +  + P  + E  + V+F +   G L V AH
Sbjct  442  VYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTVTRKGQLTVKAH  491

>PYVX_23790
Length=461

 Score = 28.5 bits (62),  Expect = 3.1, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 1/38 (3%)

Query  23   LMPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPSARANT  60
            L+P+    P  A+A E D+NG+LN PA    P     T
Sbjct  220  LVPLTEPWPTKAIAIE-DLNGVLNAPAWRALPGVHIRT  256

>SPRG_15914
Length=1710

 Score = 27.7 bits (60),  Expect = 5.3, Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  23    LMPVKRSEPLIAVAFEIDVNGMLNVPAHDK  52
             L+P++ SEP +    +I VNG++N   H K
Sbjct  1645  LLPLRLSEPRVDTLLDIRVNGVVNGQLHVK  1674

>CCI45196
Length=136

 Score = 27.3 bits (59),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  1    IYKGGGVGVASNNKLGKLNVWDLMPVKRSEPLIAVAFEIDVN  42
            I KG       N  LG++ V  + PV R  P I V F  ++N
Sbjct  78   ILKGERAMAKDNRLLGQVEVTGIPPVPRDIPQIEVTFRAEIN  119

>SPRG_20728
Length=438

 Score = 27.7 bits (60),  Expect = 5.9, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  24   MPVKRSEPLIAVAFEIDVNGMLNVPAHDKKPS  55
            MPV  + PL  VA  +DV   L+ PA +  PS
Sbjct  250  MPVVLTAPLPPVAPSVDVAVTLDAPAANDGPS  281

Lambda      K        H        a         alpha
   0.322    0.138    0.420    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3411934344

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40