Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_4800105698665365331690.0
PHYSO_485614926765365331620.0
PHYSO_486085926565365331250.0
PHYCA_104465926765365030810.0
PITG_11249926765365330780.0
PHYRA_724155698665565530770.0
PITG_11247926565365330740.0
PHYSO_344705926279865730730.0
PHYCA_1043356903565665230720.0
PPTG_02122926265765730690.0
PITG_11244926266366330680.0
PHYRA_72463926265865830550.0
PYAP_173349729165065329980.0
PYU1_G0139279729164965329800.0
PHYCA_1044294084764565729780.0
SPRG_04533926765264728970.0
SDRG_11899926765264728960.0
H310_0261014834765064728950.0
PHYCA_5329125698662665228780.0
PYVX_15641926262965328330.0
SDRG_1147312211563661128120.0
SPRG_0006812211564365327930.0
PYU1_G013931926266361027830.0
PYIW_16876926264361527830.0
PYAP_192359943964364827710.0
CCI4322116052066061527600.0
CCI40249926766060727480.0
PITG_11252927065465427430.0
CCA16153926766360727400.0
HYAP_01537927065165327380.0
PYAP_17333926265761027310.0
PHYSO_482793927065865827240.0
PHALS_09802927065165326960.0
H257_12958926764960726960.0
PHYRA_71655927065365326940.0
H310_09557926764465326900.0
PHYCA_104444927064465426760.0
PHYKE_7016927065061526630.0
PYAR_198079262161361426460.0
CCA14967152039143159526050.0
PYIR_15859926262661425960.0
PPTG_196902483756656425570.0
CCI4024715245664365225570.0
H257_1732214834760660925550.0
CCA1615115245664365525300.0
PYVX_229818037761264824940.0
HYAP_015407534563462124770.0
PYIR_158579729157765323740.0
PHALS_043303140378544522310.0
PHYKE_69845698645045022210.0
PYIW_168739729149649621580.0
PPTG_0212075345100148121350.0
H310_0943447865861719640.0
PYAR_18354478108461119590.0
PHALS_013383001738337819590.0
PYIW_2175547865861119550.0
PYAP_1334147865761119550.0
PYVX_1673847865861619510.0
PHALS_0083347865261119490.0
PYU1_G00409847865661119380.0
PHYSO_28637647866061119350.0
PHYCA_51069647865961119320.0
PPTG_0824547865861119280.0
PHYRA_7104247865461619240.0
HYAP_0100547866061119170.0
HYAP_010049399666061119170.0
PYU1_G0040979399666360819130.0
PITG_0052747865661119030.0
PHYKE_799247865761119000.0
SDRG_0356447865861818960.0
CCI5023447866561218730.0
CCA2493647866161618650.0
H310_1475912754278760717730.0
H257_0000712754278760717710.0
CCA20828976178760517710.0
SDRG_05777976178660517680.0
H257_18885976178660417670.0
HYAP_12660976178660517620.0
CCI46091976178760517600.0
PYIW_2656716585556454017590.0
SPRG_0033347861561817510.0
PYIW_221448493763360517500.0
SPRG_1051912754278260517490.0
PITG_11913976178660517490.0
PYIR_243878493763360517480.0
PPTG_03121976178660517480.0
PYVX_18121976163360517410.0
PHYRA_78193976178660517400.0
PYU1_G0015408493763360517390.0
PHYKE_10815976178660517380.0
PYAP_222388493763360517360.0
PHALS_02079976178660517350.0
PHYCA_509820976178660517220.0
PHYRA_478736903539639617020.0
PHYRA_418886871958635216750.0
SPRG_10477976176259916740.0
PYIR_1673747851149115850.0
PHYRA_47865926738138015710.0
H310_026044159331229614820.0
PHYRA_722386941960161114750.0
PYU1_G0037541272865061413680.0
PYAP_197381272864856113670.0
PYVX_150511272863257413571e-179
PHYKE_90081272865061413502e-178
H310_066311272865161513493e-178
PHYSO_5254295984561060113411e-177
PITG_157861272863361313403e-177
H257_012771272865256113414e-177
PPTG_182741272864861513398e-177
PHYRA_711231272863361513333e-176
SDRG_110431272864956213328e-176
PHYSO_5004801272863361513301e-175
PHYCA_5411341272863361513291e-175
PHALS_076161272867757113314e-175
CCI459821272866161713294e-175
CCA215141272865961713121e-172
SDRG_0581612754247948412803e-170
PYIR_196971272860859312889e-170
PYAR_221881272863462212882e-169
PHYSO_3396666941958560812642e-166
SPRG_022941272863456112482e-163
PITG_153701240847428911584e-152
PYAR_199308493762541711516e-149
PPTG_021219729122221110952e-146
PHYSO_552116309757051710981e-141
PYAP_16216309756451710961e-141
PYAR_144875698646728410862e-141
HYAP_01993309756952710944e-141
PITG_05721486430229210572e-139
PPTG_10122309756951710822e-139
PYU1_G006940309756551710796e-139
PHYRA_71591309757051710771e-138
SDRG_10038309756551210596e-136
PHYKE_64309756951710596e-136
PITG_03546309756951710597e-136
PYIR_24123309756751710562e-135
PPTG_16727927021720710101e-133
SPRG_1113312787367644810504e-133
PHALS_00390309756954410274e-131
H310_12765309756051110134e-129
PHYCA_5322073097111851910529e-129
PYVX_17692309755152710091e-128
SPRG_15695309758151210084e-128
H257_0765030975634909934e-126
PYIR_16738939965553289882e-125
PYAR_2470430975254959843e-125
CCI4758230975825539354e-117
PYIW_19165309711245169612e-115
SDRG_057781275266182409237e-115
CCA2022930975835539145e-114
PITG_15111122191861808592e-111
PYAR_246871058826185468871e-109
PYIW_17145127284433918582e-107
PHYSO_54956197613613668423e-106
PHYKE_2977753452201708143e-104
PITG_16528133105615058421e-103
PHYSO_493381133105625058342e-102
PYU1_G002895133105615058333e-102
PHYRA_79054133105635068306e-102
PHYCA_6458133105605098253e-101
SDRG_171221278733613708023e-100
PPTG_05819133105615048184e-100
PYAR_14579133105675078161e-99
H310_03911133105705167986e-97
PYIW_17320133105634987941e-96
PHALS_02692133105575057905e-96
PYIR_13638133105434997878e-96
SPRG_01255133105665007872e-95
CCI45261133105585077827e-95
H257_01680133105715187575e-91
PHALS_00667297021421427151e-90
PYVX_13615133105855287516e-90
PHALS_1279092652141637186e-90
SDRG_16621133105314937451e-89
PYAP_19903133105275047441e-89
SDRG_010681221786216197468e-89
CCA22305133105615117401e-88
HYAP_01857133104924677323e-88
PHYRA_51904408471291286923e-87
SPRG_001831221796096107301e-86
H257_167751460792912666752e-82
PHYSO_5252361275422462246651e-81
SPRG_001821221786156186924e-81
SDRG_010671221796116176723e-78
PYAP_18643457648046806484e-73
PHYSO_249932300172322126055e-73
PYVX_13288457648106796476e-73
HYAP_06818127283163006128e-73
SPRG_06720139304253916192e-72
PHALS_09281139304653976124e-71
SDRG_16559139304613916117e-71
CCA159131523708576936312e-70
PHALS_04095457648036746283e-70
SPRG_104761275262702765894e-70
H257_04453139304233896024e-70
PYAR_15468457647696566246e-70
PHYRA_53570139303953955987e-70
CCI467091523708196936213e-69
PYIR_21692139304684045993e-69
H310_12260139304243915964e-69
PPTG_09003139304493965984e-69
PHYCA_120845139304443925967e-69
PITG_17383139304383985887e-68
PYIW_19956139304593945853e-67
PYIW_142318611412435716112e-66
H257_164841261517956746002e-66
PYU1_G006843139304813975794e-66
PHALS_08498127148955436015e-66
PYU1_G008851457647953935932e-65
PPTG_19375457648093915906e-65
PHYCA_504114127148875415927e-65
PHYCA_111740415938103915881e-64
H310_062291261518003925872e-64
HYAP_07918127148973965857e-64
PHYRA_82545457648063915828e-64
PITG_15771127148833965822e-63
PHYKE_6664457648043915792e-63
PHYRA_73661127148845455804e-63
PYAP_19741127148853945761e-62
CCA27145139304634035496e-62
PYAR_16202127148935285708e-62
PHYSO_2555061271412283985741e-61
PYU1_G000896861147115625593e-61
PHYKE_9011127149023985654e-61
SDRG_032661261517923915562e-60
PYAP_21865139304814105392e-60
SPRG_080601261517933915563e-60
PHYSO_247517457647946465544e-60
CCA21519127149295455462e-58
PPTG_04054314033242555107e-58
PYVX_15061127148913975401e-57
PYIR_25979861144384005171e-57
HYAP_015389267130934864e-57
PYIR_24220127149083975346e-57
PHYSO_285382139303793525069e-57
H310_014931481489093975321e-56
PPTG_14555167767035515242e-56
H310_01496127149043975303e-56
HYAP_04460457648183935255e-56
PPTG_17083237953042144921e-55
PYU1_G003764127149103965205e-55
H257_00287127148933975143e-54
SDRG_01828127148665585115e-54
PHYCA_55893426644894884931e-53
PHYSO_339667525751601524632e-53
PYIR_18381457647473934998e-53
CCI11769139303723614743e-52
SPRG_06288127148695524966e-52
HYAP_10418139303152974668e-52
CCI45987127149395314969e-52
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_480010

Length=654
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_480010                                                          1225       0.0   
PHYSO_485614                                                          1222       0.0   
PHYSO_486085                                                          1208       0.0   
PHYCA_104465                                                          1191       0.0   
PITG_11249                                                            1190       0.0   
PHYRA_72415                                                           1189       0.0   
PITG_11247                                                            1188       0.0   
PHYSO_344705                                                          1188       0.0   
PHYCA_104335                                                          1187       0.0   
PPTG_02122                                                            1186       0.0   
PITG_11244                                                            1186       0.0   
PHYRA_72463                                                           1181       0.0   
PYAP_17334                                                            1159       0.0   
PYU1_G013927                                                          1152       0.0   
PHYCA_104429                                                          1151       0.0   
SPRG_04533                                                            1120       0.0   
SDRG_11899                                                            1120       0.0   
H310_02610                                                            1119       0.0   
PHYCA_532912                                                          1113       0.0   
PYVX_15641                                                            1095       0.0   
SDRG_11473                                                            1087       0.0   
SPRG_00068                                                            1080       0.0   
PYU1_G013931                                                          1076       0.0   
PYIW_16876                                                            1076       0.0   
PYAP_19235                                                            1071       0.0   
CCI43221                                                              1067       0.0   
CCI40249                                                              1063       0.0   
PITG_11252                                                            1061       0.0   
CCA16153                                                              1060       0.0   
HYAP_01537                                                            1059       0.0   
PYAP_17333                                                            1056       0.0   
PHYSO_482793                                                          1053       0.0   
PHALS_09802                                                           1043       0.0   
H257_12958                                                            1043       0.0   
PHYRA_71655                                                           1042       0.0   
H310_09557                                                            1040       0.0   
PHYCA_104444                                                          1035       0.0   
PHYKE_7016                                                            1030       0.0   
PYAR_19807                                                            1023       0.0   
CCA14967                                                              1008       0.0   
PYIR_15859                                                            1004       0.0   
PPTG_19690                                                            989        0.0   
CCI40247                                                              989        0.0   
H257_17322                                                            988        0.0   
CCA16151                                                              979        0.0   
PYVX_22981                                                            965        0.0   
HYAP_01540                                                            958        0.0   
PYIR_15857                                                            919        0.0   
PHALS_04330                                                           863        0.0   
PHYKE_6984                                                            860        0.0   
PYIW_16873                                                            835        0.0   
PPTG_02120                                                            827        0.0   
H310_09434                                                            761        0.0   
PYAR_18354                                                            759        0.0   
PHALS_01338                                                           759        0.0   
PYIW_21755                                                            757        0.0   
PYAP_13341                                                            757        0.0   
PYVX_16738                                                            756        0.0   
PHALS_00833                                                           755        0.0   
PYU1_G004098                                                          751        0.0   
PHYSO_286376                                                          749        0.0   
PHYCA_510696                                                          748        0.0   
PPTG_08245                                                            747        0.0   
PHYRA_71042                                                           745        0.0   
HYAP_01005                                                            743        0.0   
HYAP_01004                                                            743        0.0   
PYU1_G004097                                                          741        0.0   
PITG_00527                                                            737        0.0   
PHYKE_7992                                                            736        0.0   
SDRG_03564                                                            734        0.0   
CCI50234                                                              726        0.0   
CCA24936                                                              723        0.0   
H310_14759                                                            687        0.0   
H257_00007                                                            686        0.0   
CCA20828                                                              686        0.0   
SDRG_05777                                                            685        0.0   
H257_18885                                                            685        0.0   
HYAP_12660                                                            683        0.0   
CCI46091                                                              682        0.0   
PYIW_26567                                                            682        0.0   
SPRG_00333                                                            679        0.0   
PYIW_22144                                                            678        0.0   
SPRG_10519                                                            678        0.0   
PITG_11913                                                            678        0.0   
PYIR_24387                                                            677        0.0   
PPTG_03121                                                            677        0.0   
PYVX_18121                                                            675        0.0   
PHYRA_78193                                                           674        0.0   
PYU1_G001540                                                          674        0.0   
PHYKE_10815                                                           674        0.0   
PYAP_22238                                                            673        0.0   
PHALS_02079                                                           672        0.0   
PHYCA_509820                                                          667        0.0   
PHYRA_47873                                                           660        0.0   
PHYRA_41888                                                           649        0.0   
SPRG_10477                                                            649        0.0   
PYIR_16737                                                            615        0.0   
PHYRA_47865                                                           609        0.0   
H310_02604                                                            575        0.0   
PHYRA_72238                                                           572        0.0   
PYU1_G003754                                                          531        0.0   
PYAP_19738                                                            531        0.0   
PYVX_15051                                                            527        1e-179
PHYKE_9008                                                            524        2e-178
H310_06631                                                            524        3e-178
PHYSO_525429                                                          521        1e-177
PITG_15786                                                            520        3e-177
H257_01277                                                            521        4e-177
PPTG_18274                                                            520        8e-177
PHYRA_71123                                                           518        3e-176
SDRG_11043                                                            517        8e-176
PHYSO_500480                                                          516        1e-175
PHYCA_541134                                                          516        1e-175
PHALS_07616                                                           517        4e-175
CCI45982                                                              516        4e-175
CCA21514                                                              509        1e-172
SDRG_05816                                                            497        3e-170
PYIR_19697                                                            500        9e-170
PYAR_22188                                                            500        2e-169
PHYSO_339666                                                          491        2e-166
SPRG_02294                                                            485        2e-163
PITG_15370                                                            450        4e-152
PYAR_19930                                                            447        6e-149
PPTG_02121                                                            426        2e-146
PHYSO_552116                                                          427        1e-141
PYAP_16216                                                            426        1e-141
PYAR_14487                                                            422        2e-141
HYAP_01993                                                            426        4e-141
PITG_05721                                                            411        2e-139
PPTG_10122                                                            421        2e-139
PYU1_G006940                                                          420        6e-139
PHYRA_71591                                                           419        1e-138
SDRG_10038                                                            412        6e-136
PHYKE_64                                                              412        6e-136
PITG_03546                                                            412        7e-136
PYIR_24123                                                            411        2e-135
PPTG_16727                                                            393        1e-133
SPRG_11133                                                            409        4e-133
PHALS_00390                                                           400        4e-131
H310_12765                                                            394        4e-129
PHYCA_532207                                                          409        9e-129
PYVX_17692                                                            393        1e-128
SPRG_15695                                                            392        4e-128
H257_07650                                                            387        4e-126
PYIR_16738                                                            385        2e-125
PYAR_24704                                                            383        3e-125
CCI47582                                                              364        4e-117
PYIW_19165                                                            374        2e-115
SDRG_05778                                                            360        7e-115
CCA20229                                                              356        5e-114
PITG_15111                                                            335        2e-111
PYAR_24687                                                            346        1e-109
PYIW_17145                                                            335        2e-107
PHYSO_549561                                                          328        3e-106
PHYKE_2977                                                            318        3e-104
PITG_16528                                                            328        1e-103
PHYSO_493381                                                          325        2e-102
PYU1_G002895                                                          325        3e-102
PHYRA_79054                                                           324        6e-102
PHYCA_6458                                                            322        3e-101
SDRG_17122                                                            313        3e-100
PPTG_05819                                                            319        4e-100
PYAR_14579                                                            318        1e-99 
H310_03911                                                            311        6e-97 
PYIW_17320                                                            310        1e-96 
PHALS_02692                                                           308        5e-96 
PYIR_13638                                                            307        8e-96 
SPRG_01255                                                            307        2e-95 
CCI45261                                                              305        7e-95 
H257_01680                                                            296        5e-91 
PHALS_00667                                                           280        1e-90 
PYVX_13615                                                            293        6e-90 
PHALS_12790                                                           281        6e-90 
SDRG_16621                                                            291        1e-89 
PYAP_19903                                                            291        1e-89 
SDRG_01068                                                            291        8e-89 
CCA22305                                                              289        1e-88 
HYAP_01857                                                            286        3e-88 
PHYRA_51904                                                           271        3e-87 
SPRG_00183                                                            285        1e-86 
H257_16775                                                            264        2e-82 
PHYSO_525236                                                          260        1e-81 
SPRG_00182                                                            271        4e-81 
SDRG_01067                                                            263        3e-78 
PYAP_18643                                                            254        4e-73 
PHYSO_249932                                                          237        5e-73 
PYVX_13288                                                            253        6e-73 
HYAP_06818                                                            240        8e-73 
SPRG_06720                                                            243        2e-72 
PHALS_09281                                                           240        4e-71 
SDRG_16559                                                            239        7e-71 
CCA15913                                                              247        2e-70 
PHALS_04095                                                           246        3e-70 
SPRG_10476                                                            231        4e-70 
H257_04453                                                            236        4e-70 
PYAR_15468                                                            244        6e-70 
PHYRA_53570                                                           234        7e-70 
CCI46709                                                              243        3e-69 
PYIR_21692                                                            235        3e-69 
H310_12260                                                            234        4e-69 
PPTG_09003                                                            234        4e-69 
PHYCA_120845                                                          234        7e-69 
PITG_17383                                                            231        7e-68 
PYIW_19956                                                            229        3e-67 
PYIW_14231                                                            239        2e-66 
H257_16484                                                            235        2e-66 
PYU1_G006843                                                          227        4e-66 
PHALS_08498                                                           236        5e-66 
PYU1_G008851                                                          233        2e-65 
PPTG_19375                                                            231        6e-65 
PHYCA_504114                                                          232        7e-65 
PHYCA_111740                                                          231        1e-64 
H310_06229                                                            230        2e-64 
HYAP_07918                                                            229        7e-64 
PHYRA_82545                                                           228        8e-64 
PITG_15771                                                            228        2e-63 
PHYKE_6664                                                            227        2e-63 
PHYRA_73661                                                           228        4e-63 
PYAP_19741                                                            226        1e-62 
CCA27145                                                              216        6e-62 
PYAR_16202                                                            224        8e-62 
PHYSO_255506                                                          225        1e-61 
PYU1_G000896                                                          219        3e-61 
PHYKE_9011                                                            222        4e-61 
SDRG_03266                                                            218        2e-60 
PYAP_21865                                                            212        2e-60 
SPRG_08060                                                            218        3e-60 
PHYSO_247517                                                          218        4e-60 
CCA21519                                                              214        2e-58 
PPTG_04054                                                            201        7e-58 
PYVX_15061                                                            212        1e-57 
PYIR_25979                                                            203        1e-57 
HYAP_01538                                                            191        4e-57 
PYIR_24220                                                            210        6e-57 
PHYSO_285382                                                          199        9e-57 
H310_01493                                                            209        1e-56 
PPTG_14555                                                            206        2e-56 
H310_01496                                                            208        3e-56 
HYAP_04460                                                            206        5e-56 
PPTG_17083                                                            194        1e-55 
PYU1_G003764                                                          204        5e-55 
H257_00287                                                            202        3e-54 
SDRG_01828                                                            201        5e-54 
PHYCA_558934                                                          194        1e-53 
PHYSO_339667                                                          182        2e-53 
PYIR_18381                                                            196        8e-53 
CCI11769                                                              187        3e-52 
SPRG_06288                                                            195        6e-52 
HYAP_10418                                                            184        8e-52 
CCI45987                                                              195        9e-52 
PPTG_18280                                                            185        2e-51 
PITG_21580                                                            191        3e-51 
HYAP_01856                                                            180        1e-50 
PYVX_18450                                                            179        3e-49 
SPRG_11007                                                            178        1e-48 
PYAR_22140                                                            176        2e-48 
PITG_03068                                                            182        2e-48 
PHYSO_321565                                                          182        3e-48 
PYIW_19676                                                            181        9e-48 
PPTG_13159                                                            168        2e-47 
PHYSO_249902                                                          151        3e-42 
H310_10060                                                            152        6e-42 
PPTG_10700                                                            150        1e-41 
H257_18082                                                            150        3e-41 
PYU1_G004743                                                          149        2e-36 
PYIW_21045                                                            146        1e-35 
PYAR_13948                                                            145        2e-35 
PHALS_00479                                                           143        1e-34 
PPTG_17863                                                            130        5e-34 
PHYKE_7077                                                            140        7e-34 
HYAP_01511                                                            130        8e-34 
PPTG_22662                                                            135        9e-34 
PHYSO_353741                                                          139        2e-33 
HYAP_01510                                                            126        5e-33 
PYAP_23247                                                            137        1e-32 
PPTG_18422                                                            135        3e-32 
PITG_02259                                                            135        3e-32 
SPRG_00713                                                            131        6e-31 
HYAP_00880                                                            130        3e-30 
SDRG_01561                                                            128        7e-30 
PHYKE_585                                                             128        8e-30 
PHYCA_502791                                                          128        9e-30 
PYIR_14416                                                            128        9e-30 
PPTG_23878                                                            129        1e-29 
H257_18435                                                            127        1e-29 
PHYRA_80453                                                           119        7e-27 
PYVX_22905                                                            119        8e-27 
H310_05216                                                            118        1e-26 
PHYRA_42335                                                           102        5e-25 
PHYSO_342817                                                          103        3e-24 
PYVX_22561                                                            103        2e-22 
SPRG_17185                                                            93.6       5e-22 
HYAP_04461                                                            85.9       2e-18 
PYAP_20766                                                            91.3       3e-18 
PYVX_17117                                                            92.0       5e-18 
PHYRA_46132                                                           82.8       9e-18 
PHYRA_81377                                                           88.2       2e-17 
PHYCA_549822                                                          84.0       4e-16 
PPTG_04864                                                            84.7       4e-16 
PHYRA_82300                                                           85.1       8e-16 
PYIW_19781                                                            83.6       9e-16 
PYU1_G008203                                                          80.5       9e-15 
PYIR_20734                                                            75.9       2e-13 
CCI45196                                                              69.7       5e-13 
PHYSO_532708                                                          72.0       1e-12 
PHYKE_9691                                                            72.0       7e-12 
SPRG_08648                                                            67.4       9e-11 
PITG_03970                                                            65.1       2e-10 
SDRG_10651                                                            66.2       3e-10 
PYAR_19707                                                            60.5       2e-08 
PHYSO_383637                                                          51.2       3e-07 
PHYSO_530254                                                          48.9       2e-06 
PPTG_17862                                                            50.4       3e-06 
H257_09465                                                            52.0       7e-06 
H310_13261                                                            51.6       9e-06 
PHYRA_54751                                                           46.2       1e-05 
PITG_11248                                                            45.8       5e-05 
PPTG_09610                                                            43.5       7e-05 
PYIR_22849                                                            47.4       9e-05 
PPTG_03570                                                            43.5       4e-04 
PPTG_23039                                                            41.6       0.002 
PPTG_22091                                                            37.7       0.010 
PPTG_05521                                                            37.7       0.010 
SDRG_11277                                                            35.8       0.057 
PPTG_23917                                                            34.7       0.10  
PYIW_26103                                                            38.9       0.11  
CCI47104                                                              36.6       0.39  
CCA15201                                                              36.2       0.79  
PPTG_24969                                                            31.6       2.2   
PYIW_26201                                                            33.9       3.1   
PYIW_17996                                                            33.9       3.4   
PYAR_23626                                                            33.1       6.8   
H257_04365                                                            32.7       8.8   

>PHYSO_480010
Length=653

 Score = 1225 bits (3169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/653 (100%), Positives = 653/653 (100%), Gaps = 0/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANPVLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD
Sbjct  601  KELEGVANPVLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD  653

>PHYSO_485614
Length=653

 Score = 1222 bits (3162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/653 (99%), Positives = 652/653 (99%), Gaps = 0/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPFKISSG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANPVLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD
Sbjct  601  KELEGVANPVLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD  653

>PHYSO_486085
Length=653

 Score = 1208 bits (3125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/653 (99%), Positives = 650/653 (99%), Gaps = 0/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP+VQADI+HWPFKISSG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VEYFVQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANPVLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGA +GPKI+EVD
Sbjct  601  KELEGVANPVLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGAGEGPKIDEVD  653

>PHYCA_104465
Length=653

 Score = 1191 bits (3081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/650 (94%), Positives = 626/650 (96%), Gaps = 1/650 (0%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+++SGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  245  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  364

Query  364  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  423
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  365  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  424

Query  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  425  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  484

Query  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANK RIEAK
Sbjct  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  544

Query  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603
            NALENYAYSLRNSLNDEK+KEKIPEADKK VDDKVTE IQWLDA+QS EK+ YE+KQKEL
Sbjct  545  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  604

Query  604  EGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            EGVANPVLQK+Y A+GG              +A  S+ G DQGPKIEEVD
Sbjct  605  EGVANPVLQKMY-ASGGGMAGGVPGGMPGADAAPTSSSGTDQGPKIEEVD  653

>PITG_11249
Length=653

 Score = 1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/653 (93%), Positives = 627/653 (96%), Gaps = 0/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPFKI++G GDKPQITVQFKGE+KTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+HF QEFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTI
Sbjct  241  VEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEI+RMVAEAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSEDEANKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAYSLRNSLNDEK+KEKIPEADKKVVDDKVTE IQW+DAHQSSEKEEYE+KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWMDAHQSSEKEEYESKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELE VANPVLQKVYA+AGG G    G            + GA+QGPKIEEVD
Sbjct  601  KELESVANPVLQKVYASAGGAGDGMPGSMPNDMPGTDSRSSGAEQGPKIEEVD  653

>PHYRA_72415
Length=655

 Score = 1189 bits (3077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/655 (95%), Positives = 640/655 (98%), Gaps = 2/655 (0%)

Query  1    MAQT-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            MAQ  TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNG  360

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQID
Sbjct  421  RNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQID  480

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMVAEAEKYKSEDEANKVR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVR  540

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEAKNALENYAYSLRNSLNDEKLKE+IPEADKKVVDDKVTETIQWLDAHQS+E EEYE+K
Sbjct  541  IEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESK  600

Query  600  QKELEGVANPVLQKVYaaaggmggmpggm-pagagasaapsaggaDQGPKIEEVD  653
            QKELEGVANP+LQK+YAAAGG  G  GG+     GA AAPS+GGADQGPKIEEVD
Sbjct  601  QKELEGVANPILQKMYAAAGGAPGAEGGVPGGMPGAGAAPSSGGADQGPKIEEVD  655

>PITG_11247
Length=653

 Score = 1188 bits (3074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/653 (93%), Positives = 626/653 (96%), Gaps = 0/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKFSDP+VQADIKHWPFKI++G GDKPQITVQFKGE+KTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+HF QEFKRKHRKD+T+NQRALRRLRTACERAKRTLSSS+QAYIEIDSLFDG+DFNSTI
Sbjct  241  VEHFVQEFKRKHRKDLTQNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEI+RMVAEAEKYKS DEANK RI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSADEANKARI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAYSLRNSLNDEK+KEKIPEADKKVVDDKVTE IQWLDAHQSSEKEEYE+KQ
Sbjct  541  EAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDAHQSSEKEEYESKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELE VANPVLQKVYA+AGG G    G   G        + GA+QGPKIEEVD
Sbjct  601  KELESVANPVLQKVYASAGGAGDGMPGGMPGDMPGTDSRSSGAEQGPKIEEVD  653

>PHYSO_344705
Length=798

 Score = 1188 bits (3073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/657 (95%), Positives = 635/657 (97%), Gaps = 4/657 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  142  MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  201

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP
Sbjct  202  QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  261

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  262  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  321

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  322  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  381

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  382  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  441

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  442  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  501

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  502  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  561

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  562  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  621

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMVAEAEKYKSEDEANKVRI
Sbjct  622  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRI  681

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAY+LRN+LNDEKLK++I E DKK +DDKVTETI WLDA+QS+EKEEYE KQ
Sbjct  682  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQ  741

Query  601  KELEGVANPVLQKVY----aaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANP+LQK+Y     A G  GGMPGGMP G   + AP AG  DQGPKIEEVD
Sbjct  742  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  798

>PHYCA_104335
Length=656

 Score = 1187 bits (3072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/652 (94%), Positives = 628/652 (96%), Gaps = 2/652 (0%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+++SGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  125  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  184

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  185  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  244

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  245  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  304

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  305  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  364

Query  364  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  423
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  365  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  424

Query  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  425  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  484

Query  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANK RIEAK
Sbjct  485  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  544

Query  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603
            NALENYAYSLRNSLNDEK+KEKIPEADKK VDDKVTE IQWLDA+QS EK+ YE+KQKEL
Sbjct  545  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  604

Query  604  EGVANPVLQKVYaaaggm--ggmpggmpagagasaapsaggaDQGPKIEEVD  653
            EGVANPVLQK+YAAAGG              G   AP AG A+QGPKIEEVD
Sbjct  605  EGVANPVLQKMYAAAGGSPGAEGGMPGGVPGGMPGAPPAGAAEQGPKIEEVD  656

>PPTG_02122
Length=657

 Score = 1186 bits (3069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/657 (95%), Positives = 634/657 (96%), Gaps = 4/657 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKI+SG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMVAEAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAY+LRN+LNDEKLK++I E DKK +DDKVTETI WLDA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQ  600

Query  601  KELEGVANPVLQKVY----aaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANP+LQK+Y     A G  GGMPGGMP G   + AP AG  DQGPKIEEVD
Sbjct  601  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  657

>PITG_11244
Length=663

 Score = 1186 bits (3068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/663 (92%), Positives = 626/663 (94%), Gaps = 10/663 (2%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKI++GAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAY+LRN+LNDEKLK++I E DKKV+DDKVTETI WLDA+QS+EKEEYE KQ
Sbjct  541  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKVIDDKVTETINWLDANQSAEKEEYEGKQ  600

Query  601  KELEGVANPVLQKVY----------aaaggmggmpggmpagagasaapsaggaDQGPKIE  650
            KELEGVANP+LQK+Y              G             A  AP AG  DQGPKIE
Sbjct  601  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGGMPGAAGGAPPAGAPDQGPKIE  660

Query  651  EVD  653
            EVD
Sbjct  661  EVD  663

>PHYRA_72463
Length=658

 Score = 1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 619/658 (94%), Positives = 635/658 (97%), Gaps = 5/658 (1%)

Query  1    MAQT-TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            MAQ  TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
            NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  240

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LVDHFTQEFKRKHRKDIT+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST
Sbjct  241  LVDHFTQEFKRKHRKDITDNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  300

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG
Sbjct  301  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  360

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA
Sbjct  361  KEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIA  420

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID
Sbjct  421  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  480

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANKVR
Sbjct  481  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVR  540

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEAKNALENYAY+LRN+LNDEKLK++I E DKK ++DKVTETI WLDA+QS+EKEEYE K
Sbjct  541  IEAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGK  600

Query  600  QKELEGVANPVLQKVY----aaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            QKELEGVANP+LQK+Y     A G  GGMPGGMP G   + AP AG  DQGPKIEEVD
Sbjct  601  QKELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  658

>PYAP_17334
Length=650

 Score = 1159 bits (2998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/653 (91%), Positives = 614/653 (94%), Gaps = 3/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPF +S GAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL KMREVAEAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLTKMREVAEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFVSEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EP KSINPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI R
Sbjct  361  EPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSA+EKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYK+EDEANK+RI
Sbjct  481  TFDIDANGILNVSAIEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKIRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKN LENYAY+LRN+LNDEKLK +IPE D+K +DDKVTE I WLDAHQ+SEKEE+EAKQ
Sbjct  541  EAKNGLENYAYNLRNTLNDEKLKSQIPEDDRKAIDDKVTEVINWLDAHQASEKEEFEAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEG+ANP+LQK+Y      G   G   A  GA     + G DQGPKIEEVD
Sbjct  601  KELEGIANPILQKMY---ASAGAAGGMPGAAPGAPGPAPSAGGDQGPKIEEVD  650

>PYU1_G013927
Length=649

 Score = 1152 bits (2980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/653 (91%), Positives = 620/653 (95%), Gaps = 4/653 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQAD KHWPF +S+G GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREV+EAFIGKEV+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVSEAFIGKEVRNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF QEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTI
Sbjct  241  VDHFVQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EP KSINPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLI+R
Sbjct  361  EPCKSINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLISR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMVAEAEKYK+EDE+NKVRI
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKN LENYAY+LRN+L+DEKLK +I E D+  ++DKVTETI WLDA+QS+EKEE+EAKQ
Sbjct  541  EAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANP+LQK+Y       G  GGMP GA  + AP AG  DQGPKIEEVD
Sbjct  601  KELEGVANPILQKMY----AAAGGAGGMPGGAPPAGAPPAGAPDQGPKIEEVD  649

>PHYCA_104429
Length=645

 Score = 1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/657 (92%), Positives = 623/657 (95%), Gaps = 16/657 (2%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP            K
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP------------K  348

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  349  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  408

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  409  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  468

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANKVRI
Sbjct  469  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRI  528

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAY+LRN+LNDEKLK++I E DKK ++DKVTETI WLDA+QS+EKEEYE KQ
Sbjct  529  EAKNALENYAYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQ  588

Query  601  KELEGVANPVLQKVY----aaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANP+LQK+Y     A G  GGMPGGMP G   + AP AG  DQGPKIEEVD
Sbjct  589  KELEGVANPILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  645

>SPRG_04533
Length=652

 Score = 1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/647 (89%), Positives = 608/647 (94%), Gaps = 0/647 (0%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  66
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSM  126
             NTVFDAKRLIGRKF+DP  QADIKHWPFK++ GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  367  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            NPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
            KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDA  485

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNAL  546
            NGILNVSAVEKSTGKENKITITNDKGRL++ +I+RMV EAEKYKSEDEANK+RIEAKN L
Sbjct  486  NGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  545

Query  547  ENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGV  606
            ENYAY+LRN+LNDEKL+ KI EADKK +DDKVT+ I WLDA+QS+EKEE+EAKQKELEG+
Sbjct  546  ENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGI  605

Query  607  ANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            ANP++QK+YAAAGG  G   G     G + AP      QGPKIEEVD
Sbjct  606  ANPIMQKMYAAAGGAPGGMPGGMPDMGGAGAPPPASHAQGPKIEEVD  652

>SDRG_11899
Length=652

 Score = 1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/647 (89%), Positives = 608/647 (94%), Gaps = 0/647 (0%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  66
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSM  126
             NTVFDAKRLIGRKF+DP  QADIKHWPFK++ GAGDKPQITV+FKGESKTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEISSM  125

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  246  EFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRARFE  305

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  367  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            NPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
            KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDA  485

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNAL  546
            NGILNVSAVEKSTGKENKITITNDKGRL++ +I+RMV EAEKYKSEDEANK+RIEAKN L
Sbjct  486  NGILNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  545

Query  547  ENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGV  606
            ENYAY+LRN+LNDEKL+ KI EADKK +DDKVT+ I WLDA+QS+EKEE+EAKQKELEG+
Sbjct  546  ENYAYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGI  605

Query  607  ANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            ANP++QK+YAAAGG  G   G     G + AP      QGPKIEEVD
Sbjct  606  ANPIMQKMYAAAGGAPGGMPGGMPDMGGAGAPPPASHAQGPKIEEVD  652

>H310_02610
Length=650

 Score = 1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/647 (89%), Positives = 613/647 (95%), Gaps = 2/647 (0%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  66
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSM  126
             NTVFDAKRLIGRKF+DP++QADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            VLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP KSI
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPCKSI  365

Query  367  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            NPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI RNTTVPT
Sbjct  366  NPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPT  425

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
            KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQ+DVTFDIDA
Sbjct  426  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQVDVTFDIDA  485

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNAL  546
            NGILNVSA+EKSTGKENKITITNDKGRL++ +I+RMV EAEKYKSEDEANKVRIEAKN L
Sbjct  486  NGILNVSAIEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKVRIEAKNGL  545

Query  547  ENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGV  606
            ENYAY+LRN+LNDEKL+ K+  ADKK VDDKVTETI WLDA+QS+EKEE+EAKQKELEGV
Sbjct  546  ENYAYNLRNTLNDEKLQGKLDAADKKTVDDKVTETISWLDANQSAEKEEFEAKQKELEGV  605

Query  607  ANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            ANP++QK+YAA G  GG  G    GAG +  P++    QGPKIEEVD
Sbjct  606  ANPIMQKLYAAGGAPGGPGGMPDFGAGGAPPPASSA--QGPKIEEVD  650

>PHYCA_532912
Length=626

 Score = 1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/652 (90%), Positives = 598/652 (92%), Gaps = 32/652 (5%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  5    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEI  123
            MNAHNTVFDAKRLIGRKFSDP+VQADIKHWPF+++SGAGDKPQITVQFKGESKTFQPEEI
Sbjct  65   MNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQPEEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
            SSMVLIKMRE                              DAGAIAGLNVLRIINEPTAA
Sbjct  125  SSMVLIKMRE------------------------------DAGAIAGLNVLRIINEPTAA  154

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH
Sbjct  155  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  214

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA
Sbjct  215  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  274

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363
            RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN
Sbjct  275  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  334

Query  364  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  423
            KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT
Sbjct  335  KSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTT  394

Query  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483
            VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  395  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  454

Query  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543
            IDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDEANK RIEAK
Sbjct  455  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAK  514

Query  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603
            NALENYAYSLRNSLNDEK+KEKIPEADKK VDDKVTE IQWLDA+QS EK+ YE+KQKEL
Sbjct  515  NALENYAYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKEL  574

Query  604  EGVANPVLQKVYaaaggm--ggmpggmpagagasaapsaggaDQGPKIEEVD  653
            EGVANPVLQK+YAAAGG              G   AP AG ADQGPKIEEVD
Sbjct  575  EGVANPVLQKMYAAAGGSPGAEGGMPGGVPGGMPGAPPAGAADQGPKIEEVD  626

>PYVX_15641
Length=629

 Score = 1095 bits (2833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/653 (88%), Positives = 600/653 (92%), Gaps = 24/653 (4%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVSGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPF ++SG GDKPQI VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+                        QVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDI------------------------QVHEVVLVGGSTRIPKVQQLLSDFFNGK  336

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI R
Sbjct  337  EPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIPR  396

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  397  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  456

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYK+EDEANKVRI
Sbjct  457  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKVRI  516

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            +AKN LENY+Y+LRN+LNDEKLK +I E D+K +DDKVTETI WLDA+QS+EKEE+EAKQ
Sbjct  517  DAKNGLENYSYNLRNTLNDEKLKSQISEEDRKAIDDKVTETINWLDANQSAEKEEFEAKQ  576

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEG+ANP+LQK+YAAAGG  G   G       + AP AGGADQGPKIEEVD
Sbjct  577  KELEGIANPILQKMYAAAGGAPGGMPGGGMPGADAGAPPAGGADQGPKIEEVD  629

>SDRG_11473
Length=636

 Score = 1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/611 (89%), Positives = 581/611 (95%), Gaps = 2/611 (0%)

Query  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            T+ YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  2    TTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKRLIGRKF D +VQADIKHWPFK++SGA DKPQITVQFKGESKTFQPEEIS
Sbjct  62   NATNTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEIS  121

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  122  SMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  181

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF
Sbjct  182  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  241

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
            T EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTITRAR
Sbjct  242  TAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTITRAR  301

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FED+C DYFRKTMEPVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGKEP K
Sbjct  302  FEDLCADYFRKTMEPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKEPCK  361

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
            SINPDEAVA+GATVQAAILSG+  S KLQDLLLLDV PLSLGLETAGGVMTTLIARNTTV
Sbjct  362  SINPDEAVAFGATVQAAILSGDTQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTV  421

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTYADNQPGVLIQV+EGERSMT DN+LLGKF+LDGIPPMPRGVPQ+DVTFDI
Sbjct  422  PTKKSQTFSTYADNQPGVLIQVYEGERSMTADNHLLGKFSLDGIPPMPRGVPQVDVTFDI  481

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGILNVSAVEKSTGKENKITITNDKGRLS+ +IDRMV EAEKYK++DEA+KVR+EAKN
Sbjct  482  DANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKN  541

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALENYAYSLRN+LNDEK+  KI   DKK +DD V++TI WLD +  +EKEE+EAKQKELE
Sbjct  542  ALENYAYSLRNTLNDEKV--KIDVNDKKRLDDMVSDTINWLDHNTHAEKEEFEAKQKELE  599

Query  605  GVANPVLQKVY  615
             VANP++QK+Y
Sbjct  600  AVANPIMQKMY  610

>SPRG_00068
Length=643

 Score = 1080 bits (2793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/653 (84%), Positives = 593/653 (91%), Gaps = 10/653 (2%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MA TT  YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD ERLIGDAAKN
Sbjct  1    MATTT--YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKN  58

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKF D +VQADIKHWPFK++ GA DKPQITV+FKGESKTFQP
Sbjct  59   QVAMNAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQP  118

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKM+E++EA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  119  EEISSMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  178

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  179  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  238

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFT EFKRKHRKD+T+NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTI
Sbjct  239  VDHFTAEFKRKHRKDMTQNQRALRRLRTACERAKRTLSASAQAYIEIDSLFDGVDFNSTI  298

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C DYFRKTM+PVEKVL+DAKLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGK
Sbjct  299  TRARFEDLCADYFRKTMDPVEKVLKDAKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  358

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EP KSINPDEAVA+GATVQAAILSG++ S KLQDLLLLDV PLSLGLETAGGVMTTLIAR
Sbjct  359  EPCKSINPDEAVAFGATVQAAILSGDNQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIAR  418

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQV+EGERSMT DNNLLGKF+LDGIPPMPRGVPQ+DV
Sbjct  419  NTTVPTKKSQTFSTYADNQPGVLIQVYEGERSMTADNNLLGKFSLDGIPPMPRGVPQVDV  478

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLS+ +IDRMV EAEKYK++DEA+KVR+
Sbjct  479  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRV  538

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAY+LRN+LNDEK+  KI   DKK +DD VT+TI WLD +  +EKEE+E KQ
Sbjct  539  EAKNALENYAYNLRNTLNDEKV--KIDADDKKRLDDMVTDTINWLDHNSHAEKEEFEGKQ  596

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELE VANP++QK+YA      G      A     +        QGP IEEVD
Sbjct  597  KELEAVANPIMQKMYAGGAPNAGGVPNGGAAPPTGSTT------QGPTIEEVD  643

>PYU1_G013931
Length=663

 Score = 1076 bits (2783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/610 (87%), Positives = 576/610 (94%), Gaps = 0/610 (0%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65
            +G SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTDTERLIGDAA+NQVAMN
Sbjct  12   TGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAMN  71

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            AHNTVFDAKRLIGRKF+DP+VQAD KHWPFK+ +GA  KPQI VQFKGESKTFQPEEISS
Sbjct  72   AHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEISS  131

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+E+AEA+IGK+VKNAVITVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAI
Sbjct  132  MVLTKMKEIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAI  191

Query  186  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNR+V++F 
Sbjct  192  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRIVEYFV  251

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
            QEFKRKHRKD+T NQRALRRLRTACERAKRTLSSS+QAYIEIDSLF+GIDFNSTITRARF
Sbjct  252  QEFKRKHRKDMTGNQRALRRLRTACERAKRTLSSSSQAYIEIDSLFEGIDFNSTITRARF  311

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            ED+C DYFRKTMEPVE+VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK+  KS
Sbjct  312  EDLCADYFRKTMEPVERVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKDLYKS  371

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            INPDEAVA+GATVQAAILSG+D S +LQDLLLLDV PLS+GLETAGGVMTTLI RNTTVP
Sbjct  372  INPDEAVAFGATVQAAILSGSDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTVP  431

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
            TKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDVTFDID
Sbjct  432  TKKSQTFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDID  491

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNA  545
            ANGILNVSAVEKSTGKENKITITNDKGRLSQ EIDRMV +AE+YK +DE NK+R+EAKN+
Sbjct  492  ANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVTDAERYKDQDERNKLRVEAKNS  551

Query  546  LENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEG  605
            LENYAYSLRNSL +EKL  K+   DKK++DDK+ ETI WLDA+Q++EKEE+  KQKELE 
Sbjct  552  LENYAYSLRNSLQEEKLASKLSADDKKLLDDKIAETINWLDANQAAEKEEFADKQKELES  611

Query  606  VANPVLQKVY  615
             ANP+LQ++Y
Sbjct  612  FANPILQRMY  621

>PYIW_16876
Length=643

 Score = 1076 bits (2783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/615 (87%), Positives = 578/615 (94%), Gaps = 0/615 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMN  NTVFDAKRLIGRKFSD +VQAD+KHWPFK+ +GA +KPQI V FKGE+KTFQP
Sbjct  61   QVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREV+EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI+GLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ FT EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VEFFTAEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LS+FFNGK
Sbjct  301  TRARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSEFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            +  KSINPDEAVA+GATVQAAILSGND S +LQDLLLLDV PLS+GLETAGGVMTTLI R
Sbjct  361  DLYKSINPDEAVAFGATVQAAILSGNDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+ LGKF+LDGIPPMPRGVPQIDV
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFSLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV EAE+YK  DE NK+R+
Sbjct  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVEEAERYKDADERNKLRV  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKNALENYAY LRNSL +EKL+ K+   DKK ++DK+ ETI WLDA+Q++EK+E++AKQ
Sbjct  541  EAKNALENYAYGLRNSLQEEKLQAKLAADDKKTLEDKIAETIAWLDANQAAEKDEFDAKQ  600

Query  601  KELEGVANPVLQKVY  615
            KELE VA+P+LQK+Y
Sbjct  601  KELESVASPILQKMY  615

>PYAP_19235
Length=643

 Score = 1071 bits (2771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/648 (83%), Positives = 584/648 (90%), Gaps = 9/648 (1%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65
            SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  5    SGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  64

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            AHNTVFDAKRLIGRKF+DP+VQAD+KHWPFK+ +GAGDKPQITV+FKGE K FQPEEISS
Sbjct  65   AHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEEISS  124

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+E+AEA++G +VKNAVITVPAYFNDSQRQAT+DAG IAGLNV+RIINEPTAAAI
Sbjct  125  MVLTKMKEIAEAYLGTDVKNAVITVPAYFNDSQRQATRDAGTIAGLNVMRIINEPTAAAI  184

Query  186  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
            AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV++F 
Sbjct  185  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVEYFV  244

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             EFKRKH+KD+T NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDGIDFNSTITRARF
Sbjct  245  AEFKRKHKKDLTTNQRALRRLRTACERAKRTLSSSTQAYVEIDSLFDGIDFNSTITRARF  304

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            EDMC DYFRKTMEPVEKVL DAK+ K QVHEVVLVGGSTRIPKVQQLL DFFNGKEP KS
Sbjct  305  EDMCADYFRKTMEPVEKVLHDAKICKGQVHEVVLVGGSTRIPKVQQLLVDFFNGKEPCKS  364

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            INPDEAVA+GA VQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLI RNT VP
Sbjct  365  INPDEAVAFGAAVQAAILSGDDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNTAVP  424

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
            TKKSQTFSTYADNQPGVLIQVFEGERSMT+DNNLLGKF+LDGIPPMPRG P+I+VTFDID
Sbjct  425  TKKSQTFSTYADNQPGVLIQVFEGERSMTKDNNLLGKFSLDGIPPMPRGKPEIEVTFDID  484

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNA  545
            ANGILNVSAVEKSTGK+NKITITNDKGRLSQ+EIDRMV EAEKY  ED  NK R++AKN 
Sbjct  485  ANGILNVSAVEKSTGKDNKITITNDKGRLSQSEIDRMVKEAEKYAKEDADNKARVDAKNT  544

Query  546  LENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEG  605
            LENYAY+LRNSL+D  +K+++ E D+K +DD V+ETI+WLDAHQ SEK+EYE KQKELEG
Sbjct  545  LENYAYNLRNSLDDAPVKQQMNEDDRKKIDDAVSETIKWLDAHQMSEKQEYEMKQKELEG  604

Query  606  VANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            +ANP+LQK+YA             A   ++          GPKIEEVD
Sbjct  605  IANPILQKMYANGAAAANAGEAPSASTESTG---------GPKIEEVD  643

>CCI43221
Length=660

 Score = 1067 bits (2760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/615 (86%), Positives = 578/615 (94%), Gaps = 1/615 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQV-SGPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  59

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGR+ SDP+VQADIKHWPFK++S  GDK  ITVQ+KGE+K+F+P
Sbjct  60   QVAMNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRP  119

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEAF+GK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  120  EEISSMVLIKMREIAEAFLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  179

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  180  TAAAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  239

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EF RKHRKDIT NQRALRRLRTACERAKRTLSSSAQA+IEIDSLF+G+DFNSTI
Sbjct  240  VDHFVAEFNRKHRKDITTNQRALRRLRTACERAKRTLSSSAQAHIEIDSLFEGVDFNSTI  299

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGK
Sbjct  300  TRARFEDLCADYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGK  359

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E  KSINPDEAVA+GATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI R
Sbjct  360  ELCKSINPDEAVAFGATVQAAILSGTEQSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPR  419

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTT+PTKKSQ FSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V
Sbjct  420  NTTLPTKKSQMFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEV  479

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSA+EKST KENKITITNDKGRLSQA+IDRMV+EAEKYK EDEAN++RI
Sbjct  480  TFDIDANGILNVSAIEKSTNKENKITITNDKGRLSQADIDRMVSEAEKYKKEDEANRIRI  539

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKN LENYA++LR++L+DEK+K +I   D+  V++KV E + WLDA+QS+EKEE+E KQ
Sbjct  540  EAKNGLENYAFNLRSTLDDEKIKNQISPEDRTTVENKVKEVVSWLDANQSAEKEEFEHKQ  599

Query  601  KELEGVANPVLQKVY  615
            K+LE VANP++QK+Y
Sbjct  600  KDLEAVANPIMQKMY  614

>CCI40249
Length=660

 Score = 1063 bits (2748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/607 (87%), Positives = 569/607 (94%), Gaps = 0/607 (0%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEISSMVL  124

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            +KMREV+EA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  368
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  369  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  428
            DEAVA+GATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  429  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  488
            SQ FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  489  ILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALEN  548
            ILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYK +DEANKVRIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  549  YAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVAN  608
            YAY+LRNSLNDEKLK ++ E D+KV+DDK++ET+ WLDA+QS+EKEEYE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKVLDDKISETMSWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  609  PVLQKVY  615
            P+LQK+Y
Sbjct  605  PILQKMY  611

>PITG_11252
Length=654

 Score = 1061 bits (2743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/654 (82%), Positives = 591/654 (90%), Gaps = 1/654 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MPEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPF +  GA  KPQ+ VQFKGE KTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTI
Sbjct  241  VEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C +YFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL DFFNGK
Sbjct  301  TRARFEDLCSEYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E  KSINPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVP+KK+Q+FSTYADNQ GVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPSKKTQSFSTYADNQSGVLIQVFEGERTMTRDNHHLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ++IDRMVA+AEKYK +DE NK+R+
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVADAEKYKDQDERNKLRV  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            E+KNALENYA+SLRNS  +EK+  K+ E DKK ++DKV ET+ WLDA+Q++EKEE++AKQ
Sbjct  541  ESKNALENYAFSLRNSTREEKIAAKLSEEDKKSIEDKVAETLHWLDANQAAEKEEFDAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsagga-DQGPKIEEVD  653
            +ELEGVANP+LQK+YA+  G G    G         + +     ++GPKIEEVD
Sbjct  601  QELEGVANPILQKIYASEAGAGMGGMGGAGPRPGGPSGAGSADGEEGPKIEEVD  654

>CCA16153
Length=663

 Score = 1060 bits (2740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/607 (87%), Positives = 568/607 (94%), Gaps = 0/607 (0%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA N
Sbjct  5    AIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAAN  64

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGR FSDPIVQAD+KHWPF + +G G+KP I V FKGE K FQPEEISSMVL
Sbjct  65   TVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEISSMVL  124

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            +KMREV+EA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG
Sbjct  125  VKMREVSEAYIGKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  184

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            L+KKG E NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  185  LEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVDHFVAEF  244

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRKHRKDIT NQRALRRLRT+CERAKRTLSSSAQAYIEIDSL DGIDFNS+ITRARFED+
Sbjct  245  KRKHRKDITTNQRALRRLRTSCERAKRTLSSSAQAYIEIDSLADGIDFNSSITRARFEDL  304

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  368
            C DYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN KEP KSINP
Sbjct  305  CSDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNNKEPCKSINP  364

Query  369  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  428
            DEAVA+GATVQAAILSGND SEKLQDLLLLDV PLSLGLETAGGVMT LI RNTT+PTKK
Sbjct  365  DEAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKK  424

Query  429  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  488
            SQ FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANG
Sbjct  425  SQLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANG  484

Query  489  ILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALEN  548
            ILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYK +DEANKVRIEAKN LEN
Sbjct  485  ILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLEN  544

Query  549  YAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVAN  608
            YAY+LRNSLNDEKLK ++ E D+K++DDK++ET+ WLDA+QS+EKEEYE  QK+LE +AN
Sbjct  545  YAYNLRNSLNDEKLKSQLSEDDRKILDDKISETMNWLDANQSAEKEEYEKLQKDLEAIAN  604

Query  609  PVLQKVY  615
            P+LQK+Y
Sbjct  605  PILQKMY  611

>HYAP_01537
Length=651

 Score = 1059 bits (2738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/653 (82%), Positives = 590/653 (90%), Gaps = 2/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M ++ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT++ERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP VQ+DIKHWPFK++  + DKPQ+ VQFKGE+K FQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEA+IGK+V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLLSIE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF  EFKRKHRKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSL DGIDFN+TI
Sbjct  241  VDHFVSEFKRKHRKDMTLNQRALRRLRTACERAKRTLSTSAQAYIEIDSLLDGIDFNTTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C D+FRKTMEPV +VLRD+KLSK +VHE+VLVGGSTRIPKVQQLL DFFNGK
Sbjct  301  TRARFEDLCADFFRKTMEPVAQVLRDSKLSKGEVHEIVLVGGSTRIPKVQQLLIDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E  KSINPDEAVAYGATVQAAILSG  +S KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGGGASSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVP KKSQ+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKSQSFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFSLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV +AE YK +DE NK+R+
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVNDAETYKDQDERNKLRV  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            E+KN LENYA+S+R S++DEK+  K+   DKK+V+DKV E +QWLDA+ S+EKEE +AKQ
Sbjct  541  ESKNGLENYAFSVRTSVSDEKIAVKLSTDDKKIVEDKVAEILQWLDANHSAEKEEIDAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEGVANP++QK+YAA  G G   G   A    ++  +     +GPKIEEVD
Sbjct  601  KELEGVANPIMQKIYAAEAGAGMGGGATGASGPGASFGAKDK--EGPKIEEVD  651

>PYAP_17333
Length=657

 Score = 1056 bits (2731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/610 (86%), Positives = 573/610 (94%), Gaps = 0/610 (0%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT TERLIGDAAKNQVAMN
Sbjct  7    TGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAKNQVAMN  66

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            AHNTVFDAKRLIGRKF DP+VQAD+KHWPF++ +G  DKPQI V+FKGESK F  EEISS
Sbjct  67   AHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFYAEEISS  126

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KMR++AEA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  127  MVLTKMRDIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  186

Query  186  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
            AYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV++F 
Sbjct  187  AYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVEYFV  246

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             EFKRKHR+D++ NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++GIDFNSTITRARF
Sbjct  247  GEFKRKHRRDMSNNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGIDFNSTITRARF  306

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            ED+CGD+FRKTMEPVE+VLRD+KLSKSQV EVVLVGGSTRIPK+QQ+LSD+FNGKE  KS
Sbjct  307  EDLCGDFFRKTMEPVERVLRDSKLSKSQVQEVVLVGGSTRIPKIQQMLSDYFNGKELYKS  366

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            INPDEAVA+GATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVP
Sbjct  367  INPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVP  426

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
            TKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDG+PPMPRGVPQIDVTFDID
Sbjct  427  TKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDGLPPMPRGVPQIDVTFDID  486

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNA  545
            ANGILNVSAVEKSTGKENKITITNDKGRLSQ EIDRMV EAEKYK +DE NK+R+EAKNA
Sbjct  487  ANGILNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVQEAEKYKDQDERNKLRVEAKNA  546

Query  546  LENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEG  605
            LENYA+SLR+++ DEKL  K+ + DKK +D  V   I+WLD HQ++EKEEY+AK KELEG
Sbjct  547  LENYAFSLRSAVQDEKLVMKLDQDDKKTIDSAVNGVIEWLDQHQAAEKEEYDAKMKELEG  606

Query  606  VANPVLQKVY  615
            VANP++QK+Y
Sbjct  607  VANPIMQKLY  616

>PHYSO_482793
Length=658

 Score = 1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/658 (82%), Positives = 596/658 (91%), Gaps = 5/658 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEPVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK++ G  +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F QEFKRKHR+D++ N RA+RRLRTACERAKRTLS+SAQAYIEIDSL DG DFNSTI
Sbjct  241  VEYFVQEFKRKHRRDLSVNSRAMRRLRTACERAKRTLSTSAQAYIEIDSLLDGTDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C ++FRKTM+PV +VLRD+KLSK+QV+EVVLVGGSTRIPKVQQLL DFFNGK
Sbjct  301  TRARFEDLCNEFFRKTMDPVAQVLRDSKLSKNQVNEVVLVGGSTRIPKVQQLLVDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E  KSINPDEAVAYGATVQAAILSGNDSS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGNDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTT+P+KK+Q+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTIPSKKTQSFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMVA+AEKYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVADAEKYKDQDERNKLRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            E+KNALENYA+SLR+S  +EKL  K+ E DKK ++ KV +T+ WLDA+Q++EKEE++AKQ
Sbjct  541  ESKNALENYAFSLRSSTREEKLAAKLSEDDKKTIEYKVADTLHWLDANQAAEKEEFDAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsagga-----DQGPKIEEVD  653
            +ELE +ANP+LQKVYAA  G G   GGM     A A     G      D+GPKIEEVD
Sbjct  601  QELESMANPILQKVYAAEAGAGAGMGGMGGATAAGAGAGPHGPGGADGDEGPKIEEVD  658

>PHALS_09802
Length=651

 Score = 1043 bits (2696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/653 (81%), Positives = 591/653 (91%), Gaps = 2/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M++  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MSEPITGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+D  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMRE+AEAFIGK+V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE +VLIFDLGGGTFDVSLL+IEEGIFEV ATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHHVLIFDLGGGTFDVSLLTIEEGIFEVMATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F  EFKRKHRKD++ NQRALRRLRTACERAKRTLS+SAQAY+EIDSLFDGIDFNSTI
Sbjct  241  VEYFVAEFKRKHRKDLSVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C +YFRKTM+PV +VLRD+KLSKSQV+E+VLVGGSTRIPKVQQ+L DFFNGK
Sbjct  301  TRARFEDLCAEYFRKTMDPVAQVLRDSKLSKSQVNEIVLVGGSTRIPKVQQMLMDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            +  KSINPDEAVAYGATVQAAILSG++SS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  DLFKSINPDEAVAYGATVQAAILSGSESSAKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVP KK Q+FSTY DNQ GVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKMQSFSTYTDNQSGVLIQVFEGERTMTRDNHLLGKFSLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ+EIDRMVA+A+KYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADADKYKDQDERNKLRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            E+KN+LEN+A+SLR+S+NDEK+  KI   D+K++D KV ET+QWL+A+Q++EK E++AKQ
Sbjct  541  ESKNSLENFAFSLRSSINDEKVVAKISAEDRKLIDGKVAETLQWLEANQAAEKGEFDAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            +ELEGVANP++QK+Y  A   G   GGM   A       A   + GPKIEEVD
Sbjct  601  QELEGVANPIMQKMY--AAEAGTGMGGMGRAANGPKGDKAPEGNAGPKIEEVD  651

>H257_12958
Length=649

 Score = 1043 bits (2696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/607 (85%), Positives = 568/607 (94%), Gaps = 0/607 (0%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  N
Sbjct  8    SVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  67

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TVFDAKRLIGRKF+DP++QADIKHWPFK+ +GAGDKPQI V+FKGE KTFQPEEISSMVL
Sbjct  68   TVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            IKM+EVAEA++G +V+NAVITVPAYFNDSQRQATKDAGAIAGL V+RIINEPTAAAIAYG
Sbjct  128  IKMKEVAEAYLGLDVQNAVITVPAYFNDSQRQATKDAGAIAGLTVMRIINEPTAAAIAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF  EF
Sbjct  188  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVDEF  247

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDM  308
            KRK+RKD+  NQRALRRLRTA ERAKRTLSSS QA++EIDSLFDGID+N+TITRARFED+
Sbjct  248  KRKYRKDMKTNQRALRRLRTASERAKRTLSSSTQAHLEIDSLFDGIDYNTTITRARFEDL  307

Query  309  CGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINP  368
            C DYFRKTM PVE VLRDAKLSK+QV+EVVLVGGSTRIPKVQQLLSDFFNGKE  KSINP
Sbjct  308  CSDYFRKTMGPVETVLRDAKLSKNQVNEVVLVGGSTRIPKVQQLLSDFFNGKELYKSINP  367

Query  369  DEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKK  428
            DEAVA+GATVQAAILSG   S+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK
Sbjct  368  DEAVAFGATVQAAILSGTSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK  427

Query  429  SQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  488
            SQTFSTYADNQPGVLIQVFEGER MT+DNNLLGKF+LDG+PPMPRG+PQ+DVTFDIDANG
Sbjct  428  SQTFSTYADNQPGVLIQVFEGERVMTKDNNLLGKFSLDGLPPMPRGMPQVDVTFDIDANG  487

Query  489  ILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALEN  548
            ILNVSAVEKSTGKENKITITNDKGRLS+ EIDRMV +AEKYK+EDE N+ RIEAKN LEN
Sbjct  488  ILNVSAVEKSTGKENKITITNDKGRLSKDEIDRMVNDAEKYKAEDEKNRARIEAKNGLEN  547

Query  549  YAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVAN  608
            YAYSLRN+LND+K+K  +  ADKK ++DKV +TI W+D + ++EK+E+EAKQ+ELE VAN
Sbjct  548  YAYSLRNTLNDDKIKGAVDPADKKTLEDKVADTIAWMDRNLAAEKDEFEAKQQELESVAN  607

Query  609  PVLQKVY  615
            P++QK+Y
Sbjct  608  PIMQKLY  614

>PHYRA_71655
Length=653

 Score = 1042 bits (2694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/653 (81%), Positives = 588/653 (90%), Gaps = 0/653 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M ++ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DI+HWPFK++ G  +KP++ VQFKGE  TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTI
Sbjct  241  VEFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQLL DFFNGK
Sbjct  301  TRARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQLLIDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            +  KSINPDEA+AYGATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  KLFKSINPDEAIAYGATVQAAILSGHDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVP KK+Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFD+D NGILNVSAVEKSTGKENKI ITNDKGRLSQ+EI+RMV +AEKYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            E+KNALENYA+SLR+S  DEK+  K+ + DKK ++DKV ET+ WLDA+Q++ KEE++AKQ
Sbjct  541  ESKNALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQ  600

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            +ELEGV NP++QK+Y AA G     GG   G GA +     G D GPKIEEVD
Sbjct  601  QELEGVTNPIMQKIYTAASGAASGMGGAGTGGGAPSGAGGAGGDDGPKIEEVD  653

>H310_09557
Length=644

 Score = 1040 bits (2690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/653 (81%), Positives = 588/653 (90%), Gaps = 9/653 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MA+T    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAKTEQ--SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  58

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMN  NTVFDAKRLIGRKF+DP++QADIKHWPFK+ +G GDKPQI V+FKGESKTFQP
Sbjct  59   QVAMNPSNTVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQP  118

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKM++VAEAFIG EV+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  119  EEISSMVLIKMKQVAEAFIGVEVQNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  178

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAG+THLGGEDFDNRL
Sbjct  179  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGNTHLGGEDFDNRL  238

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFT EFKRK++ D+  NQRALRRLRTACERAKRTLSSS QAY+EIDSLFDG+D+N+TI
Sbjct  239  VDHFTDEFKRKYKGDLKTNQRALRRLRTACERAKRTLSSSTQAYLEIDSLFDGMDYNTTI  298

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C DYFRKTMEPV+ VL+DAKLSK+QVHEVVLVGGSTRIPKVQQLLSDFF+GK
Sbjct  299  TRARFEDLCSDYFRKTMEPVKSVLQDAKLSKNQVHEVVLVGGSTRIPKVQQLLSDFFHGK  358

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E  KSINPDEAVA+GATVQAAILSG+  S+KLQDLLLLDVTPLSLGLETAGGVMTTLI+R
Sbjct  359  ELYKSINPDEAVAFGATVQAAILSGSSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLISR  418

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQV+EGER+MT DN+LLGKF+LDG+PPMPRGVPQ+DV
Sbjct  419  NTTVPTKKSQTFSTYADNQPGVLIQVYEGERTMTHDNHLLGKFSLDGLPPMPRGVPQVDV  478

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLS+ EI+RMV +AEKYK+ED  NK R+
Sbjct  479  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSKDEIERMVNDAEKYKAEDTKNKERV  538

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKN LENYAYSLRN+L +EK++  +   DKKV++DKV + I W+D + ++EK+EYE KQ
Sbjct  539  EAKNGLENYAYSLRNTLQEEKIQGAMDAGDKKVLEDKVHDIISWMDRNLAAEKDEYEGKQ  598

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            +ELE VANP+LQKV+A+ GG          G   S A        GPKIEEVD
Sbjct  599  QELESVANPILQKVHASGGGGTPGGMPGSQGPSTSGA-------DGPKIEEVD  644

>PHYCA_104444
Length=644

 Score = 1035 bits (2676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/654 (79%), Positives = 574/654 (88%), Gaps = 11/654 (2%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEAVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  G   KP + VQFKGE +TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL+KMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F  EFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VEFFVLEFKRKYRKDMTGNQRALRRLRTACERAKRTLSTSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C +YFRKTM PV +VL+D+KLSK+ V+EVVLVGGSTRIPKVQQLL +FFNGK
Sbjct  301  TRARFEDLCSEYFRKTMGPVAQVLQDSKLSKNHVNEVVLVGGSTRIPKVQQLLMEFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp-lslglETAGGVMTTLIA  419
            E  KSINPDEAVAYGATVQAAILSG+ +       LLL     LSLGLETAGGVMT LI 
Sbjct  361  ELFKSINPDEAVAYGATVQAAILSGSGNMSSKLQDLLLLDVAPLSLGLETAGGVMTKLIP  420

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNTTVP KK+Q+FSTY+DNQ GVLIQVFEGERS+T+DN+LLGKFNLDGIPPM RGVPQID
Sbjct  421  RNTTVPAKKTQSFSTYSDNQSGVLIQVFEGERSLTQDNHLLGKFNLDGIPPMQRGVPQID  480

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ+EIDRMVA+AEKYK +DE NK+R
Sbjct  481  VTFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLR  540

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IE+KNALENYA+SLR+S+ ++KL  K+  ADKK ++DKV ET+QWLDA+Q++EKEE+++K
Sbjct  541  IESKNALENYAFSLRSSMKEDKLATKLSAADKKTIEDKVAETLQWLDANQAAEKEEFDSK  600

Query  600  QKELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            Q+ELEGVANP++QKVY                  A     +GG D GPKIEEVD
Sbjct  601  QQELEGVANPIMQKVY----------AAEVDKGTAPDGRGSGGDDNGPKIEEVD  644

>PHYKE_7016
Length=650

 Score = 1030 bits (2663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/615 (83%), Positives = 569/615 (93%), Gaps = 1/615 (0%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            +   +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  3    SSVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  62

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPE  121
            VAMNAHNTVFDAKRLIGRKFSD  VQ+DIKHWPFK+  G  +KPQ+ VQFKGESKTFQPE
Sbjct  63   VAMNAHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQPE  122

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMVLIKMREVAEAFIGK+VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT
Sbjct  123  EISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  182

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAAIAYGLDKK GE NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  183  AAAIAYGLDKKRGEHNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  242

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            ++F  +FKRKHRKD++ + RA+RRLRTACERAKRTLS+SAQAYIEIDSLFDG+DFNSTIT
Sbjct  243  EYFVTDFKRKHRKDMSTSSRAMRRLRTACERAKRTLSTSAQAYIEIDSLFDGVDFNSTIT  302

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RARFE +C D+FRKTMEPV +VL DAKLSK  V EVVLVGGSTRIPKVQQLL+DFF+GKE
Sbjct  303  RARFESLCDDFFRKTMEPVAQVLHDAKLSKGHVQEVVLVGGSTRIPKVQQLLTDFFHGKE  362

Query  362  PNKSINPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIAR  420
              KSINPDEAVA+GATVQAAILSG  D+S KLQDLLLLDV PLSLGLETAGGVMTTLIAR
Sbjct  363  LFKSINPDEAVAFGATVQAAILSGAGDTSSKLQDLLLLDVAPLSLGLETAGGVMTTLIAR  422

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVP+KKSQTFSTY+DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPM RG+PQIDV
Sbjct  423  NTTVPSKKSQTFSTYSDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMRRGIPQIDV  482

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ EIDRMVAEA+K+K +D  NK+RI
Sbjct  483  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQDEIDRMVAEADKFKDQDARNKLRI  542

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            E+KN++ENYA+SLR+S+ +EKL  K+   DK+V++DKV E + WL+ +Q++EKEE++AKQ
Sbjct  543  ESKNSVENYAFSLRSSIREEKLAVKLTAEDKQVIEDKVAEVLSWLEVNQAAEKEEFDAKQ  602

Query  601  KELEGVANPVLQKVY  615
            KELE VANP+++K++
Sbjct  603  KELEDVANPIMEKIF  617

>PYAR_19807
Length=1613

 Score = 1023 bits (2646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/614 (83%), Positives = 559/614 (91%), Gaps = 12/614 (2%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            A   +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQ
Sbjct  4    ASVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  63

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPE  121
            VAMNAHNTVFDAKRLIGRKF+D +VQADIKHWPF++ + + +KPQI VQFKGE+K F  E
Sbjct  64   VAMNAHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKFYAE  123

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMVL KMR+VAEAFIGK+VKNA            RQATKDAGAIAGLNVLRIINEPT
Sbjct  124  EISSMVLTKMRDVAEAFIGKQVKNA------------RQATKDAGAIAGLNVLRIINEPT  171

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  172  AAAIAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLV  231

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            ++F  EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL++G+DFNSTIT
Sbjct  232  EYFVGEFKRKHRKDMTSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYEGVDFNSTIT  291

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RARFED+C D+FRKTMEPVE+VLRDAKLSK+QV EVVLVGGSTRIPK+QQLLSDFFNGKE
Sbjct  292  RARFEDLCADFFRKTMEPVERVLRDAKLSKNQVQEVVLVGGSTRIPKIQQLLSDFFNGKE  351

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
              KSINPDEAVA+GATVQAAILSG+D S KLQDLLLLDVTPLSLGLETAGGVMTTLIARN
Sbjct  352  LYKSINPDEAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARN  411

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
            TTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LD +PPMPRGVPQIDVT
Sbjct  412  TTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDALPPMPRGVPQIDVT  471

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
            FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ EIDRMV+EAE YK +DE NK+R+E
Sbjct  472  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQQEIDRMVSEAETYKDQDERNKLRVE  531

Query  542  AKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQK  601
            AKN LENYA++LRNSL D+K+  K+ + DKK + D + E + WLD HQ++EKEEY+AKQK
Sbjct  532  AKNGLENYAFTLRNSLQDDKVTAKLGDEDKKTLGDAIAEVVAWLDGHQAAEKEEYDAKQK  591

Query  602  ELEGVANPVLQKVY  615
            ELE VA P+LQK+Y
Sbjct  592  ELENVATPILQKMY  605

>CCA14967
Length=1431

 Score = 1008 bits (2605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/595 (84%), Positives = 550/595 (92%), Gaps = 7/595 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
             IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA NTV
Sbjct  22   SIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAINTV  81

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            FDAKRLIGR+ SDP+VQADIKHWPFK++S  GDKP ITVQ+KGE+K+F+PEEISSMVLIK
Sbjct  82   FDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRPEEISSMVLIK  141

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            MRE+A+A++G +VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD
Sbjct  142  MREIAQAYLGNDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  201

Query  191  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  250
            +KGGERN+LIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHF  EF R
Sbjct  202  RKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFVAEFNR  261

Query  251  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            KHRKDI  NQRALRRLRTACERAKRTLSSSAQA IEIDSLF+G+DFNSTITRARFED+CG
Sbjct  262  KHRKDIATNQRALRRLRTACERAKRTLSSSAQAQIEIDSLFEGVDFNSTITRARFEDLCG  321

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDE  370
            DYFR+TMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLS+FFNGK+  KSINPDE
Sbjct  322  DYFRRTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSEFFNGKDLCKSINPDE  381

Query  371  AVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  430
            AVA+GATVQAAILSG + SEKLQDLLLLDV PLSLGLETAGGVMTTLI RNTT+PTKKSQ
Sbjct  382  AVAFGATVQAAILSGTEKSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTLPTKKSQ  441

Query  431  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  490
            TFSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+VTFDIDANGIL
Sbjct  442  TFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGIL  501

Query  491  NVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYA  550
            NVSAVEKST KENKITITNDKGRLSQA+ID MV+EAEKYK EDEAN++R+EAKN LENY 
Sbjct  502  NVSAVEKSTNKENKITITNDKGRLSQADIDLMVSEAEKYKKEDEANRIRVEAKNGLENYT  561

Query  551  YSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL------DAHQSSEKE-EYEA  598
            ++LR++L+DEK+K +I   D+  +++KV E + WL      D +Q S+ E ++EA
Sbjct  562  FNLRSTLDDEKIKNQISPEDRTTIENKVKEVVSWLLQCREEDTNQMSKDEPKWEA  616

>PYIR_15859
Length=626

 Score = 1004 bits (2596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/614 (83%), Positives = 552/614 (90%), Gaps = 28/614 (5%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            AQ T G +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
Sbjct  7    AQVT-GQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ  65

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPE  121
            VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+S GAGDKPQITV+FKGE+KTFQPE
Sbjct  66   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPE  125

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMVLIKM+E++EA+IGK+VKNAVITVPAYFNDSQRQATKDAG IAGLN         
Sbjct  126  EISSMVLIKMKEISEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVIAGLN---------  176

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
                       GGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLV
Sbjct  177  -----------GGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLV  225

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            + FT EFKRK +KD+T+NQR+LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT
Sbjct  226  EFFTAEFKRKFKKDMTQNQRSLRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  285

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RARFED+C DYFRKTMEPVE+VLRDAKLSK QV+E+VLVGGSTRIPKVQQ+LSDFFNGK+
Sbjct  286  RARFEDLCADYFRKTMEPVERVLRDAKLSKRQVNEIVLVGGSTRIPKVQQMLSDFFNGKD  345

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
              KSINPDEAVA+GATVQAAILSG D S +LQDLLLLDV PLSLGLETAGGVMTTLI   
Sbjct  346  LYKSINPDEAVAFGATVQAAILSGADKSSRLQDLLLLDVAPLSLGLETAGGVMTTLIP--  403

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
                     TFSTYADNQPGVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDVT
Sbjct  404  -----XXXXTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFNLDGIPPMPRGVPQIDVT  458

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
            FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ +IDRMVAEAEKYK  DE NK+R+E
Sbjct  459  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQEDIDRMVAEAEKYKDADERNKLRVE  518

Query  542  AKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQK  601
            AKNALENYAY LRNSL +EK++ K+   DKK VDDK+TETI WLDA+Q++EKEE++AKQK
Sbjct  519  AKNALENYAYGLRNSLQEEKIQAKLSADDKKRVDDKITETIAWLDANQAAEKEEFDAKQK  578

Query  602  ELEGVANPVLQKVY  615
            ELEGVANP+LQK+Y
Sbjct  579  ELEGVANPILQKMY  592

>PPTG_19690
Length=566

 Score = 989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/564 (88%), Positives = 530/564 (94%), Gaps = 0/564 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V++F QEFKRK+RKD+T NQRALRRLRTACERAKRTLS+SAQAY+EIDSL DGIDFNSTI
Sbjct  241  VEYFVQEFKRKYRKDMTVNQRALRRLRTACERAKRTLSTSAQAYLEIDSLLDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFED+C DYFRKTMEPV +VLRD+KLSK+QV E+VLVGGSTRIPKVQQLL  FFNGK
Sbjct  301  TRARFEDLCSDYFRKTMEPVAQVLRDSKLSKNQVDEIVLVGGSTRIPKVQQLLMGFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            +  KSINPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAGGVMT LI R
Sbjct  361  DLFKSINPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVP KK+QTFSTY DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDV
Sbjct  421  NTTVPAKKTQTFSTYTDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDV  480

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFD+D NGILNVSAVEKSTGKENKITITNDKGRLSQ+EIDRMVA+AEKYK +DE NK+RI
Sbjct  481  TFDVDVNGILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLRI  540

Query  541  EAKNALENYAYSLRNSLNDEKLKE  564
            E+KNALENYA+SLRNS  +EK +E
Sbjct  541  ESKNALENYAFSLRNSTREEKGQE  564

>CCI40247
Length=643

 Score = 989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/652 (74%), Positives = 556/652 (85%), Gaps = 13/652 (2%)

Query  3    QTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            +  SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAKNQV
Sbjct  4    KAVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQV  63

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEE  122
            AMNA NTVFDAKRLIGRKF D  VQ D KHWPF++  G  DKPQI V+ KG  K F  EE
Sbjct  64   AMNAENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFYAEE  123

Query  123  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  182
            IS+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NEPTA
Sbjct  124  ISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNEPTA  183

Query  183  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  242
            AAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNRLV+
Sbjct  184  AAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNRLVE  243

Query  243  HFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  302
            HF  EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNSTITR
Sbjct  244  HFLAEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNSTITR  303

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            ARFED+C DYFRKTMEPVEKVLRDAKL+K+Q+HE+VLVGGSTRIPKVQQ+LSDFFNGKE 
Sbjct  304  ARFEDLCSDYFRKTMEPVEKVLRDAKLAKNQLHEIVLVGGSTRIPKVQQMLSDFFNGKEL  363

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtp-lslglETAGGVMTTLIARN  421
             KSINPDEAVAYGATVQAAILSG     +    ++L     LS+GLETAGGVMT LIARN
Sbjct  364  YKSINPDEAVAYGATVQAAILSGGSDQSERLQNVVLLDVAPLSMGLETAGGVMTVLIARN  423

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
            TTVPT+KSQTFSTYADNQ GVLIQV+EGERSMTRDN+LLGKFNL+GIPPMPRGVPQI+VT
Sbjct  424  TTVPTRKSQTFSTYADNQSGVLIQVYEGERSMTRDNHLLGKFNLEGIPPMPRGVPQIEVT  483

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
            F++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ EIDRMV EA+ YK +DE NK+R+E
Sbjct  484  FEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKLRVE  543

Query  542  AKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQK  601
            +KN LE+Y + +RN++ D K+   + + DKK ++ K+ +TI WLD H ++E++E+E+KQK
Sbjct  544  SKNKLESYVFQVRNTIRDGKIAGNLSDEDKKQMESKIEDTISWLDQHSAAERDEFESKQK  603

Query  602  ELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            E+E + NP+LQK Y              A +    + +    + GPKIEEVD
Sbjct  604  EIESMVNPLLQKAY------------GAAASATGESTAPSSKEGGPKIEEVD  643

>H257_17322
Length=606

 Score = 988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/609 (84%), Positives = 539/609 (89%), Gaps = 43/609 (7%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  66
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSM  126
             NTVFDAKRLIGRKF+D ++QADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            VLIKM+EV+EAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAFIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGGEDFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTA  245

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            EFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE
Sbjct  246  EFKRKHRKDMTANQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  305

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            DMCGDYFRKTMEPVEKVLRD+KLSKSQVHEVVLVGGSTRIPK                  
Sbjct  306  DMCGDYFRKTMEPVEKVLRDSKLSKSQVHEVVLVGGSTRIPK------------------  347

Query  367  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
                        QAAILSGNDSSEKLQDLLLLDVTPL L LETAGGVM TLI RNTTVPT
Sbjct  348  ----------PWQAAILSGNDSSEKLQDLLLLDVTPLLLTLETAGGVMATLIQRNTTVPT  397

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
            KKSQTFST A+NQ GVLIQVF                 LDGIPPMPRGVP +DVTFDIDA
Sbjct  398  KKSQTFSTCANNQSGVLIQVFRW---------------LDGIPPMPRGVPHVDVTFDIDA  442

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNAL  546
            NGILNVSA+EKSTGKENKITITNDKGRLS+ +I+RMV EAEKYKSEDEANK+RIEAKN L
Sbjct  443  NGILNVSAIEKSTGKENKITITNDKGRLSKDDIERMVQEAEKYKSEDEANKLRIEAKNGL  502

Query  547  ENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGV  606
            ENYAY+LRN+LNDEKL+ K+ EADKKVVDDKVTETI WLDA+QS+EKEEYEAKQKELEGV
Sbjct  503  ENYAYNLRNTLNDEKLQGKLDEADKKVVDDKVTETINWLDANQSAEKEEYEAKQKELEGV  562

Query  607  ANPVLQKVY  615
            ANP++QK+Y
Sbjct  563  ANPIMQKLY  571

>CCA16151
Length=643

 Score = 979 bits (2530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/655 (75%), Positives = 570/655 (87%), Gaps = 14/655 (2%)

Query  1    MAQTT-SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  59
            M +TT SG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT  ERLIG+AAK
Sbjct  1    MVETTVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAK  60

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
            NQVAMNA NTVFDAKRLIGRKF D  VQ D KHWPF +  G  DKPQI V+  G  K F 
Sbjct  61   NQVAMNAENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFY  120

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EEIS+MVL KMRE+AEA++G++VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NE
Sbjct  121  AEEISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNE  180

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FEV+ATAGDTHLGGEDFDNR
Sbjct  181  PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRATAGDTHLGGEDFDNR  240

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LV+HF  EFKRK+RKD+++NQRALRRLR+ACERAKRTLSSSAQAYIEIDSL +G+DFNST
Sbjct  241  LVEHFLTEFKRKYRKDLSQNQRALRRLRSACERAKRTLSSSAQAYIEIDSLHEGVDFNST  300

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ITRARFED+C DYFRKTM+PVE+VLRDAKLSK+Q++E+VLVGGSTRIPKVQQLLSDFFNG
Sbjct  301  ITRARFEDLCSDYFRKTMDPVERVLRDAKLSKNQLNEIVLVGGSTRIPKVQQLLSDFFNG  360

Query  360  KEPNKSINPDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLI  418
            KE  KSINPDEAVAYGATVQAAILSG +D SE+LQ+++LLDV PLS+GLETAGGVMT LI
Sbjct  361  KELYKSINPDEAVAYGATVQAAILSGASDQSERLQNVVLLDVAPLSMGLETAGGVMTVLI  420

Query  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  478
             RNTTVPT+KSQTFSTYADNQPGVLIQV+EGER+MTRDN+LLGKFNL+ IPPMPRGVPQI
Sbjct  421  PRNTTVPTRKSQTFSTYADNQPGVLIQVYEGERTMTRDNHLLGKFNLEEIPPMPRGVPQI  480

Query  479  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKV  538
            +VTF++DANGIL+V+AVEKSTGKENKITITNDKGRLS+ EIDRMV EA+ YK +DE NK+
Sbjct  481  EVTFEVDANGILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKL  540

Query  539  RIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEA  598
            R+E KN LE+Y + +RN++ D+K+ +K+ + +KK V+ K+ ETI WLD + ++E++E+E+
Sbjct  541  RVECKNKLESYVFHVRNTIRDDKIADKLSDEEKKQVESKIEETISWLDQNTAAERDEFES  600

Query  599  KQKELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KQK++E + NP+LQK Y              A + A  +    G + GPKIEEVD
Sbjct  601  KQKDVEDMVNPLLQKAY------------GAAASTAGESADPSGKEAGPKIEEVD  643

>PYVX_22981
Length=612

 Score = 965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/648 (77%), Positives = 549/648 (85%), Gaps = 48/648 (7%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  65
            +G SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN
Sbjct  13   TGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  72

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            A NTVFDAKRLIGRKF+DP+VQ DI+HWPFK+S+G+  KPQITVQF+GE KTFQPEEISS
Sbjct  73   AANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQPEEISS  132

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL+KMR+VAEAFIGK VKNAVITVPAYFNDSQRQATKDAG IAGLN             
Sbjct  133  MVLMKMRDVAEAFIGKPVKNAVITVPAYFNDSQRQATKDAGVIAGLN-------------  179

Query  186  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
                                           EGIFEVKATAGDTHLGGEDFDNRLV+HF 
Sbjct  180  -------------------------------EGIFEVKATAGDTHLGGEDFDNRLVEHFA  208

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             EFKRK+RKD++E+QRALRRLRTACERAKRTLSSSAQAY+EIDSL+DG+DFN+TITRARF
Sbjct  209  AEFKRKYRKDLSESQRALRRLRTACERAKRTLSSSAQAYVEIDSLYDGVDFNTTITRARF  268

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            E+MCGDYFRKTMEPVE VLRDAKL K QVHEVVLVGGSTRIPKVQQLLS FFNGKEP KS
Sbjct  269  EEMCGDYFRKTMEPVETVLRDAKLGKGQVHEVVLVGGSTRIPKVQQLLSQFFNGKEPCKS  328

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            INPDEAVA+GATVQAAILSG+DSS KLQDLLLLDV PLSLGLETAGGVMTTLI RNTTVP
Sbjct  329  INPDEAVAFGATVQAAILSGHDSSAKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTVP  388

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
             KKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLD +PPMPRGVPQIDVTFDID
Sbjct  389  AKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDALPPMPRGVPQIDVTFDID  448

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNA  545
            ANGILNV+AVEKSTGKENKITITNDKGRLSQA+IDRMVAEAEKYK +DE  K R+++KN+
Sbjct  449  ANGILNVTAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKQQDEVQKQRVDSKNS  508

Query  546  LENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEG  605
            LENYAY LRNSLND+K+KE++ + D+K VDD+VT+TI WLD++Q +EK+E++AKQKEL  
Sbjct  509  LENYAYGLRNSLNDDKIKEQLSDNDRKAVDDQVTQTINWLDSNQMAEKDEFDAKQKELAD  568

Query  606  VANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            VANP+LQK+Y       G   G   GA        G  ++GPKIEEVD
Sbjct  569  VANPILQKMY----ASAGGAPGKMPGADEMPTAPGGSDEKGPKIEEVD  612

>HYAP_01540
Length=634

 Score = 958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/621 (81%), Positives = 529/621 (85%), Gaps = 50/621 (8%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQT S YSVGID+GT YS VGVWQND VEIIA DQGNRT+                   
Sbjct  1    MAQTMSDYSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAV-----------------  43

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
             VAMNAHNTVFD KRLIGRKFSD +VQAD+KHWPFK++SGAGDKPQITVQFKGESKTFQ 
Sbjct  44   -VAMNAHNTVFDGKRLIGRKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQS  102

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATK------DAGAIAGLNVL  174
            EEISSMVLIKMREVAEAF+GKEVK AVITVPAYFNDSQRQ  +      D+     L   
Sbjct  103  EEISSMVLIKMREVAEAFMGKEVKKAVITVPAYFNDSQRQRRRMQGPLLDSTCSVSLTSR  162

Query  175  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  234
            R+   PT              R          T+               ATAGDTHLGGE
Sbjct  163  RLRPSPTVWT-----------RRAASAMCSSSTW---------------ATAGDTHLGGE  196

Query  235  DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
            DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI
Sbjct  197  DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  256

Query  295  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  354
            DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS
Sbjct  257  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  316

Query  355  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  414
            DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM
Sbjct  317  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  376

Query  415  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  474
            TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG
Sbjct  377  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  436

Query  475  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  534
            VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMV+EAEKYKSEDE
Sbjct  437  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDE  496

Query  535  ANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKE  594
            ANK+RIEAKNALENYAY+LRN+LNDEKLK++IPE D+K +DDKVTETI WLDA+QS+EKE
Sbjct  497  ANKIRIEAKNALENYAYNLRNTLNDEKLKDQIPEDDRKAIDDKVTETINWLDANQSAEKE  556

Query  595  EYEAKQKELEGVANPVLQKVY  615
            EYEAKQKE+E VANP+LQK+Y
Sbjct  557  EYEAKQKEVESVANPILQKMY  577

>PYIR_15857
Length=577

 Score = 919 bits (2374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/653 (77%), Positives = 533/653 (82%), Gaps = 76/653 (12%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK+S GAGDKPQITV+FKGE+KTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREV+EAFIGKE    +  V A   D+                       
Sbjct  121  EEISSMVLIKMREVSEAFIGKE---GIFEVKATAGDTH----------------------  155

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
                                  LGG  FD  L+                H  GE      
Sbjct  156  ----------------------LGGEDFDNRLVD---------------HFVGE------  172

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
                   FKRKHRKDIT NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDG+DFNSTI
Sbjct  173  -------FKRKHRKDITSNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGVDFNSTI  225

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  226  TRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  285

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EP K+INPDEAVA+GATVQAAILSGND SEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  286  EPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  345

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV
Sbjct  346  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  405

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+IDRMVAEAEKYK+EDE+NKVRI
Sbjct  406  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRI  465

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EAKN LENYAY+LRN+L+DEKLK +I E D+  ++DKVTETI WLDA+QS+EKEE+EAKQ
Sbjct  466  EAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQ  525

Query  601  KELEGVANPVLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            KELEG+ANP+LQK+Y AA G  G   G   GA  + AP A G DQGPKIEEVD
Sbjct  526  KELEGIANPILQKMY-AAAGGAGGMPGGAPGAPGAGAPPAAGGDQGPKIEEVD  577

>PHALS_04330
Length=785

 Score = 863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/445 (99%), Positives = 443/445 (99%), Gaps = 0/445 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFDAKRLIGRKFSDP+VQADIKHWPFK++SGAGDKPQI VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR
Sbjct  361  EPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIAR  420

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQ  445
            NTTVPTKKSQTFSTYADNQPGVLIQ
Sbjct  421  NTTVPTKKSQTFSTYADNQPGVLIQ  445

>PHYKE_6984
Length=450

 Score = 860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/450 (98%), Positives = 445/450 (99%), Gaps = 2/450 (0%)

Query  1    MAQTTS--GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  58
            MAQTT+  GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA
Sbjct  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTF  118
            KNQVAMNAHNTVFDAKRLIGRKFSDPIVQ+DIKHWPFK+SSGAGDKPQITVQFKGESKTF
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120

Query  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN
Sbjct  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  240

Query  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298
            RLVDHF  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS
Sbjct  241  RLVDHFVSEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  300

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358
            TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN
Sbjct  301  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  360

Query  359  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  418
            GKEP KSINPDEAVA+GATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI
Sbjct  361  GKEPCKSINPDEAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLI  420

Query  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448
            ARNTTVPTKKSQTFSTYADNQPGVLIQVFE
Sbjct  421  ARNTTVPTKKSQTFSTYADNQPGVLIQVFE  450

>PYIW_16873
Length=496

 Score = 835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/496 (90%), Positives = 466/496 (94%), Gaps = 1/496 (0%)

Query  159  RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  218
            RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG
Sbjct  1    RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  60

Query  219  IFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLS  278
            IFEVKATAGDTHLGGEDFDNRLVDHF  EFKRKHRKDIT NQRALRRLRTACERAKRTLS
Sbjct  61   IFEVKATAGDTHLGGEDFDNRLVDHFVGEFKRKHRKDITSNQRALRRLRTACERAKRTLS  120

Query  279  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  338
            SSAQAYIEIDSLFDG+DFNSTITRARFEDMCGDYFRKTM+PVEKVLRD+KLSKSQVHEVV
Sbjct  121  SSAQAYIEIDSLFDGVDFNSTITRARFEDMCGDYFRKTMDPVEKVLRDSKLSKSQVHEVV  180

Query  339  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  398
            LVGGSTRIPKVQQLLSDFFNGKEP K+INPDEAVA+GATVQAAILSGND SEKLQDLLLL
Sbjct  181  LVGGSTRIPKVQQLLSDFFNGKEPCKAINPDEAVAFGATVQAAILSGNDQSEKLQDLLLL  240

Query  399  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  458
            DVTPLSLGLETAGGVMTTLI+RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN
Sbjct  241  DVTPLSLGLETAGGVMTTLISRNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  300

Query  459  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAE  518
            LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQA+
Sbjct  301  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  360

Query  519  IDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKV  578
            IDRMVAEAEKYK+EDE+NKVRIEAKN LENYAY+LRN+L+DEKLK +I E D+  ++DKV
Sbjct  361  IDRMVAEAEKYKAEDESNKVRIEAKNGLENYAYNLRNTLDDEKLKSQISEEDRSAINDKV  420

Query  579  TETIQWLDAHQSSEKEEYEAKQKELEGVANPVLQKVY-aaaggmggmpggmpagagasaa  637
            TETI WLDA+QS+EKEE+EAKQKELEG+ANP+LQK+Y AA G  G   G      GA A 
Sbjct  421  TETINWLDANQSAEKEEFEAKQKELEGIANPILQKMYAAAGGAGGMPGGAPGGMPGAGAP  480

Query  638  psaggaDQGPKIEEVD  653
            P A G DQGPKIEEVD
Sbjct  481  PPAAGGDQGPKIEEVD  496

>PPTG_02120
Length=1001

 Score = 827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/481 (91%), Positives = 448/481 (93%), Gaps = 2/481 (0%)

Query  175   RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  234
             R +  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE
Sbjct  521   RGLYHPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  580

Query  235   DFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
             DFDNRLVDHFTQEFKRKHRKD+T NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+
Sbjct  581   DFDNRLVDHFTQEFKRKHRKDLTHNQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGV  640

Query  295   DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  354
             DFNSTITRARFED+C DYFRKTMEPVEKVLRDAKLSK QVHEVVLVGGSTRIPKVQQLLS
Sbjct  641   DFNSTITRARFEDLCADYFRKTMEPVEKVLRDAKLSKGQVHEVVLVGGSTRIPKVQQLLS  700

Query  355   DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  414
             DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM
Sbjct  701   DFFNGKEPNKSINPDEAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVM  760

Query  415   TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRG  474
             TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRG
Sbjct  761   TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRG  820

Query  475   VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  534
             VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE
Sbjct  821   VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  880

Query  535   ANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKE  594
             ANKVRIEAKNALENYAYSLRNSLNDEK+KEKIPEADKKVVDDKVTE IQWLDA+QS+EKE
Sbjct  881   ANKVRIEAKNALENYAYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDANQSAEKE  940

Query  595   EYEAKQKELEGVANPVLQKVY--aaaggmggmpggmpagagasaapsaggaDQGPKIEEV  652
             EYE+KQKELE VANPVLQKVY  A                  +A  S+   DQGPKIEEV
Sbjct  941   EYESKQKELESVANPVLQKVYASAGGADGMAGGMAGGMPGAGAAPSSSSSTDQGPKIEEV  1000

Query  653   D  653
             D
Sbjct  1001  D  1001

>H310_09434
Length=658

 Score = 761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/617 (63%), Positives = 490/617 (79%), Gaps = 5/617 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  59
            MAQ   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   MAQEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
            NQ  +N  NT+FD KRLIGR ++D  VQAD K  PF I +  G +P I V+ KGE+K F 
Sbjct  83   NQATINPENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDG-RPFIEVKIKGEAKQFS  141

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
            PEE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINE
Sbjct  142  PEEVSAMILTKMKTIAENYLGKEVHDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  201

Query  180  PTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            PTAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD 
Sbjct  202  PTAAAIAYGIDKKAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFDQ  261

Query  239  RLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298
            R++  F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+ 
Sbjct  262  RIMQFFIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFDE  321

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358
            T+TRARFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFFN
Sbjct  322  TLTRARFEELNNDLFKKTLTPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFFN  381

Query  359  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  418
            GKEP++ INPDEAVAYGA VQ  IL G  +   L ++LLLDV PLSLG+ET GGVMT +I
Sbjct  382  GKEPSRGINPDEAVAYGAAVQGGILGGE-NDSNLNEILLLDVAPLSLGIETVGGVMTKII  440

Query  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  478
             RNT VPTKKSQTFSTY DNQP V IQVFEGER+MT+DN++LGKF L GIPP PRGVPQI
Sbjct  441  NRNTVVPTKKSQTFSTYQDNQPAVSIQVFEGERAMTKDNHILGKFELTGIPPAPRGVPQI  500

Query  479  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKV  538
            +VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ EIDRMV EAE+   ED+  K 
Sbjct  501  EVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKD  560

Query  539  RIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEA  598
            RI+ +N+LE Y Y+L+N++ D KL +KI EADK  +   V E + WLD +Q ++KE+++A
Sbjct  561  RIDGRNSLEGYLYNLKNNVED-KLADKIEEADKDTLLKAVQEAMDWLDENQEADKEDFDA  619

Query  599  KQKELEGVANPVLQKVY  615
            +QK +E +ANP++ KVY
Sbjct  620  QQKAIEKIANPIMAKVY  636

>PYAR_18354
Length=1084

 Score = 759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/611 (64%), Positives = 482/611 (79%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  PF I +  G KP I V  KGE K F PEEIS+
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDG-KPFIQVTIKGEKKQFSPEEISA  148

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+ +AEA+IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  149  MVLSKMKTIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  208

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LLSI+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  209  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLSIDAGVFEVLATNGDTHLGGEDFDQRVMQYF  268

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  269  IKKWKKDKNIDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  328

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  329  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  388

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVA+GA VQ  IL G    +  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  389  GVNPDEAVAFGAAVQGGILGGE-QDDTNKDILLIDVAPLSLGIETVGGVMTKLINRNTVI  447

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGERSMT+DN +LGKF L G+PP PRGVPQI+V+F++
Sbjct  448  PTKKSQTFSTYQDNQPAVLIQVFEGERSMTKDNRMLGKFELTGLPPAPRGVPQIEVSFEL  507

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL V A +K TGK  KITIT DKGRLSQ E++RMV EAE++  ED+  K RI+ +N
Sbjct  508  DANGILQVGAEDKGTGKAEKITITADKGRLSQEEVERMVKEAEEFADEDKKIKDRIDGRN  567

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALE Y YSL+NS+ D KL +KI E DK+ V   V + + WL+ +Q S+K+++EAKQKE+E
Sbjct  568  ALEGYLYSLKNSVED-KLADKIEEDDKESVLKAVQDAMDWLEDNQESDKDDFEAKQKEVE  626

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  627  KIVNPIMSKVY  637

>PHALS_01338
Length=383

 Score = 759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/378 (95%), Positives = 373/378 (99%), Gaps = 0/378 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMN+ NTVFDAKRLIGRK+SDP+V+ADIKHWPFK+++G GDKPQITVQFKGE+KTFQP
Sbjct  61   QVAMNSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEA+IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAYIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            VDHF QEFKRKHRKD+++NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI
Sbjct  241  VDHFVQEFKRKHRKDLSQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK
Sbjct  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360

Query  361  EPNKSINPDEAVAYGATV  378
            EPNKSINPDEAVAYGAT+
Sbjct  361  EPNKSINPDEAVAYGATI  378

>PYIW_21755
Length=658

 Score = 757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/611 (64%), Positives = 478/611 (78%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  P+ I +  G KP I V  KGE KTF PEE+S+
Sbjct  89   PEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDG-KPLIEVSVKGEKKTFSPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  148  MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL V A +K TGK  KITIT +KGRLSQ EIDRMV EA +   ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  566

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
             LE Y YSL+NS+ D KL +KI E DK  V   V + + WL+ +Q ++KE++EAKQKE+E
Sbjct  567  GLEGYLYSLKNSVED-KLADKIEEDDKDTVLKSVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  605  GVANPVLQKVY  615
               NP++ KVY
Sbjct  626  KAVNPIMAKVY  636

>PYAP_13341
Length=657

 Score = 757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/611 (63%), Positives = 485/611 (79%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  P++I +  G KP I V  KGE+K F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPFIQVTIKGENKLFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+++AEA+IG+EV +AV+TVPAYFND+QRQATKDAG I+G+ V RIINEPTAAAI
Sbjct  148  MVLTKMKQIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTISGMTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI +++RAL++LR   ER KR LS+ AQA +EI+SL DG DF   ++RAR
Sbjct  268  IKKWKKDKSIDIGKDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTEALSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKVL+D  L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVLKDGGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLSLG+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDVTKDILLIDVVPLSLGIETVGGVMTKLINRNTVI  446

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+V+F++
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERTMTKDNRLLGKFELTGLPPAPRGVPQIEVSFEL  506

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL V A +K TGK  KITIT +KGRLSQ EI+RMV EAE++  ED+  K RI+ +N
Sbjct  507  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIERMVKEAEEFADEDKKVKDRIDGRN  566

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
             LE Y YSL+N++ D KL +KI E DK+ V   V + + WL+ +Q S+KE++EAKQKE+E
Sbjct  567  GLEGYLYSLKNNVED-KLADKIDEDDKETVLKAVQDAMDWLEDNQDSDKEDFEAKQKEVE  625

Query  605  GVANPVLQKVY  615
             V NP++ KVY
Sbjct  626  KVVNPIMAKVY  636

>PYVX_16738
Length=658

 Score = 756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/616 (63%), Positives = 481/616 (78%), Gaps = 5/616 (1%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  23   AKGPRGPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  82

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            Q  +N   T+FD KRLIGRK++D  VQAD K  P+ I+   G KP I V  KGE + F P
Sbjct  83   QATINPEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQG-KPFIEVTVKGEKRQFAP  141

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+S+MVL KM+++AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEP
Sbjct  142  EEVSAMVLTKMKQIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEP  201

Query  181  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  202  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  261

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            ++ +F +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +
Sbjct  262  IMQYFIKKWKKDKSVDIGSDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTES  321

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ++RARFE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQ L+ D+FNG
Sbjct  322  LSRARFEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQTLIKDYFNG  381

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KEP++ +NPDEAVAYGA VQ  IL G    E  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  382  KEPSRGVNPDEAVAYGAAVQGGILGG-ADDELTKDVLLIDVVPLSQGIETVGGVMTKLIN  440

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+
Sbjct  441  RNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIE  500

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGIL V A +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K R
Sbjct  501  VTFEIDANGILQVGAEDKGTGKAESITITAEKGRLSQEEIDRMVQEAAEFADEDKLVKER  560

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            I+ +NALE Y YSL+N++ D KL +KI E DK  V   V + + WL+ +Q + KE+++AK
Sbjct  561  IDGRNALEGYLYSLKNNVED-KLADKIDEDDKDTVLTAVQDAMDWLEDNQEANKEDFDAK  619

Query  600  QKELEGVANPVLQKVY  615
            QKE+E V NP++ KVY
Sbjct  620  QKEVEKVVNPIMAKVY  635

>PHALS_00833
Length=652

 Score = 755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/611 (63%), Positives = 486/611 (80%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V  KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVVIKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLSKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI+ ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDISSDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALE Y YSL+N++ +EKL++K+ + DK  V + V + + WL+ +Q ++KE+YEAKQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKLNDDDKDTVLNAVQDAMDWLEDNQEADKEDYEAKQKEVE  624

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  625  KLVNPIMSKVY  635

>PYU1_G004098
Length=656

 Score = 751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/611 (63%), Positives = 479/611 (78%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGR ++D  VQAD K  P++I +  G KP I V  KGE K F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGEKKHFSPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM++ AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAI
Sbjct  147  MILTKMKQTAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQFF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKSVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G  + +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-TDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL V A +K TGK  KITIT +KGRLSQ EIDRMV EA +   ED+  K RI+ +N
Sbjct  506  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  565

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
             LE Y YSL+N++ D K+ +KI E DK  V   V + + WL+ +Q ++KE++E KQKE+E
Sbjct  566  GLEGYLYSLKNTVED-KMADKIEEDDKDAVLKAVQDAMDWLEDNQEADKEDFEGKQKEVE  624

Query  605  GVANPVLQKVY  615
             V NP++ KVY
Sbjct  625  KVVNPIMAKVY  635

>PHYSO_286376
Length=660

 Score = 749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/611 (63%), Positives = 487/611 (80%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIQVEVKGEKRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKSQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  ILSG    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILSGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALE Y YSL+N++ +EKL++KI E DK  V   V + + WL+ +Q ++KE++EAKQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  626  KLVNPIMSKVY  636

>PHYCA_510696
Length=659

 Score = 748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/611 (63%), Positives = 486/611 (80%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P++I +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALE Y YSL+N++ +EKL++KI E DK  V   V + + WL+ +Q ++KE++EAKQKE+E
Sbjct  566  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  625  KLVNPIMSKVY  635

>PPTG_08245
Length=658

 Score = 747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/611 (63%), Positives = 485/611 (79%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+ + +  G KP I V+ KGE + F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDG-KPFIEVEVKGEKRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  268  IKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRN  566

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALE Y YSL+N++ +EKL++KI E DK  V   V + + WL+ +Q ++KE++EAKQKE+E
Sbjct  567  ALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  625

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  626  KLVNPIMSKVY  636

>PHYRA_71042
Length=654

 Score = 745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/616 (62%), Positives = 487/616 (79%), Gaps = 5/616 (1%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  20   AEEARGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  79

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            Q  +N   T+FD KRLIGRK++D  VQ+D K  P++I +  G KP I V+ KGE + F P
Sbjct  80   QATINPEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDG-KPFIQVEVKGEKREFAP  138

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+S+MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEP
Sbjct  139  EEVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  198

Query  181  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  199  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  258

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            ++ +F +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +
Sbjct  259  IMQYFIKKWKKDKNLDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTES  318

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ++RARFE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNG
Sbjct  319  LSRARFEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  378

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KEP++ +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI 
Sbjct  379  KEPSRGVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLIN  437

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+
Sbjct  438  RNTVIPTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIE  497

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K R
Sbjct  498  VTFEIDANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDR  557

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            I+ +NALE Y YSL+N++ +EKL++KI E DK  V   V + + WL+ +Q ++KE++E K
Sbjct  558  IDGRNALEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEEK  616

Query  600  QKELEGVANPVLQKVY  615
            QKE+E + NP++ KVY
Sbjct  617  QKEVEKLVNPIMSKVY  632

>HYAP_01005
Length=660

 Score = 743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/611 (63%), Positives = 483/611 (79%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            +LE Y Y+L+N++ + KL +KI E DK  V   V + + WL+ +Q  +KE+YEAKQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  605  GVANPVLQKVY  615
             V NP++ KVY
Sbjct  626  KVVNPIMSKVY  636

>HYAP_01004
Length=660

 Score = 743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/611 (63%), Positives = 483/611 (79%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQ+D K  P+++ +  G KP I VQ KGE++ F PEE+S+
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDG-KPFIQVQVKGETRQFAPEEVSA  147

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM+ +AE +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  148  MVLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  207

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  208  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF  +++RAR
Sbjct  268  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLEGEDFTESLSRAR  327

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  328  FEKLNDDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  387

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  388  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  446

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  447  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  506

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  507  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRN  566

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            +LE Y Y+L+N++ + KL +KI E DK  V   V + + WL+ +Q  +KE+YEAKQKE+E
Sbjct  567  SLEGYLYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVE  625

Query  605  GVANPVLQKVY  615
             V NP++ KVY
Sbjct  626  KVVNPIMSKVY  636

>PYU1_G004097
Length=663

 Score = 741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/608 (62%), Positives = 485/608 (80%), Gaps = 5/608 (1%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNAHN  68
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N   
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T+FD KRLIGR ++D  VQAD K  P++I +  G KP I V  KG++K F PEEIS+MVL
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDG-KPVIQVTVKGQTKLFSPEEISAMVL  154

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+++AEA++G++V++AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAIAYG
Sbjct  155  GKMKQIAEAYLGRDVRDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIAYG  214

Query  189  LDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F ++
Sbjct  215  IDKKAQGEKNVLVFDLGGGTFDVTLLAIDNGVFEVLATNGDTHLGGEDFDQRVMQFFIKK  274

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            +K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL +G DF+ T+TRARFE 
Sbjct  275  WKQDKGVDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLNGEDFSETLTRARFEK  334

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  D F+KT+ PVEKVL+DA L KSQV E+VLVGGSTRIPKVQQ++ D+FNGKEP++ +N
Sbjct  335  LNEDLFKKTLGPVEKVLKDAGLKKSQVDEIVLVGGSTRIPKVQQMIKDYFNGKEPSRGVN  394

Query  368  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  427
            PDEAVAYGA +Q  IL G+   EKLQDL+L+DV PLS G+ET GGVMT LI RNT +PTK
Sbjct  395  PDEAVAYGAAIQGGILGGD-QDEKLQDLVLIDVVPLSQGIETVGGVMTKLINRNTAIPTK  453

Query  428  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  487
            KSQ FST+ DNQ  V I+VFEGER++ + N LLGKF+L G+PP PRGVPQI+VTF+IDAN
Sbjct  454  KSQVFSTHVDNQAAVSIKVFEGERTLVKHNRLLGKFDLAGLPPAPRGVPQIEVTFEIDAN  513

Query  488  GILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALE  547
            GIL VSA +K TGK  KITIT +KGRLSQ EI+RMV +A ++  ED+  K RIE+KN+LE
Sbjct  514  GILQVSAQDKGTGKTEKITITAEKGRLSQEEIERMVQDAAEHAEEDKKVKERIESKNSLE  573

Query  548  NYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVA  607
             Y YS +N++ D KL +KI E DK +V   V + + WLD ++ ++KE++E KQK++E V 
Sbjct  574  TYLYSAKNTVED-KLSDKIEEDDKGIVLQAVKDAMDWLDDNEDADKEDFEGKQKDVEKVV  632

Query  608  NPVLQKVY  615
            NP++ KVY
Sbjct  633  NPIMAKVY  640

>PITG_00527
Length=656

 Score = 737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/611 (63%), Positives = 486/611 (80%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+++ +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDG-KPFIEVEVKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+  + D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKKIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVEKVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKRVKDRIDGRN  565

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
             LE Y YSL+N++ +EKL++KI E DK  V   V + + WL+ +Q ++KE++EAKQKE+E
Sbjct  566  GLEGYLYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVE  624

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  625  KLVNPIMSKVY  635

>PHYKE_7992
Length=657

 Score = 736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/611 (61%), Positives = 479/611 (78%), Gaps = 5/611 (1%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
               T+FD KRLIGRK++D  VQAD K  P+ + +  G KP I V+ KGE + F PEE+S+
Sbjct  88   PEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDG-KPFIQVEVKGEKRQFAPEEVSA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL KM++++E +IG+EV +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAI
Sbjct  147  MVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAI  206

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++ +F
Sbjct  207  AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQYF  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    D+  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  267  IKKWKKDKNIDVASDKRALQKLRREAERVKRALSAQAQARLEIESLLDGEDFTESLSRAR  326

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVE+V++DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  327  FEKLNEDLFKKTLGPVERVMKDADLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  386

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  387  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  445

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  446  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  505

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL VSA +K TGK   ITIT +KGRLSQ EIDRMV EA ++  ED+  K RI+ +N
Sbjct  506  DANGILQVSAEDKGTGKAETITITAEKGRLSQDEIDRMVQEAAEFADEDKKVKDRIDGRN  565

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            ALE Y YSL+N++ ++   +   E DK  +   V + + WL+ +Q ++KE+YE KQKE+E
Sbjct  566  ALEGYLYSLKNNVEEKLEDKLD-EDDKDTITTAVQDAMDWLEDNQEADKEDYEEKQKEVE  624

Query  605  GVANPVLQKVY  615
             + NP++ K+Y
Sbjct  625  KLVNPIMSKMY  635

>SDRG_03564
Length=658

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/618 (61%), Positives = 487/618 (79%), Gaps = 6/618 (1%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  59
            +A+   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   VAEEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
            NQ  +N  NT+FD KRLIGR+++D  VQAD K  P++I +  G +P I V  KGE+KTF 
Sbjct  83   NQATINPENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEG-RPYIQVIVKGETKTFS  141

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINE
Sbjct  142  AEEVSAMILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  201

Query  180  PTAAAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            PTAAAIAYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD
Sbjct  202  PTAAAIAYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFD  261

Query  238  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
             R++  F ++++++ + DI+ ++RAL++LR   ER KR LS+  QA +EI+SL DG DF+
Sbjct  262  QRVMQFFIKKWQKQKKIDISSDKRALQKLRREAERVKRALSTQPQARLEIESLLDGEDFD  321

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
             T+TRARFE++  D F+KT+ PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFF
Sbjct  322  ETLTRARFEELNNDLFKKTLGPVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFF  381

Query  358  NGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  417
            NGKEP++ INPDEAVAYGA VQ  IL+G  + E  +D+LLLDV PLSLG+ET GGVMT +
Sbjct  382  NGKEPSRGINPDEAVAYGAAVQGGILAG-VNDESTKDILLLDVAPLSLGIETVGGVMTKI  440

Query  418  IARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ  477
            I RNT VPTKKSQTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQ
Sbjct  441  INRNTVVPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQ  500

Query  478  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANK  537
            I+VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ EIDRMV EAE+   ED+  K
Sbjct  501  IEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIK  560

Query  538  VRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYE  597
             RI+ +N+LE Y Y+L+N++ D+   +   +    V+   V E + WLD +Q ++KE+++
Sbjct  561  DRIDGRNSLEGYLYNLKNNVEDKLADKIDDDDKDTVL-KAVQEAMDWLDENQEADKEDFD  619

Query  598  AKQKELEGVANPVLQKVY  615
            A+QK +E V NP++ KVY
Sbjct  620  AQQKAVEKVVNPIMSKVY  637

>CCI50234
Length=665

 Score = 726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/612 (61%), Positives = 473/612 (77%), Gaps = 5/612 (1%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  64
            +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  RLIGDAAKNQ   
Sbjct  34   TGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAKNQAVH  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            N   T+FD KRLIGRKF+D  VQAD K  P++I +  G KP I V  KGE K F PEEIS
Sbjct  94   NPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTVKGEQKVFAPEEIS  152

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            +MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEPTAAA
Sbjct  153  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  212

Query  185  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  
Sbjct  213  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRVMQF  272

Query  244  FTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRA  303
            F +++ ++   +I +++RA++++R   ER KR LS++ QA IE++SL DGIDF+  ++RA
Sbjct  273  FIKKWNKEKTIEIEKDKRAVQKIRREAERVKRALSTNTQARIEVESLIDGIDFSDNLSRA  332

Query  304  RFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPN  363
             FE +  D FRKT+ PV+KVL+DA L KS+V EVVLVGGSTRIPKVQ+LL  +FNGKE N
Sbjct  333  LFEKLNNDLFRKTLAPVDKVLKDAGLKKSEVDEVVLVGGSTRIPKVQELLKAYFNGKELN  392

Query  364  KSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTT  423
            + +NPDEAVAYGA VQ  IL G    +  +DLLL+DV PLS G+ET GGVMT +I RNT 
Sbjct  393  RGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTV  451

Query  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483
            +PTKKSQ FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+VTF+
Sbjct  452  IPTKKSQVFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFE  511

Query  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543
            +DANGIL VSA +K TGK  KITIT +KGRLS+ EI RMV EAE++  ED+  K RI+ +
Sbjct  512  VDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDGR  571

Query  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603
            NALE Y Y+L++ ++D KL +KI E DK+ V + V + + WL+ +Q ++K ++EAKQKE+
Sbjct  572  NALEGYLYNLKSQVDD-KLADKIEEDDKETVSNAVQDALDWLEDNQEADKPDFEAKQKEV  630

Query  604  EGVANPVLQKVY  615
            E + NP++ K+Y
Sbjct  631  EKIVNPIMAKLY  642

>CCA24936
Length=661

 Score = 723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/616 (61%), Positives = 473/616 (77%), Gaps = 5/616 (1%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKN  60
            A+  +G  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF  T  R+IGDAAKN
Sbjct  26   AKPMTGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKN  85

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            Q   N   T+FD KRLIGRKF+D  VQAD K  P++I +  G KP I V  K E K F P
Sbjct  86   QAIHNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDG-KPFIRVTIKDEQKVFAP  144

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEIS+MVL KM+++AE  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEP
Sbjct  145  EEISAMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEP  204

Query  181  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R
Sbjct  205  TAAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQR  264

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            ++  F +++ ++ + +I +++RA+++LR   ER KR LS+  QA +E++SL DG DF+  
Sbjct  265  IMQFFIKKWNKEKKINIEQDKRAIQKLRRESERVKRALSTLPQARLEVESLIDGQDFSDV  324

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ++RA FE +  D FRKT+ PVEKVL+DA L KS++ EVVLVGGSTRIPKVQ+LL  FFNG
Sbjct  325  LSRAMFEKLNNDLFRKTLAPVEKVLKDAGLKKSEIDEVVLVGGSTRIPKVQELLKAFFNG  384

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE N+ +NPDEAVAYGA VQ  IL G    +  +DLLL+DV PLS G+ET GGVMT +I 
Sbjct  385  KELNRGVNPDEAVAYGAAVQGGILGGE-QDDLNKDLLLIDVIPLSQGIETVGGVMTKIIN  443

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +PTKK+Q FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+
Sbjct  444  RNTVIPTKKAQLFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIE  503

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF++DANGIL VSA +K TGK  K+TIT +KGRLS+ EI RMV EAE++  ED+  K R
Sbjct  504  VTFEVDANGILQVSAEDKGTGKAEKVTITAEKGRLSEEEIQRMVQEAEEFADEDKRIKER  563

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            I+ +NALE Y Y+L++ + DEKL EKI E DK+ V + V + + WL+ +Q ++K ++EAK
Sbjct  564  IDGRNALEGYLYNLKSQV-DEKLAEKIEEDDKETVTNAVQDALDWLEDNQEADKADFEAK  622

Query  600  QKELEGVANPVLQKVY  615
            QKE+E V NP++ K+Y
Sbjct  623  QKEVEKVVNPIMAKLY  638

>H310_14759
Length=787

 Score = 687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/607 (59%), Positives = 454/607 (75%), Gaps = 16/607 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  248

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFKIS G GDKP I V F+GE K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEIS  308

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE F+G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  185  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDSNMV  428

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D    EFKRK+R  D T + R++RRLRTACE AKR LS++  A IE+D+LF+G+DF+ST+
Sbjct  429  DFLVTEFKRKNRNLDPTSSARSMRRLRTACESAKRMLSTTTSATIEVDALFEGVDFSSTM  488

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS+ F GK
Sbjct  489  TRAKFESLNEECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQTMLSNLFGGK  548

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NT +P KK++ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTSEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ +IDRMV EAEKYK  D     RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EA+N LE + Y         +  E   +  +   ++ + +   WLD H  +  +E E K+
Sbjct  728  EARNDLEGFIY---------RYLEVASKKGEAQAENALRDARDWLDEHAEATVKELEDKK  778

Query  601  KELEGVA  607
            + LE V 
Sbjct  779  RALERVC  785

>H257_00007
Length=787

 Score = 686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/607 (59%), Positives = 456/607 (75%), Gaps = 16/607 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  189  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAAS  248

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFKI+ G GDKP I V F+GE+K+F PEEIS
Sbjct  249  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEIS  308

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  309  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  368

Query  185  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  369  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  428

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  429  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  488

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  489  TRAKFESLNDECFKRTEETVLKVLQDANMEPGQITELVLVGGSTRIPKVQNMLSGLFGGK  548

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  549  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  607

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NT +P KK++ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++V
Sbjct  608  NTAIPVKKTRIYTTEEDFQTTEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEV  667

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TF+IDANGIL+VS  +K TG +N+ TI+N++GRLSQ +IDRMV EAEKYK  D     RI
Sbjct  668  TFEIDANGILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRI  727

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EA+N LE + Y         +  E   +  +   ++ + ET  WL+ H  +  +E E K+
Sbjct  728  EARNELEGFIY---------RYLEVATKKGEAAAENLLRETRDWLEDHTEATVKELEDKK  778

Query  601  KELEGVA  607
            + LE V 
Sbjct  779  RALERVC  785

>CCA20828
Length=787

 Score = 686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/605 (60%), Positives = 452/605 (75%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDTERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAAKIQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKR+IGR F+D  VQ D +H+PFKI SG GDKP I V++K E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  241  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ LLS  FNG
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPGDISEIVLVGGSTRIPKVQNLLSGVFNG  547

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMV++AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLAR  726

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N+LE + Y   N+ N         E  +   ++ + +  +WLD H+ +   E E K
Sbjct  727  IEARNSLEQFIYRALNNGN---------EKCEAGAENALRDAREWLDDHEEATLRELEDK  777

Query  600  QKELE  604
            ++ LE
Sbjct  778  KRTLE  782

>SDRG_05777
Length=786

 Score = 685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/605 (59%), Positives = 453/605 (75%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFKI  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  428  VDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSST  487

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F G
Sbjct  488  MTRAKFESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGG  547

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIK  606

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P KK++ ++T +D Q  V + ++EGER+    NN LG+F + G+    RG PQ++
Sbjct  607  RNTAIPIKKTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISGLERAKRGEPQVE  666

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K T  + + TI+N+ GRLSQA+IDRMV EAEK+K ED     +
Sbjct  667  VTFEIDANGILNVSARDKKTNAKAETTISNNHGRLSQADIDRMVEEAEKFKKEDAEALKK  726

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N+LE++ Y         +  E   E      ++ + E  +WL+ H+ +   E E K
Sbjct  727  IEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEK  777

Query  600  QKELE  604
            ++ LE
Sbjct  778  KRVLE  782

>H257_18885
Length=786

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/604 (59%), Positives = 456/604 (75%), Gaps = 16/604 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFKI++G  DKP I V FKGE+K+F PEEIS
Sbjct  248  NATNTVFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +AYGLD      G+ N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  368  LAYGLDTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  427

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  428  DYLITEFKRKNKNLDPTTSARSMRRLRTACESAKRMLSTTTSATIEVDSLFEGVDFSSTM  487

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRA+FE +  + F++T E V KVL+DA +   Q+ E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  488  TRAKFESLNDECFKRTEETVLKVLQDANMKPDQISELVLVGGSTRIPKVQNMLSGLFGGK  547

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI R
Sbjct  548  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKR  606

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NT +P KK++ ++T AD Q  V + ++EGER+    NN LG+F + GI    RG PQ++V
Sbjct  607  NTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKRGEPQVEV  666

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TF+IDANGILNVSA +K T  + + TI+++ GRLSQ +IDRMVA+AEKYK +D     +I
Sbjct  667  TFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDDAEVLRKI  726

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            EA+N LE + Y         +  E   E      ++ + E  +WL+ H+ +   E E K+
Sbjct  727  EARNNLEGFIY---------RALEIAREKGDSQAENTIREAREWLEDHEEATLRELEDKK  777

Query  601  KELE  604
            + LE
Sbjct  778  RLLE  781

>HYAP_12660
Length=786

 Score = 683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/605 (59%), Positives = 451/605 (75%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PFKI  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKVCNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLAEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPENVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRL+Q +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLTQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E+  E     V+  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEQAREKGDTTVESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>CCI46091
Length=787

 Score = 682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/605 (59%), Positives = 448/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKR+IGR F+D  VQ D +H+PFKI SG GDKP I V+FK E+K F PEEIS
Sbjct  248  NPTNTVFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            +MVL +M+E AEA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  308  AMVLTRMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+L IE GIFEVKAT GDTHLGGEDFDN +
Sbjct  368  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTHLGGEDFDNNM  427

Query  241  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+  QEFKRK+R  D + N R++RRLRTACE AKR LS+S  A IE+DSLF+GIDF+ T
Sbjct  428  VDYMIQEFKRKNRGSDPSSNPRSMRRLRTACESAKRMLSTSTTASIEVDSLFEGIDFSLT  487

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DA +   ++ E+VLVGGSTRIPKVQ LLS  F G
Sbjct  488  VTRAKFESLNEELFKRCEETVLKVLADAAMKPDEISEIVLVGGSTRIPKVQNLLSAVFGG  547

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  548  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  606

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ 
Sbjct  607  RNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVK  666

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMV++AEK+K +D     R
Sbjct  667  VTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLSR  726

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y   N          + E       + + +  +WLD H+ +   E E K
Sbjct  727  IEARNGLEQFIYRAINI---------VQEKGDAATGNALRDAREWLDDHEDATLRELEEK  777

Query  600  QKELE  604
            ++ LE
Sbjct  778  KRMLE  782

>PYIW_26567
Length=564

 Score = 682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/540 (64%), Positives = 432/540 (80%), Gaps = 4/540 (1%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQV  62
            T+ G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ 
Sbjct  27   TSRGPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQA  86

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEE  122
             +N   T+FD KRLIGR +SD  VQAD K  P+ I +  G KP I V  KGE K F PEE
Sbjct  87   TINPEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDG-KPMIEVLIKGEKKLFSPEE  145

Query  123  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  182
            IS+M+L KM+++AE+++G+EV +A++TVPAYFND+QRQATKDAG IAGL V RIINEPTA
Sbjct  146  ISAMILTKMKQIAESYLGREVHDAIVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTA  205

Query  183  AAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAIAYG+DK+  GE++VL+FDLGGGTFDV+LL+IE G+FEV AT GDTHLGGEDFD R++
Sbjct  206  AAIAYGIDKQSEGEKHVLVFDLGGGTFDVTLLAIEGGVFEVLATNGDTHLGGEDFDQRVM  265

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
              F +++K+    DI  ++RAL++LR   ER KR LS+  QA +EIDSL DG DF+ T++
Sbjct  266  QFFIKKWKKDRGIDIGSDKRALQKLRREAERVKRALSTQTQARLEIDSLLDGEDFSETLS  325

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIPKVQQL+ DFFNGKE
Sbjct  326  RARFEKLNEDLFKKTLTPVEKVLKDAGIKKSEVDEIVLVGGSTRIPKVQQLIKDFFNGKE  385

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
            P++ +NPDEAVAYGA VQ  IL G  + + L D++L+DV PLS G+ET GGVMT LI RN
Sbjct  386  PSRGVNPDEAVAYGAAVQGGILGG-MNQKDLGDIVLIDVVPLSQGIETVGGVMTKLINRN  444

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
            T +P KKSQ FST+ DNQP V I+V+EGER++ +DN+LLGKF+L GIPP PRG+PQI+VT
Sbjct  445  TAIPNKKSQVFSTHVDNQPAVSIKVYEGERTLVKDNHLLGKFDLTGIPPAPRGIPQIEVT  504

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
            F+IDANGIL VSA +K TGK  KITIT +KGRLSQAEIDR++ EAE++  ED+  K RI+
Sbjct  505  FEIDANGILQVSAEDKGTGKAEKITITAEKGRLSQAEIDRIIEEAEQFAEEDKKVKERID  564

>SPRG_00333
Length=615

 Score = 679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/618 (58%), Positives = 459/618 (74%), Gaps = 49/618 (8%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAK  59
            +A+   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   VAEEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
            NQ  +N  NT+FD KRLIGR+++D  VQAD K  PF+I +  G +P I V+ KGE+KTF 
Sbjct  83   NQATINPENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEG-RPYIQVKVKGETKTFS  141

Query  120  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             EE+S+M+L KM+ +AE ++GKEV +AV+TVPAYFND+QRQATKDAG IAGL V RIINE
Sbjct  142  AEEVSAMILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINE  201

Query  180  PTAAAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            PTAAAIAYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FEV +T GDTHLGGEDFD
Sbjct  202  PTAAAIAYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLSTNGDTHLGGEDFD  261

Query  238  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
             R++  F ++++++ + DI+ ++RAL++LR   E+  R                      
Sbjct  262  QRVMQFFIKKWQKQKKIDISSDKRALQKLRREAEQDAR----------------------  299

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
                                 PVEKV++DA L KS+V E+VLVGGSTRIPK+QQL+ DFF
Sbjct  300  ---------------------PVEKVMKDAGLKKSEVDEIVLVGGSTRIPKIQQLIKDFF  338

Query  358  NGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  417
            NGKEP++ INPDEAVAYGA VQ  IL+G  + +  +D+LLLDV PLSLG+ET GGVMT +
Sbjct  339  NGKEPSRGINPDEAVAYGAAVQGGILAG-VNDDGTKDILLLDVAPLSLGIETVGGVMTKI  397

Query  418  IARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ  477
            I RNT VPTKKSQTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQ
Sbjct  398  INRNTVVPTKKSQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQ  457

Query  478  IDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANK  537
            I+VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ EIDRMV EAE+   ED+  K
Sbjct  458  IEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIK  517

Query  538  VRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYE  597
             RI+ +N+LE Y Y+L+N++ D KL +KI + DK  V   V E + WLD +Q ++KE+++
Sbjct  518  DRIDGRNSLEGYLYNLKNNVED-KLADKIDDEDKDTVLKAVQEAMDWLDENQEADKEDFD  576

Query  598  AKQKELEGVANPVLQKVY  615
            A+QK +E V NP++ KVY
Sbjct  577  AQQKAVEKVVNPIMSKVY  594

>PYIW_22144
Length=633

 Score = 678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/605 (59%), Positives = 453/605 (75%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR F+D IV+ D KH+PFKI  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRL TACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLHTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL+DA +   ++ E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLQDANMKPGEITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQ++IDRMVA+AEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+NALE Y Y         +  E   E     V+  + +   WL+ H+ +   E E K
Sbjct  573  IEARNALEQYIY---------RAIELSREKGDANVETAIRDARDWLEDHEEATLRELEDK  623

Query  600  QKELE  604
            ++ LE
Sbjct  624  KRALE  628

>SPRG_10519
Length=782

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/605 (59%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  183  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  242

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFKI  G GDKP I V FKGE K F PEEIS
Sbjct  243  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEIS  302

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  303  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  362

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  363  LAYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  422

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+   EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST
Sbjct  423  VDYLITEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSST  482

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F G
Sbjct  483  MTRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGG  542

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI 
Sbjct  543  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIK  601

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P KK++ ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+
Sbjct  602  RNTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIE  661

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q +IDRMV EAEK+K +D     R
Sbjct  662  VTFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKR  721

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            I+A+N LE Y Y         +  E   + +       + E   W+D ++     E E K
Sbjct  722  IDARNDLEGYLY---------RALEAASKKNDAAAQTALREARDWMDDNEELTVRELEDK  772

Query  600  QKELE  604
            ++ LE
Sbjct  773  RRVLE  777

>PITG_11913
Length=786

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 448/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PF I  G  DK  I V+FKGE K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLSEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIETAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>PYIR_24387
Length=633

 Score = 677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/605 (59%), Positives = 452/605 (75%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR F+D IV+ D KH+PFKI  G  +K  I V+FKGESK F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLSDANMKPEDITELVLVGGSTRIPKVQTMLSGLFNG  393

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG   + TI+N+ GRLSQ++IDRMVA+AEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRR  572

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N+LE Y Y         +  E   E     V+  + +   WL+ H+ +   E E K
Sbjct  573  IEARNSLEQYIY---------RAIEIAREKGDANVETAIRDARDWLEDHEEATLRELEDK  623

Query  600  QKELE  604
            ++ LE
Sbjct  624  KRVLE  628

>PPTG_03121
Length=786

 Score = 677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/605 (59%), Positives = 450/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D  H+PFKI  G  DK  I V+FKGE+K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E     V+  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>PYVX_18121
Length=633

 Score = 675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 448/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D  H+PFKI  G  +K  I V+FKGE+K F PEEIS
Sbjct  94   NATNTVFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  154  SMVLLRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGSDGKACNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  274  VEHLLTEFKRKNRSLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DA +    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  334  VTRAKFESLNEELFKRCEETVLKVLSDANMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  393

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDSNNKLGEFNISGIERAKRGEPQVE  512

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q +IDRMV EAEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVQEAEKFKKDDAEMLRR  572

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E     V++ + +   WL+ H+ +   E E K
Sbjct  573  IEARNDLEQFIY---------RAIETAREKGDANVENAIRDARDWLEDHEEATLRELEDK  623

Query  600  QKELE  604
            ++ LE
Sbjct  624  KRMLE  628

>PHYRA_78193
Length=786

 Score = 674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 448/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PF I  G  DK  I V+FKG+ K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGTACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSSSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  + V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEDTVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIETAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>PYU1_G001540
Length=633

 Score = 674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/605 (59%), Positives = 449/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +TERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKR+IGR F+D IV+ D KH+PFKI  G  +K  I V+FKGE K F PEEIS
Sbjct  94   NAHNTVFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGNNGQKTNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VEYLLTEFKRKNRNLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  FNG
Sbjct  334  VTRAKFESLGEELFKRCEETVLKVLADANMKPEDITELVLVGGSTRIPKVQTMLSSLFNG  393

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVE  512

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG   + TI+ + GRLSQ +IDRMVAEAEK+K +D     R
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISQNAGRLSQDDIDRMVAEAEKFKKDDAELLRR  572

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  +   E     V+  + +   WL+ H+ +   E E K
Sbjct  573  IEARNDLEQFIY---------RAIDIAREKGDSNVETSIRDARDWLEEHEEATLRELEDK  623

Query  600  QKELE  604
            ++ LE
Sbjct  624  KRSLE  628

>PHYKE_10815
Length=786

 Score = 674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/605 (58%), Positives = 448/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D KH+PF I  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+++  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQKIGQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  427  VEHLLTEFKRKNRNLDPSSSPRAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSAT  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVTKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>PYAP_22238
Length=633

 Score = 673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 450/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D+ERLIG+AAK Q A 
Sbjct  34   GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAS  93

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  NTVFDAKR+IGR FSD IV+ D  H+PFKI+ G  +K  I V+FKGE+K+F PEEIS
Sbjct  94   NPSNTVFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSFTPEEIS  153

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AEA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  154  SMVLTRMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  213

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G+     NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  214  LAYGLDTNAGQSGKGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  273

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            VD+   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF++T
Sbjct  274  VDYLLSEFKRKNRGLDPSTSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSTT  333

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ITRA+FE +  + F++  E V KVL DA +    + EVVLVGGSTRIPKVQ +LS  F G
Sbjct  334  ITRAKFESLNEELFKRCEETVVKVLSDANMKPEDITEVVLVGGSTRIPKVQTMLSAQFGG  393

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  394  KELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  452

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++
Sbjct  453  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVDANNKLGEFNISGIERAKRGEPQVE  512

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG   + TI+N++GRL+Q +IDRMVAEAEKYK +D     +
Sbjct  513  VTFEIDANGILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVAEAEKYKKDDAELLRK  572

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E  +   ++ + +   WL+ H+ +   E E K
Sbjct  573  IEARNELEQFIY---------RAIEIAREKGETEAENAIRDARDWLEDHEDASLRELEDK  623

Query  600  QKELE  604
            ++ LE
Sbjct  624  KRMLE  628

>PHALS_02079
Length=786

 Score = 672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 446/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAS  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NT+FDAKR+IGR FSD +V+ D  H+PF I  G  DK  I V FKGE K+F PEEIS
Sbjct  247  NATNTIFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQNISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G      NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFDN +
Sbjct  367  LAYGLDTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V++   EFKRK+R  D + + RA+RRLRTACE AKR LSS+  A +E+DSLF+G+DF+ST
Sbjct  427  VEYLLSEFKRKNRNMDPSTSARAMRRLRTACESAKRMLSSTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSSLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEIAREKGDTNTESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>PHYCA_509820
Length=786

 Score = 667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 445/605 (74%), Gaps = 17/605 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A 
Sbjct  187  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAG  246

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSD +V+ D  H+PF I  G  DK  I V+FK E K+F PEEIS
Sbjct  247  NATNTVFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEIS  306

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL++M+E AEAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA
Sbjct  307  SMVLLRMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAA  366

Query  185  IAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            IAYGLD   G      NVLIFDLGGGTFDVSLLSIEEGIF VK+T GDT+LG EDFDN +
Sbjct  367  IAYGLDTNAGTDGKACNVLIFDLGGGTFDVSLLSIEEGIFGVKSTGGDTYLGSEDFDNNM  426

Query  241  VDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST
Sbjct  427  VEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSST  486

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F G
Sbjct  487  VTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFGG  546

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI 
Sbjct  547  KELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIK  605

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  479
            RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++
Sbjct  606  RNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVE  665

Query  480  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR  539
            VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     R
Sbjct  666  VTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRR  725

Query  540  IEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            IEA+N LE + Y         +  E   E      +  + +   WL+ H+ +   E E K
Sbjct  726  IEARNDLEQFIY---------RAIEMAREKGDTNAESAIRDARDWLEDHEEATLRELEDK  776

Query  600  QKELE  604
            ++ LE
Sbjct  777  KRMLE  781

>PHYRA_47873
Length=396

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/396 (93%), Positives = 384/396 (97%), Gaps = 1/396 (0%)

Query  259  NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTME  318
            NQRALRRLRTACERAKRTLSSSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTME
Sbjct  1    NQRALRRLRTACERAKRTLSSSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTME  60

Query  319  PVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATV  378
            PVEKVLRDAKLSKSQV+EVVLVGGSTRIPKVQQLLS+FFNGKEPNKSINPDEAVAYGATV
Sbjct  61   PVEKVLRDAKLSKSQVNEVVLVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATV  120

Query  379  QAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADN  438
            QAAIL GNDSS+KLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADN
Sbjct  121  QAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADN  180

Query  439  QPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  498
            QPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKS
Sbjct  181  QPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  240

Query  499  TGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN  558
            TGKENKITITNDKGRLSQ++IDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN
Sbjct  241  TGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN  300

Query  559  DEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANPVLQKVYaaa  618
            DEKLKE+IPEADKKVVDDKVTETIQWLDAHQS+E EEYE+KQKELEGVANP+LQK+YAAA
Sbjct  301  DEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANPILQKMYAAA  360

Query  619  ggmggmpggmp-agagasaapsaggaDQGPKIEEVD  653
            GG  G  GG+P    GA AAPS+GGADQGPKIEEVD
Sbjct  361  GGAPGAEGGVPGGMPGAGAAPSSGGADQGPKIEEVD  396

>PHYRA_41888
Length=586

 Score = 649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/352 (86%), Positives = 331/352 (94%), Gaps = 0/352 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M ++ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DI+HWPFK++ G  +KP++ VQFKGE  TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL+KMRE+AEA+IGK+VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRL
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRL  240

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            V+ F QEFKRKHRKD+T N RALRRLRTACERAKRTLS SAQAYIEIDSL DG+DFNSTI
Sbjct  241  VEFFVQEFKRKHRKDMTVNSRALRRLRTACERAKRTLSMSAQAYIEIDSLLDGVDFNSTI  300

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  352
            TRARFED+CG++FRKTM+PV +VLRD+KLSKSQV+EVVLVGGSTRIPKVQQ 
Sbjct  301  TRARFEDLCGEFFRKTMDPVAQVLRDSKLSKSQVNEVVLVGGSTRIPKVQQF  352

 Score = 313 bits (803),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 173/192 (90%), Gaps = 0/192 (0%)

Query  424  VPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  483
            VP KK+Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  364  VPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFD  423

Query  484  IDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAK  543
            +D NGILNVSAVEKSTGKENKI ITNDKGRLSQ+EI+RMV +AEKYK +DE NK+RIE+K
Sbjct  424  VDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESK  483

Query  544  NALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603
            NALENYA+SLR+S  DEK+  K+ + DKK ++DKV ET+ WLDA+Q++ KEE++AKQ+EL
Sbjct  484  NALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQEL  543

Query  604  EGVANPVLQKVY  615
            EGV NP++QK+Y
Sbjct  544  EGVTNPIMQKIY  555

>SPRG_10477
Length=762

 Score = 649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/599 (58%), Positives = 435/599 (73%), Gaps = 28/599 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
            VFDAKR+IGR FSDPIV+ D  H+PFKI  G  DKP I V FKGE K F PEEISSMVL 
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  130  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  189
            +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  304  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  363

Query  190  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFEVKAT GDTHLG +  D  L     
Sbjct  364  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKATGGDTHLGVQAQDKGL-----  418

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
                     D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+TRA+F
Sbjct  419  ---------DPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSSTMTRAKF  469

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            E +  + F++T E V KVL DAK+   ++ E+VLVGGSTRIPKVQ +LS  F GKE +KS
Sbjct  470  ESLNEECFKRTEETVLKVLADAKMKPEEITELVLVGGSTRIPKVQNMLSAVFGGKELSKS  529

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            INPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P
Sbjct  530  INPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIP  588

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
             KK++ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ VTF+ID
Sbjct  589  VKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEID  648

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNA  545
            ANGILNVSA++K T  + + TI N+ GRL+Q +IDRMVA+AEK+K +D     +IEA+N+
Sbjct  649  ANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEKFKKDDAEVLKKIEARNS  708

Query  546  LENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
            LE++ Y         +  E   E      ++ + E  +WL+ H+ +   E E K++ LE
Sbjct  709  LESFIY---------RALELTREKGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  758

>PYIR_16737
Length=511

 Score = 615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/491 (64%), Positives = 390/491 (79%), Gaps = 3/491 (1%)

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            M+L KM++VAE +IG+EV +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  1    MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  60

Query  186  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FEV AT GDTHLGGEDFD R++  F
Sbjct  61   AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLATNGDTHLGGEDFDQRIMQFF  120

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
             +++K+    DI  ++RAL++LR   ER KR LS+ AQA +EI+SL DG DF  +++RAR
Sbjct  121  IKKWKKDKSMDIGTDKRALQKLRREAERVKRALSTQAQARLEIESLLDGEDFTESLSRAR  180

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE +  D F+KT+ PVEKVL+DA L KS+V E+VLVGGSTRIPKVQQL+ D+FNGKEP++
Sbjct  181  FEKLNEDLFKKTLGPVEKVLKDAGLKKSEVDEIVLVGGSTRIPKVQQLIKDYFNGKEPSR  240

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDEAVAYGA VQ  IL G    +  +D+LL+DV PLS G+ET GGVMT LI RNT +
Sbjct  241  GVNPDEAVAYGAAVQGGILGGE-QDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVI  299

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+I
Sbjct  300  PTKKSQTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEI  359

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGIL V A +K TGK  KITIT +KGRLSQ EIDRMV EA +   ED+  K RI+ +N
Sbjct  360  DANGILQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRN  419

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
             LE Y YSL+N+++D KL +KI E DK  V   V + + WL+ +Q ++KE++EAKQKE+E
Sbjct  420  GLEGYLYSLKNTVDD-KLADKIEEDDKDSVLKAVQDAMDWLEDNQEADKEDFEAKQKEVE  478

Query  605  GVANPVLQKVY  615
             + NP++ KVY
Sbjct  479  KIVNPIMAKVY  489

>PHYRA_47865
Length=381

 Score = 609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/380 (89%), Positives = 356/380 (94%), Gaps = 5/380 (1%)

Query  279  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  338
            SSAQAYIEIDSL+DG+DFNSTITRARFED+CGDYFRKTMEPVEKVLRDAKLSKSQV+EVV
Sbjct  2    SSAQAYIEIDSLYDGVDFNSTITRARFEDLCGDYFRKTMEPVEKVLRDAKLSKSQVNEVV  61

Query  339  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdllll  398
            LVGGSTRIPKVQQLLS+FFNGKEPNKSINPDEAVAYGATVQAAIL GNDSS+KLQDLLLL
Sbjct  62   LVGGSTRIPKVQQLLSEFFNGKEPNKSINPDEAVAYGATVQAAILGGNDSSDKLQDLLLL  121

Query  399  dvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNN  458
            DVTPLSLGLETAGGVMTTLIARNTTVPTKK+QTFSTYADNQPGVLIQVFEGERSMTRDN+
Sbjct  122  DVTPLSLGLETAGGVMTTLIARNTTVPTKKAQTFSTYADNQPGVLIQVFEGERSMTRDNH  181

Query  459  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAE  518
            LLGKFNLD IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQ++
Sbjct  182  LLGKFNLDAIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQSD  241

Query  519  IDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKV  578
            IDRMVAEAEKYKSED+ANKVRIEAKNALENYAYSLRNSLNDEKLKE+IPEADKKVVDDKV
Sbjct  242  IDRMVAEAEKYKSEDKANKVRIEAKNALENYAYSLRNSLNDEKLKEQIPEADKKVVDDKV  301

Query  579  TETIQWLDAHQSSEKEEYEAKQKELEGVANPVLQKVY-----aaaggmggmpggmpagag  633
            TETI WLDA+QS+E EEYE+KQKELEGVANP+LQK+Y     A     G   G      G
Sbjct  302  TETINWLDANQSAETEEYESKQKELEGVANPILQKMYAAAGGAPGAEGGVPGGMPGGMPG  361

Query  634  asaapsaggaDQGPKIEEVD  653
            A AAPS+GGADQGPKIEEVD
Sbjct  362  AGAAPSSGGADQGPKIEEVD  381

>H310_02604
Length=312

 Score = 575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/296 (92%), Positives = 288/296 (97%), Gaps = 0/296 (0%)

Query  7    GYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNA  66
            G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN 
Sbjct  6    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNP  65

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSM  126
             NTVFDAKRLIGRKF+DP++QADIKHWPFK++ GAGDKPQITV+FKGE+KTFQPEEISSM
Sbjct  66   TNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEISSM  125

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            VLIKM+EV+EA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  126  VLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  185

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFEVKATAGDTHLGG+DFDNRLVDHFT 
Sbjct  186  YGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGKDFDNRLVDHFTA  245

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITR  302
            EFKRKHRKD+T+NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT+
Sbjct  246  EFKRKHRKDMTQNQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITQ  301

>PHYRA_72238
Length=601

 Score = 572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/611 (51%), Positives = 415/611 (68%), Gaps = 30/611 (5%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            T  G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT+T RLIG AAK Q+ 
Sbjct  5    TPEGPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAKYQLT  64

Query  64   MNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEI  123
             NA NTVF   +L+GRKFSDP VQ  +KHWPFK+  G  D P++ VQF+GE+KTFQP EI
Sbjct  65   RNARNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQPVEI  124

Query  124  SSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
             +M+L ++RE+AE   GK VK  V+TVP+ FN SQR+A KDAG IAGLNVLR +N  TAA
Sbjct  125  LAMLLAELRELAEKHTGKTVKEVVLTVPSCFNHSQRRAMKDAGEIAGLNVLRFVNPATAA  184

Query  184  AIAYGLDK--KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            +IAYG DK    GE +VL+FDLGGG  DVS+++IE+GI+EVKA   D  LGG+  DNRLV
Sbjct  185  SIAYGFDKDWTDGEHDVLVFDLGGGMLDVSVVTIEQGIYEVKAAVTDARLGGQVLDNRLV  244

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
            +H   +F+R H K++  N RA+ RLR ACE+AKR LSSS + YIE+D+L DGID+ +TIT
Sbjct  245  EHCVTDFERVHDKNLRVNLRAITRLRLACEQAKRALSSSTETYIELDALHDGIDYYATIT  304

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RA  E++  D F K ++ V+KVLRDA+++K +V EVV+ GGS R PK+ QLL DFF+ K 
Sbjct  305  RAEMENLSADLFDKALQLVQKVLRDARVAKDRVREVVVGGGSARSPKMLQLLKDFFSDKA  364

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
             +  I PDE  A+G TVQAAIL+   +S  L D ++LDVTPLSL  E  G     +I R+
Sbjct  365  LSSPIRPDEGAAFGVTVQAAILNC-VASPTLYDFIMLDVTPLSLWAEVDGTNSLVVIYRH  423

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
            TTVPTK++  FST  DNQ  + +++FEGE S    N LLG   +D IP  PRG  +I+VT
Sbjct  424  TTVPTKRTVPFSTSEDNQAVMRVRIFEGEHSDMSANCLLGTIEVDNIPLKPRGESEIEVT  483

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
             DI+A+ I+NVS  E STG E  ++I                         D   ++R+ 
Sbjct  484  LDINADDIVNVSVKEISTGLEKNLSI-----------------------GTDAREELRLG  520

Query  542  AKNALENYAYSLRNS--LNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAK  599
            +K ALE+YA ++ +S   N  +LK  I  AD + + D  T+T+ WL+ + S+EKE ++ K
Sbjct  521  SKTALESYANAVCSSATANIAELKRSI--ADMQAIKDSATDTLHWLNGNHSAEKEAFDVK  578

Query  600  QKELEGVANPV  610
            +++LE VA PV
Sbjct  579  RQKLEEVATPV  589

>PYU1_G003754
Length=650

 Score = 531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/614 (50%), Positives = 396/614 (64%), Gaps = 27/614 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  30   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  89

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI SG   K    V+ KG  K + P +I SMVL
Sbjct  90   TFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  146

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  147  TKMKETADGFLGKSVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  206

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     EF
Sbjct  207  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  265

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  266  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  323

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A+FE + G    +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  324  AQFEKLVGHLIERTMTPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTSVEEFF-GKKP  382

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  383  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  437

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  438  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSF  497

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV+A +K+TGKE  I I +  G LS A+I+RMVAEAE     D+  K  IEA
Sbjct  498  DIDANGIVNVAARDKATGKEQNIVIQSSGG-LSDADIERMVAEAEMNAEADQKRKELIEA  556

Query  543  KNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEK-EEYEAKQK  601
            KN  ++ +Y+      ++ LKE   + DK+ V ++V   ++ L      E  EE +A  +
Sbjct  557  KNEADSVSYT-----TEKTLKEHEDKLDKETV-EQVKAGLENLRTKAEGENAEEIKAALE  610

Query  602  ELEGVANPVLQKVY  615
            E++ ++  + + VY
Sbjct  611  EVQKLSLKIGEAVY  624

>PYAP_19738
Length=648

 Score = 531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/561 (53%), Positives = 369/561 (66%), Gaps = 20/561 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG  K + P +I SMVL
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGK-DAWVEAKG--KKYSPSQIGSMVL  145

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A++F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  146  TKMKETADSFLGKSVSQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  205

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EF
Sbjct  206  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVAEF  264

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  265  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  322

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQQ + +FF GK+P
Sbjct  323  ATFEKLVSGLVERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKP  381

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  382  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  436

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+VTF
Sbjct  437  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVTF  496

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NVSA +KSTGKE  I I +  G LS A+I+RMV EAE     D+  K  IEA
Sbjct  497  DIDANGIVNVSARDKSTGKEQSIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIEA  555

Query  543  KNALENYAYSLRNSLNDEKLK  563
            KN  ++ AY+   +L + + K
Sbjct  556  KNEADSVAYTTEKTLKEHEDK  576

>PYVX_15051
Length=632

 Score = 527 bits (1357),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 296/574 (52%), Positives = 377/574 (66%), Gaps = 22/574 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPAKRQAVTNPQN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF+D   Q   K   ++I SG   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETAEGFLGKSITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EF
Sbjct  188  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVSEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE +  +   +T+ P +K ++DA L K  ++EV+LVGG +R+PKVQQ + DFF GK+P
Sbjct  305  ATFEKLVANLIDRTIGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQQSVEDFF-GKKP  363

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  418

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V F
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVAF  478

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NVSA +K+T KE  I I +  G LS ++I+RMV EAE     D+  K  IE+
Sbjct  479  DIDANGIVNVSARDKATNKEQSIVIQSSGG-LSDSDIERMVQEAEMNAEADQKRKELIES  537

Query  543  KNALENYAYSLRNSL--NDEKLKEKIPEADKKVV  574
            KN  ++ AY++  +L  +++KL ++  E  K  V
Sbjct  538  KNEADSVAYNVEKTLKEHEDKLDDETKEQVKTAV  571

>PHYKE_9008
Length=650

 Score = 524 bits (1350),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 307/614 (50%), Positives = 395/614 (64%), Gaps = 27/614 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPAKRQAVTNPEN  87

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKFSD   Q   K   +KI  G   K    V+ KG+   + P +I SMVL
Sbjct  88   TFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  144

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  145  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  204

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  205  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  263

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  264  KKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  321

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + DFF GK+P
Sbjct  322  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEDFF-GKKP  380

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  381  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  435

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  436  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAPRGVPQIEVSF  495

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS AEI++MVA+AE   + D+  K  IEA
Sbjct  496  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAADQERKELIEA  554

Query  543  KNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEK-EEYEAKQK  601
            KN  ++ AY       ++ LKE   + D + V +KV   +  L      E  EE +A  +
Sbjct  555  KNDADSTAYQ-----TEKTLKEHEDKIDAETV-EKVKAALADLQKKAEGENTEEIKAALE  608

Query  602  ELEGVANPVLQKVY  615
            E++ ++  + + VY
Sbjct  609  EVQKLSMKIGEAVY  622

>H310_06631
Length=651

 Score = 524 bits (1349),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 392/615 (64%), Gaps = 29/615 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPFN  87

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQIT-VQFKGESKTFQPEEISSMV  127
            T++  KRLIGRK+ D   Q   K   +KI +G    P  T    + + + + P +I SMV
Sbjct  88   TLYAVKRLIGRKYQDKETQDVSKVVSYKIVAG----PNGTDAWVEAQGQKYSPSQIGSMV  143

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AY
Sbjct  144  LTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  203

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            GLDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H   E
Sbjct  204  GLDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHLVSE  262

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  301
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  263  FKRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  320

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RA+FE + G    +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + +FF GK 
Sbjct  321  RAQFEKLVGHLIERTLNPCKKCVKDAGVTKEEINEVILVGGMSRMPKVQTSVEEFF-GKR  379

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
            P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RN
Sbjct  380  PSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRN  434

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
            TT+PTKKSQ FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+
Sbjct  435  TTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVS  494

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
            FDIDANGI+NV A +K+TGKE  I I +  G LS+ EI+RMV EAE     D   K  IE
Sbjct  495  FDIDANGIVNVGARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIE  553

Query  542  AKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL-DAHQSSEKEEYEAKQ  600
            AKN  ++  Y+   +L + + K      D  +V D V  ++Q + DA +  + E  +A  
Sbjct  554  AKNEADSLVYTTEKTLTEHEAK-----LDAALV-DSVKASLQGVRDAIEKDDLETLKAAL  607

Query  601  KELEGVANPVLQKVY  615
            +EL   +  + + +Y
Sbjct  608  EELNKTSMKIGEAIY  622

>PHYSO_525429
Length=610

 Score = 521 bits (1341),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 293/601 (49%), Positives = 399/601 (66%), Gaps = 28/601 (5%)

Query  16   TTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKR  75
            TT   VGVW N+ V ++ +D   R  PS+VAFTDTERL+GD AK QVA N +NTVF   R
Sbjct  3    TTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGTTR  59

Query  76   LIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVA  135
            LIGRKFSD  VQ D+KHWPFK+  G  D P + VQ  G++KTF+P EI +M+L + RE  
Sbjct  60   LIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEARETV  119

Query  136  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK--KG  193
            E  +GK V+NAV+TVPA FN +QRQA KDAGA+AGLNV R+I+  TAAAIA+GL+   K 
Sbjct  120  ETHLGKRVENAVVTVPASFNYAQRQAIKDAGAVAGLNVARLISASTAAAIAHGLENKTKA  179

Query  194  GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHR  253
            G+RN+L+ DLGGGT DVSL++IEE I+EV ATAG+ HLGGEDFD+RLV+H   EFKR HR
Sbjct  180  GQRNLLVLDLGGGTLDVSLVAIEEEIYEVLATAGNAHLGGEDFDSRLVEHCVAEFKRMHR  239

Query  254  KDITENQRALRRLRTACERAKRTLSS--SAQAYIEIDSLFDGIDFNSTITRARFEDMCGD  311
            KD++ N RA+ RLR ACE AKR L +  S +  IE+D+L++GIDF++ ITRA+FE +C D
Sbjct  240  KDLSTNARAMMRLRMACESAKRALFAPESVEKLIELDALYEGIDFHTKITRAQFEKLCAD  299

Query  312  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEA  371
                 M PV++VL DA + +S+V EVV+VGGS RI KV++LL +FFNGK+  +S + +E 
Sbjct  300  LSDDIMLPVQQVLSDASVLRSKVDEVVMVGGSMRITKVEELLKEFFNGKKIIRSRHEEEL  359

Query  372  VAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT-LIARNTTVPTKKSQ  430
               GAT+ AA+L+   S  K  +  +L                T+ +I R+TT+PT+K++
Sbjct  360  NVLGATMHAAMLTDELSVIKPLEEFMLLDVTPLSLGVKIDDTNTSVMIPRSTTIPTRKTR  419

Query  431  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  490
            TFST  DNQ  V I++ EGE     DN ++GK   DG+P  PRG  +I+VT ++DANG +
Sbjct  420  TFSTSQDNQSVVQIELLEGEDG---DNRVIGKLKGDGLPLEPRGEFKIEVTVEVDANGCI  476

Query  491  NVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYA  550
             V   ++STG+  K+ ++ D   LS  EIDRM     K  S+ E           LENYA
Sbjct  477  TVLIADESTGQSKKLEVSGDC--LSALEIDRMRKSVMKDASKIE-----------LENYA  523

Query  551  YSLRNSLNDE--KLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVAN  608
             S+R++      +LK  I E   + V+++ TET+ WL+ + S  + + + K+++LE  A 
Sbjct  524  NSVRSTAAKRIAELKRSIEEM--QAVEEQATETLHWLNRNHSVGRADIDVKRRKLEEAAT  581

Query  609  P  609
            P
Sbjct  582  P  582

>PITG_15786
Length=633

 Score = 520 bits (1340),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 301/613 (49%), Positives = 392/613 (64%), Gaps = 25/613 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVNEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFF-GKKP  363

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  418

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSF  478

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS+AEI++MVA+AE   + D+  K  IEA
Sbjct  479  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEA  537

Query  543  KNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKE  602
            KN  ++  YS      ++ LKE   + D + ++   T         +    EE +A  +E
Sbjct  538  KNDADSTLYS-----TEKTLKEHEDKIDAETLEQVKTALTDLRTKSEGDNTEEIKAALEE  592

Query  603  LEGVANPVLQKVY  615
            ++ ++  + + VY
Sbjct  593  VQKLSMKIGEAVY  605

>H257_01277
Length=652

 Score = 521 bits (1341),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 285/561 (51%), Positives = 369/561 (66%), Gaps = 20/561 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N +N
Sbjct  28   IGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPYN  87

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T++  KRLIGRKF D   Q   K   +KI +G  +     V+ +G+   + P +I SMVL
Sbjct  88   TLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGT-NGTDAWVEAQGQK--YSPSQIGSMVL  144

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E AE F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  145  TKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  204

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            LDK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H   EF
Sbjct  205  LDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHLVSEF  263

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  264  KRESGIDLSGDGLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  321

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A+FE +      +T+ P +K ++DA ++K +++EV+LVGG +R+PKVQ  + +FF GK P
Sbjct  322  AQFEKLVNHLIERTLNPCKKCVKDAGVTKDEINEVILVGGMSRMPKVQTSVEEFF-GKRP  380

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  381  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  435

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+F
Sbjct  436  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVSF  495

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS+ EI+RMV EAE     D   K  IEA
Sbjct  496  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEDEIERMVREAEVNAEADAKRKELIEA  554

Query  543  KNALENYAYSLRNSLNDEKLK  563
            KN  ++  Y+   +L + + K
Sbjct  555  KNEADSLVYTTEKTLTEHEAK  575

>PPTG_18274
Length=648

 Score = 520 bits (1339),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 303/615 (49%), Positives = 395/615 (64%), Gaps = 29/615 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  86

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG    + P +I SMVL
Sbjct  87   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGTK--YSPSQIGSMVL  143

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKPVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  262

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  263  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  320

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  321  ATFEKLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFF-GKKP  379

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  380  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  434

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  435  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSF  494

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS+AEI++MVA+AE   + D+  K  IEA
Sbjct  495  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEA  553

Query  543  KNALENYAYSLRNSL--NDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            KN  ++  YS   +L  +++K+  +  E  K  + D  T++       +    EE +A  
Sbjct  554  KNEADSTLYSTEKTLKEHEDKIDAETLEKVKAALADLRTKS-------EGDNTEEIKAAL  606

Query  601  KELEGVANPVLQKVY  615
            +E++ ++  + + VY
Sbjct  607  EEVQKMSMKIGEAVY  621

>PHYRA_71123
Length=633

 Score = 518 bits (1333),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 301/615 (49%), Positives = 396/615 (64%), Gaps = 29/615 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG  K + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKESSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE + G    +TM P +K ++DA L KS+++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEQLVGKLIERTMGPCKKCVKDAGLDKSEINEVILVGGMSRMPKVQTTVEEFF-GKKP  363

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  418

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAPRGVPQIEVSF  478

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS++EI++MVA+AE   + D   K  IEA
Sbjct  479  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSESEIEKMVADAEANAAADLERKELIEA  537

Query  543  KNALENYAYSLRNSL--NDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            KN  ++  Y+   +L  +++K+  +  E  K  + D  T++       ++   EE +A  
Sbjct  538  KNDADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKS-------ETDNTEEIKAAL  590

Query  601  KELEGVANPVLQKVY  615
            +E++ ++  + + VY
Sbjct  591  EEVQKMSMKIGEAVY  605

>SDRG_11043
Length=649

 Score = 517 bits (1332),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 285/562 (51%), Positives = 367/562 (65%), Gaps = 22/562 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGA-GDKPQITVQFKGESKTFQPEEISSMV  127
            T++  KRLIGRKF+D   Q   K   +KI  G  G    +  Q     + + P +I SMV
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQ----GQKYSPSQIGSMV  142

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AY
Sbjct  143  LTKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAY  202

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            G+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     E
Sbjct  203  GMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGE  261

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTIT  301
            FKR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  IT
Sbjct  262  FKRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKIT  319

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            RA+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + DFF GK 
Sbjct  320  RAQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKR  378

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
            P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RN
Sbjct  379  PSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRN  433

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVT  481
            TT+PTKKSQ FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+
Sbjct  434  TTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVS  493

Query  482  FDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE  541
            FDIDANGI+NVSA +K+TGKE  I I +  G LS+ EI+RMV EAE     D   K  IE
Sbjct  494  FDIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIE  552

Query  542  AKNALENYAYSLRNSLNDEKLK  563
             KN  ++  Y+   +L++ + K
Sbjct  553  VKNEADSLVYNAEKTLSEHESK  574

>PHYSO_500480
Length=633

 Score = 516 bits (1330),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 300/615 (49%), Positives = 396/615 (64%), Gaps = 29/615 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKHVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            +++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  I+R
Sbjct  247  RKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKISR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE + G+   +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEKLVGNLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQSTVEEFF-GKKP  363

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  418

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSF  478

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS+AEI++MVA+AE   + D+  K  IEA
Sbjct  479  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEA  537

Query  543  KNALENYAYSLRNSL--NDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            KN  ++  Y+   +L  +++K+  +  E  K  + D  T++       +    EE +A  
Sbjct  538  KNEADSTLYTTEKTLKEHEDKIDAETLEKVKAALADLRTKS-------EGDNTEEIKAAL  590

Query  601  KELEGVANPVLQKVY  615
            +E++ ++  + + VY
Sbjct  591  EEVQKMSMKIGEAVY  605

>PHYCA_541134
Length=633

 Score = 516 bits (1329),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 301/615 (49%), Positives = 394/615 (64%), Gaps = 29/615 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG+   + P +I SMVL
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGK-DAWVEAKGQK--YSPSQIGSMVL  127

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  128  TKMKETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  187

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  188  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVDEF  246

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  247  KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  304

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE + G    +TM P +K ++DA L KS ++EV+LVGG +R+PKVQ  + +FF GK+P
Sbjct  305  ATFEKLVGKLIERTMGPCKKCVKDAGLEKSDINEVILVGGMSRMPKVQTSVEEFF-GKKP  363

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  364  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNT  418

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+F
Sbjct  419  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSF  478

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV A +K+TGKE  I I +  G LS AEI++MVA+AE   + D+  K  IEA
Sbjct  479  DIDANGIVNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAADQQRKELIEA  537

Query  543  KNALENYAYSLRNSL--NDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            KN  ++  Y+   +L  +++K+  +  E  K  + D  T++       +    EE +A  
Sbjct  538  KNEADSTLYTTEKTLTEHEDKIDAETLEKVKAALADLRTKS-------EGDNTEEIKAAL  590

Query  601  KELEGVANPVLQKVY  615
            +E++ ++  + + VY
Sbjct  591  EEVQKMSMKIGEAVY  605

>PHALS_07616
Length=677

 Score = 517 bits (1331),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 295/571 (52%), Positives = 374/571 (65%), Gaps = 22/571 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D  ERL+G  AK Q   N  N
Sbjct  55   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  114

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T +  KRLIGRKF D   Q   K   +KI  G   K    V+ KG  K + P +I SMVL
Sbjct  115  TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGK-DAWVEAKG--KKYSPSQIGSMVL  171

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AVITVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  172  TKMKETADGFLGKPITQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  231

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  232  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVSEF  290

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID----FNSTITRAR  304
            K++   +++ +  A++RLR A E+AKR L   AQ  I +  +          N  ITRA 
Sbjct  291  KKETSINLSGDNLAMQRLREAAEKAKRELDGLAQTDISLPFITADASGPKHLNMKITRAT  350

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
            FE + G    +TM P +K ++DA LSKS ++EV+LVGG +R+PKVQ  + +FF GK+P+K
Sbjct  351  FEKLVGKLIERTMGPCKKCVKDAGLSKSDINEVILVGGMSRMPKVQASVEEFF-GKKPSK  409

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNTT+
Sbjct  410  GVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTI  464

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            PTKKSQ FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDI
Sbjct  465  PTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDI  524

Query  485  DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
            DANGI+NV A +K+TGKE  I I +  G LS+AEI++MVA+AE   + D+  K  IEAKN
Sbjct  525  DANGIVNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAKN  583

Query  545  ALENYAYSLRNSLN------DEKLKEKIPEA  569
              ++  Y+   +L       D +L EK+  A
Sbjct  584  DADSTIYTTEKTLKEHEDKIDAELLEKVKTA  614

>CCI45982
Length=661

 Score = 516 bits (1329),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 298/617 (48%), Positives = 387/617 (63%), Gaps = 30/617 (5%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  64
            SG  +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  32   SGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  91

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  +T +  KRLIGRK++D       +   +KI  G   K    V+ KG+   + P +I 
Sbjct  92   NPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGK-DAWVETKGQK--YSPSQIG  148

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA
Sbjct  149  SMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAA  208

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H 
Sbjct  209  LAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHL  267

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNS  298
              +FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D       N 
Sbjct  268  VSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKHLNM  325

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358
             ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ + DFF 
Sbjct  326  KITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEDFF-  384

Query  359  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  418
            GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI
Sbjct  385  GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLI  439

Query  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  478
             RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI
Sbjct  440  PRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQI  499

Query  479  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKV  538
            +V+FDIDANGI+NV+A +K+TGKE  I I +  G LS+A+I+RMV EAE   + D+  K 
Sbjct  500  EVSFDIDANGIVNVAARDKATGKEQNIVIQSSGG-LSEADIERMVQEAEMNATADQQRKE  558

Query  539  RIEAKNALENYAYSLRNSLND----------EKLKEKIPEADKKVVDDKVTETIQWLDAH  588
             IE KN  +   YS   +L +          E++K  + +   K   D V E    L+  
Sbjct  559  LIELKNDADGVIYSTEKTLKEYEDKIEATLVEQVKTDLADLRSKAEGDSVDEIKAALEKV  618

Query  589  QSSEKEEYEAKQKELEG  605
            Q S  +  EA  K  +G
Sbjct  619  QQSSLKIGEAVYKAQQG  635

>CCA21514
Length=659

 Score = 509 bits (1312),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 296/617 (48%), Positives = 385/617 (62%), Gaps = 30/617 (5%)

Query  6    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAM  64
            SG  +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  31   SGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  90

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            N  +T +  KRLIGRK++D       +   +KI  G+  K    V+ KG+   + P +I 
Sbjct  91   NPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGK-DAWVETKGQK--YSPSQIG  147

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL KM+E A++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL VLRIINEPTAAA
Sbjct  148  SMVLGKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAA  207

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYG+DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ H 
Sbjct  208  LAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRHL  266

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNS  298
              +FK++   D++++  A++RLR A E+AKR L   AQ  I +   F   D       N 
Sbjct  267  VSKFKQESGIDVSKDTLAMQRLREAAEKAKRELDGLAQTDISLP--FITADASGPKHLNM  324

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358
             ITR+ FE++      +T+ P  K + DA L+K  ++EV+LVGG +R+PKVQQ + +FF 
Sbjct  325  KITRSTFENLVSKLIERTITPCRKCVTDAGLAKKDINEVILVGGMSRMPKVQQAVEEFF-  383

Query  359  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  418
            GK+P+K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI
Sbjct  384  GKKPSKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLI  438

Query  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  478
             RNTT+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI
Sbjct  439  PRNTTIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQI  498

Query  479  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKV  538
            +V+FDIDANGI+NV+A +K+TGKE  I I +  G LS A+I+RMV EAE   + D+  K 
Sbjct  499  EVSFDIDANGIVNVAARDKATGKEQNIIIQSSGG-LSDADIERMVQEAEMNAAADQQRKE  557

Query  539  RIEAKNALENYAYSLRNSLND----------EKLKEKIPEADKKVVDDKVTETIQWLDAH  588
             IE KN  ++  YS   +L +          E++K  + +   K   D   E    L+  
Sbjct  558  VIELKNDADSVIYSTEKTLKEFEDKIEATLAEQVKTDLADLKSKAEGDSADEIKAALEKV  617

Query  589  QSSEKEEYEAKQKELEG  605
            Q S  +  EA  K  +G
Sbjct  618  QQSSLKIGEAVYKAQQG  634

>SDRG_05816
Length=479

 Score = 497 bits (1280),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 271/484 (56%), Positives = 347/484 (72%), Gaps = 15/484 (3%)

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+
Sbjct  1    MVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAAL  60

Query  186  AYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +V
Sbjct  61   AYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNMV  120

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            D    EFKRK++  D T + R++RRLRTACE AKR LS++  A IE+DSLF+G+DF+ST+
Sbjct  121  DFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSSTM  180

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TRA+FE +  + F++T E V KVL DA +    + E+VLVGGSTRIPKVQ +LS  F GK
Sbjct  181  TRAKFESLNEECFKRTEETVLKVLADANMQPGDITELVLVGGSTRIPKVQNMLSAVFGGK  240

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E +KSINPDEAVAYGA VQ AILSG   ++    LLL+DVTPLSLG+E  G VM+ LI R
Sbjct  241  ELSKSINPDEAVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIELVGKVMSVLIKR  299

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDV  480
            NT +P KK++ ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+V
Sbjct  300  NTAIPVKKTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIEV  359

Query  481  TFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            TF+IDANGIL+VSA +K TG +N  TI+N++GRL+Q +IDRMV EAEK+K +D     RI
Sbjct  360  TFEIDANGILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKRI  419

Query  541  EAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQ  600
            +A+N LE Y Y         +  E   + +       + E   W+D ++     E E K+
Sbjct  420  DARNDLEGYLY---------RALEAASKKNDAAAQTALCEARDWMDDNEELTVRELEDKR  470

Query  601  KELE  604
            + LE
Sbjct  471  RVLE  474

>PYIR_19697
Length=608

 Score = 500 bits (1288),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 291/593 (49%), Positives = 380/593 (64%), Gaps = 27/593 (5%)

Query  31   IIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  89
            +I N +G RTTPS VA  D  ERL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  90   IKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  149
             K   +KI +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKTITQAVVT  124

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            VPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  269
            VS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEFKKETSIDLSSDNLAMQRLREA  243

Query  270  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  323
             E+AKR L   AQ  I +   F   D       N  ITRA FE +      +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVSHLIERTMTPCKKC  301

Query  324  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAIL  383
            ++DA L K  ++EV+LVGG +R+PKVQ  + +FF GK+P+K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQTTVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  384  SGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVL  443
             G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD+Q  V 
Sbjct  361  RGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  444  IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  503
            I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI+NV+A +K+TGKE 
Sbjct  416  IKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVAARDKATGKEQ  475

Query  504  KITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLK  563
             I I +  G LS +EI+RMV EAE     D+  K  IE KN  ++ AY+      ++ LK
Sbjct  476  NIVIQSSGG-LSDSEIERMVQEAEMNAEADQKRKELIETKNEADSVAYT-----TEKTLK  529

Query  564  EKIPEADKKVVDDKVTETIQWLDAHQSSEK-EEYEAKQKELEGVANPVLQKVY  615
            E   + DK+ V ++V   ++ L +    E  EE +A  +E++ ++  + + VY
Sbjct  530  EHEEKLDKETV-EQVKAGLENLRSKAEGENAEEIKAALEEVQKLSLKIGEAVY  581

>PYAR_22188
Length=634

 Score = 500 bits (1288),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 302/622 (49%), Positives = 383/622 (62%), Gaps = 60/622 (10%)

Query  31   IIANDQGNRTTPSYVAFTDTE-RLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQAD  89
            +I N +G RTTPS VA  D E RL+G  AK Q   N  NT +  KRLIGRKF D   Q  
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  90   IKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKNAVIT  149
             K   +KI +G   K    V+ KG  K + P +I SMVL KM+E A+ F+GK +  AV+T
Sbjct  68   SKVVSYKIVAGPNGK-DAWVEAKG--KKYSPSQIGSMVLTKMKETADGFLGKPITQAVVT  124

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            VPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFD
Sbjct  125  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFD  183

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  269
            VS+L I  G+FEVKAT GDT LGGEDFD  L+ +   EFK++   D++ +  A++RLR A
Sbjct  184  VSILEISGGVFEVKATNGDTLLGGEDFDEELLRYLVTEFKKETSIDLSGDNLAMQRLREA  243

Query  270  CERAKRTLSSSAQAYIEIDSLFDGID------FNSTITRARFEDMCGDYFRKTMEPVEKV  323
             E+AKR L   AQ  I +   F   D       N  ITRA FE + G+   +TM P +K 
Sbjct  244  AEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITRATFEKLVGNLVERTMGPCKKC  301

Query  324  LRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAIL  383
            ++DA L K  ++EV+LVGG +R+PKVQQ + +FF GK+P+K +NPDE VA GA +Q  +L
Sbjct  302  VKDAGLDKKDINEVILVGGMSRMPKVQQSVEEFF-GKKPSKGVNPDEVVAMGAAIQGGVL  360

Query  384  SGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVL  443
             G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST AD+Q  V 
Sbjct  361  RGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAADSQTQVG  415

Query  444  IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKEN  503
            I+V +GER M  DN  LG F+L GIPP PRGVPQI+VTFDIDANGI+NVSA +KSTGKE 
Sbjct  416  IKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSARDKSTGKEQ  475

Query  504  KITITNDKGRLSQAEIDRMVAEAE-------KYKS------------------EDEANKV  538
             I I +  G LS A+I+RMV EAE       K K+                   D+  K 
Sbjct  476  SIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIXXXXERMVQEAEMNAEADQKRKA  534

Query  539  RIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTET----IQWLDAHQSSE-K  593
             IEAKN  ++ AYS   SL + + K          +D + +ET    IQ L      E  
Sbjct  535  LIEAKNEADSVAYSTEKSLKEHEDK----------IDAETSETVKTAIQNLRTQAEGEDA  584

Query  594  EEYEAKQKELEGVANPVLQKVY  615
            E  +A  +E++ +A  + + VY
Sbjct  585  EAIKAAVEEVQKLAMKIGEAVY  606

>PHYSO_339666
Length=585

 Score = 491 bits (1264),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 278/608 (46%), Positives = 383/608 (63%), Gaps = 38/608 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT+T  L+G+AAK Q+  N  NT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
            VFD  + +GRKFS+  ++  +  WPFK+  G  D PQ+ VQ+KGE+K+F P EI +++L 
Sbjct  65   VFDLTQFVGRKFSE--LRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLY  122

Query  130  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  189
            +MR++AE ++ +EV  AV TVP  FN  QRQA KDAGAIAGL+V+R++N  T A I YG 
Sbjct  123  EMRKIAEIYLDQEVTKAVFTVPGSFNYFQRQAMKDAGAIAGLDVIRLVNSATVACIEYGF  182

Query  190  DK---KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            +    + GE NVL+ D G  + +                          FD+RLV+HF  
Sbjct  183  NTLVGRVGELNVLVVDYGASSLN--------------------------FDSRLVEHFAA  216

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            EF+R+H KD+  +  A+ RLRTACE AKR LSSS +A+IE+D+L DGI+F S I     E
Sbjct  217  EFQRRHGKDLRSDSSAVMRLRTACEHAKRALSSSMEAFIELDALHDGINFYSMIRCVWME  276

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
             +C D F K +  VEK+LR+A+L K QV E+VLVGGST +PKVQQ L DFFNGK    S+
Sbjct  277  RLCADLFDKMLRLVEKLLREARLRKDQVDEIVLVGGSTHVPKVQQKLKDFFNGK--MLSL  334

Query  367  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL-IARNTTVP  425
              DEA A+G  VQ   L G   S KL + +LLD   L   +E    +M  + +++N+T+P
Sbjct  335  RQDEAAAFGVAVQGDFL-GGLPSPKLDEYMLLDTASLEFSVEIDDCMMKEVPVSKNSTLP  393

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
             +KS+TF T   N+  + I+ FEGE +    N LL +F +DGI   P  + +I+V  D+D
Sbjct  394  MRKSRTFLTANANKSTMRIKAFEGEATTVATNRLLCEFEMDGITMTPGRLSEIEVAIDVD  453

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNA  545
            ANG L VSAVEKSTGKE KITI  +  RLS +E++RM +  E+   + E  ++RI++K  
Sbjct  454  ANGSLTVSAVEKSTGKEKKITI--NCSRLSTSEVERMHSNIEETFLDPE-EELRIQSKAV  510

Query  546  LENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEG  605
            LE YA S+ +S      K K   A +  ++    E +QWLD + S++KE ++AK+++L  
Sbjct  511  LERYANSVCSSAAKRIAKLKRSLAKEYTIESSAMEALQWLDTNPSAKKEHFDAKRQKLGE  570

Query  606  VANPVLQK  613
            +A P  Q+
Sbjct  571  MATPSGQR  578

>SPRG_02294
Length=634

 Score = 485 bits (1248),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 282/561 (50%), Positives = 366/561 (65%), Gaps = 35/561 (6%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNAHN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  +  ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            T++  KRLIGRKFSD   Q   K   + I +G   +       + + + + P +I SMVL
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQ---DAWVEAQGQKYSPSQIGSMVL  143

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             KM+E A+ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG
Sbjct  144  TKMKETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYG  203

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+     EF
Sbjct  204  MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRFLVGEF  262

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            KR+   D++ +  A++RLR A E+AKR L   AQ  + +   F   D       N  ITR
Sbjct  263  KRESGIDLSGDVLAMQRLREAAEKAKRELDGLAQTDVSLP--FITADATGPKHLNIKITR  320

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A+FE + G    +T+ P +K ++DA +SK +++EV+LVGG +R+PKVQQ + DFF GK P
Sbjct  321  AQFEKLVGHLIERTLNPCKKCVKDAGVSKEEINEVILVGGMSRMPKVQQSVEDFF-GKRP  379

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
             +                 +L G+     ++D+LLLDVTPLSLG+ET GGV T LI RNT
Sbjct  380  RR---------------GGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNT  419

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+F
Sbjct  420  TIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSF  479

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NVSA +K+TGKE  I I +  G LS+ EI+RMV EAE     D   K  IE 
Sbjct  480  DIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEV  538

Query  543  KNALENYAYSLRNSLNDEKLK  563
            KN  ++  Y+   +L++ + K
Sbjct  539  KNEADSLVYNAEKTLSEHESK  559

>PITG_15370
Length=474

 Score = 450 bits (1158),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 245/289 (85%), Positives = 262/289 (91%), Gaps = 3/289 (1%)

Query  148  ITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGT  207
            +TVPAYFNDSQRQAT  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  150  VTVPAYFNDSQRQATIYAGAIAGLNVLRIINEPTAAAIAYGLDKKGGEHNVLIFDLGGGT  209

Query  208  FDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLR  267
            FDVSLL+IE+GIFEVKATAGDTHLGGEDFDNRLV+ F  EFKRKHRKD+T NQRALRRLR
Sbjct  210  FDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVEFFVTEFKRKHRKDMTSNQRALRRLR  269

Query  268  TACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDA  327
            TACERAKRTLS+SAQAYIEIDSLFDG+DFNSTITRARFED+C DYFRKTM+PV +VLRD+
Sbjct  270  TACERAKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFEDLCSDYFRKTMDPVAQVLRDS  329

Query  328  KLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNd  387
            KLSK+QV+E+VLVG STR  KVQQLL DFFNGKE  KSINPDEAVAYGATVQAAILSGN+
Sbjct  330  KLSKNQVNEIVLVGSSTR-SKVQQLLKDFFNGKELFKSINPDEAVAYGATVQAAILSGNE  388

Query  388  sseklqdlllldvtplslglETAGGVMTTLIARN--TTVPTKKSQTFST  434
            SS KLQDLLLLDV PLSLGLETAGGVMT LI RN  T   T K ++ ST
Sbjct  389  SSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNNSTLSLTGKYRSLST  437

>PYAR_19930
Length=625

 Score = 447 bits (1151),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 246/417 (59%), Positives = 309/417 (74%), Gaps = 10/417 (2%)

Query  136  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  195
            E  IG+  K    + P     + RQ+TKDAGAIAGL+V RIINEPTAAA+AYGLD   G+
Sbjct  214  ERLIGEAAKIQAASNPT----NTRQSTKDAGAIAGLDVKRIINEPTAAALAYGLDTNAGQ  269

Query  196  R----NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRK  251
                 NVLIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ LVD    EFKRK
Sbjct  270  SGAGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNLVDFLVTEFKRK  329

Query  252  HRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            ++  D T + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+ST+TRA+ E +  
Sbjct  330  NKGLDPTGSARAMRRLRTACESAKRMLSTTTSAAVEVDSLFEGVDFSSTLTRAKLESLNE  389

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDE  370
            D F++  E V+KVL DAK+    + EVVLVGGSTRIPKVQ LLS  F GKE +KSINPDE
Sbjct  390  DLFKRCEETVQKVLADAKMKPDDITEVVLVGGSTRIPKVQSLLSALFGGKELSKSINPDE  449

Query  371  AVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQ  430
            AVAYGA VQ AILSG   ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P +K++
Sbjct  450  AVAYGAAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKTR  508

Query  431  TFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGIL  490
             ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++VTF+IDANGIL
Sbjct  509  VYTTEEDYQTSVDVCIYEGERAHVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDANGIL  568

Query  491  NVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALE  547
            NVSA +K TG   + TI+N++GRL+Q +IDRMV++AEK+K +D     +IEA+N LE
Sbjct  569  NVSARDKKTGARAETTISNNRGRLTQEDIDRMVSDAEKFKKDDAELLRKIEARNELE  625

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 2/65 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D ERLIG+AAK Q A 
Sbjct  168  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQERLIGEAAKIQAAS  227

Query  65   NAHNT  69
            N  NT
Sbjct  228  NPTNT  232

>PPTG_02121
Length=222

 Score = 426 bits (1095),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 205/211 (97%), Positives = 207/211 (98%), Gaps = 0/211 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M Q TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NTVFDAKRLIGRKFSDPIVQADIKHWPFKI+SG GDKPQITVQFKGESKTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211

>PHYSO_552116
Length=570

 Score = 427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/517 (43%), Positives = 335/517 (65%), Gaps = 5/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF I++GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+++++ VI+ PA+ +DS  +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVISKPAHTDDSYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  + 
Sbjct  185  EAANNAKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AK+TLS+  QA IE+D+L +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRIACEVAKKTLSTQTQANIEVDTLMEGEDFSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY  +T+  +E +L + +L K  +  +VLVGGSTRIP VQ L+  FF+GK  +  ++
Sbjct  305  LITDYVHETITEIEAILEENELEKEDIDHIVLVGGSTRIPLVQNLVKKFFDGKNVHTQLS  364

Query  368  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDEAVAYGAT++ + L+           L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAYGATIEGSGLAELVGVPAPKNPLNMVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+VTF +  
Sbjct  425  TATELFTTSEDNQEAVYLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIEVTFTVST  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L V+A E+  GK++ + +T D  RL+ A++  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PYAP_16216
Length=564

 Score = 426 bits (1096),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 338/517 (65%), Gaps = 5/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NTV
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+   +   +  +  W F+++ GA           GE+    P +  S+++  
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+ V + VI +PA+  +SQ++  + A   AG+NV+  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGETVDSIVINIPAHAGESQKELIRAAATKAGVNVMSYLSEPLAAAIAYGLD  184

Query  191  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
               K       L+FD+GG T DV+LLS+++G+FE+ AT+G+  LGGEDF   + +H  + 
Sbjct  185  ENTKNSHAEYALVFDIGGATHDVTLLSVDKGLFEIVATSGNDALGGEDFTKAIFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F+RK + ++ +NQ+A  RLR ACE AKR+LS+ +Q  IE+DSL +G DF   ++R RFE+
Sbjct  245  FQRKTKLNVKDNQKASSRLRAACETAKRSLSTQSQVNIEVDSLMEGEDFALKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  D+ + +++ VEK+L +A++ K+ +  V+L+GGS+RIP VQ  +  FF+GK+ +  I+
Sbjct  305  LIADFVKDSLKEVEKLLEEAEIEKADIDHVILIGGSSRIPLVQNSVKKFFDGKKTHMHIS  364

Query  368  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDE VA+GAT++AA +       E       ++VTPL+L +  A G ++ +I R+T +PT
Sbjct  365  PDEVVAHGATLEAAAIGDIAALGEPKSAQNDVNVTPLTLSVALANGSVSEVIHRDTVLPT  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T  DNQ  + IQV+EGER M +DN LL +  + GI P+P+G  +I+VTF I +
Sbjct  425  SATEVFTTSVDNQDSIFIQVYEGERVMAKDNTLLAQLKVTGISPLPKGEAEIEVTFAISS  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L V+A E S GK+  + + ND  RL+ A++  ++
Sbjct  485  KGVLTVTANEASAGKKT-LEVKNDAKRLTAADVAAVI  520

>PYAR_14487
Length=467

 Score = 422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 261/284 (92%), Gaps = 0/284 (0%)

Query  370  EAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKS  429
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  184  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243

Query  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303

Query  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549
            LNVSAVEKSTGKENKITITNDKGRLSQA+I+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363

Query  550  AYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANP  609
            AY+LRN+LNDEKL+ +IPE D+K +DDKVTE I WLDAHQ+SEKEE+EAKQKELEG+ANP
Sbjct  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423

Query  610  VLQKVYaaaggmggmpggmpagagasaapsaggaDQGPKIEEVD  653
            +LQK+YA+AG  GGMPGG P   GA     + G DQGPKIEEVD
Sbjct  424  ILQKMYASAGAAGGMPGGAPGAPGAPGPAPSAGGDQGPKIEEVD  467

 Score = 343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 187/245 (76%), Gaps = 40/245 (16%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MAQ+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV---KATAGDTHLGGEDFD  237
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE     AT     L G D  
Sbjct  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQS  203

Query  238  NRLVD  242
             +L D
Sbjct  204  EKLQD  208

>HYAP_01993
Length=569

 Score = 426 bits (1094),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 221/527 (42%), Positives = 338/527 (64%), Gaps = 5/527 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A NT+
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF ++ GA    Q   Q  GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+++++ VI  PA+ ++   +    A    G+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVINKPAHTDEKYTELLDAAAKKVGVNVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G+  LGGEDF   + +H  + 
Sbjct  185  EAANNDKPEFVLVFDIGGATHDVTLLNADKGLFEVVASKGNDTLGGEDFTAAIFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  245  FLRKTKLDVKPNQKASSRLRLACEAAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  D  +KT+  +E +L+D +L K  +  VVLVGGS+RIP VQ L+  FF  K  +  ++
Sbjct  305  LINDDVQKTITEIEAILKDNELEKEDIDHVVLVGGSSRIPLVQTLIKKFFENKTLHTQLS  364

Query  368  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDEAVA+GAT++A+ L+    S    + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASCLAELLGSEAPAKPLNMVNVVPLTLSVALANGSVSELIQRDTILPA  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T +DNQ    +Q++EG+R M +DN L+ + ++ GI P+P+G  +IDVTF +  
Sbjct  425  SATEVFTTSSDNQEAAFLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIDVTFTVST  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSED  533
             G+L V+A E+  G ++ + + +D  RL+ A++  +V +A+    ED
Sbjct  485  KGVLTVTASERKAGSKS-LEVMHDSTRLTPADVAAVVKKADDAADED  530

>PITG_05721
Length=302

 Score = 411 bits (1057),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/292 (77%), Positives = 247/292 (85%), Gaps = 12/292 (4%)

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L K +      I  + K + +TVPAYFNDSQ QATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  1    MLQKCKPTTHRKIKNKTKTSEVTVPAYFNDSQHQATKDAGAIAGLNVLRIINEPTAAAIA  60

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            YGLD+KGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGG DFDNR+V+ F  
Sbjct  61   YGLDEKGGENNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGGDFDNRMVEFFVT  120

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
            E K  HR            LRTACER KRTLS+SAQAYIEIDSLFDG+DFNSTITRARFE
Sbjct  121  EVKPLHR------------LRTACERTKRTLSTSAQAYIEIDSLFDGVDFNSTITRARFE  168

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            D+C DYFRKTM+PV +VLRD+KLSK+Q +E+VLVGGSTRIPKVQQLL DFFNGKE  KS+
Sbjct  169  DLCSDYFRKTMDPVAQVLRDSKLSKNQGNEIVLVGGSTRIPKVQQLLKDFFNGKELFKSV  228

Query  367  NPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  418
            NPDEAVAYGATVQAAILSGN+SS KLQDLLLLDV PLSLGLETAG VMT LI
Sbjct  229  NPDEAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGSVMTKLI  280

>PPTG_10122
Length=569

 Score = 421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/517 (42%), Positives = 336/517 (65%), Gaps = 6/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF ++ GA +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGA-EGAQVETQRSGEKHPVTPVEFMAVLLQN  123

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  183

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EAANNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKASSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+  +F+GK     ++
Sbjct  304  LISDYVHETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFDGKNVRTQMS  363

Query  368  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDEAVAYGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAYGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+V F +  
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVIFTVST  483

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L V+A E+  GK++ + +T+D  RL+ A++  +V
Sbjct  484  KGVLTVTASERKAGKKS-LEVTHDSKRLTPADVAAIV  519

>PYU1_G006940
Length=565

 Score = 420 bits (1079),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 332/517 (64%), Gaps = 5/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+   D +    I+ W FK+S              GE     P E  S+++  
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+ V + V+++PA+  + Q++  ++A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEAVDSVVLSIPAHATEKQKELLQEAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  191  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
               K      VL+FD+GG T DV+L++ ++G+FE+ A+AG+  LGGEDF   LV+H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVASAGNDKLGGEDFTKALVEHCAKA  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F+RK + ++ +N++A  RLR ACE AKRTLS+  Q  IEIDSL +G DF+  ++R RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQTQVNIEIDSLMEGEDFSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY    ++ V+ +L  A + K  V  V+LVGGS+RIP +Q  +  +F+GK  +  ++
Sbjct  305  LINDYVTAALKEVDALLESADVEKEHVDHVILVGGSSRIPLLQNAVKKYFDGKTTHLHLS  364

Query  368  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDE VA+GATV+A++ +   +     + L  ++VTPL+L +  A G +T LI R T +P 
Sbjct  365  PDEVVAHGATVEASLRADLANFEAPKKALDNVNVTPLTLSVALANGSVTELIHRETVLPA  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++TF+T  DNQ  + +Q++EGER M +DN LL    + GI P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQIYEGERVMAKDNTLLASLAVSGIAPAPKGEAEIEVTFAVNT  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G L ++AVE++ GK+  + ++ND  RLS A++  ++
Sbjct  485  KGALTITAVEQTAGKKT-LEVSNDPKRLSAADVAVII  520

>PHYRA_71591
Length=570

 Score = 419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 220/517 (43%), Positives = 332/517 (64%), Gaps = 5/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+  +D   +  +K WPF +++GA    Q   Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+++++ VI  PA+ ++S  +    A A AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAAKAGVNVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   L +H  + 
Sbjct  185  EASNNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFSAALFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKR+LS+  QA IE+DSL +G D +  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRSLSTQTQANIEVDSLMEGEDLSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY  +T+  ++ +L +  L K  +  VVLVGGSTRIP VQ L+  +F GK  +  ++
Sbjct  305  LISDYVHETITEIDAILEENDLEKDDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVHTQLS  364

Query  368  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDEAVA+GAT++A+ L+      E  + L L++V PL+L +  A G ++ LI R+T +P 
Sbjct  365  PDEAVAFGATIEASGLAELVGVPEPKKPLNLVNVVPLNLSVALANGSVSELIQRDTVLPA  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P  +G  +I+V F +  
Sbjct  425  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPKAKGEVEIEVDFTVST  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L V+A E+  GK++ + +T D  RL+ A++  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>SDRG_10038
Length=565

 Score = 412 bits (1059),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 218/512 (43%), Positives = 325/512 (63%), Gaps = 6/512 (1%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  3    CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL
Sbjct  63   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLVL  122

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG
Sbjct  123  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  182

Query  189  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  183  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  242

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
             F+R+ + D+ +N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D    ++R+RFE
Sbjct  243  TFERQKKVDLKDNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRFE  302

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            +M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+ + +I
Sbjct  303  EMIGDHVRKMVTDIETLLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  362

Query  367  NPDEAVAYGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             PDE +AYGATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +
Sbjct  363  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  422

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++
Sbjct  423  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  482

Query  485  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  514
                +L V A +  + G ++K +T+ +D  R+
Sbjct  483  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  514

>PHYKE_64
Length=569

 Score = 412 bits (1059),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 214/517 (41%), Positives = 329/517 (64%), Gaps = 5/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A +T+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            +  KRL+G+  +D   +  +K WPF +  GA           GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+ +++ VI+ PA+ ++  ++    A   AG+ VL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGETLEHVVISKPAHADEKHQELLNAAAEKAGVKVLTYLSEPLAAAIAYGLD  184

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV ++ G   LGGEDF N + +H  + 
Sbjct  185  EAANNPKPEYVLVFDIGGATHDVTLLNADKGLFEVLSSKGKDTLGGEDFTNAVFEHCAKS  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+A  RLR ACE AKRTLS+  Q+ IE+DSL +G DF+  ++R RFE+
Sbjct  245  FLRKTKLDVKTNQKASSRLRLACETAKRTLSTQTQSNIEVDSLMEGEDFSLKLSRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY    M+ V+ +L + +L K  +  VVLVGGSTRIP VQ ++   F GK  +  + 
Sbjct  305  LIIDYVTDIMKEVDAILEENELEKDDIDHVVLVGGSTRIPLVQSMIKKSFEGKTTHLQMP  364

Query  368  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDE +AYGAT++A+ L+    + E  + + +++V PL+L +  A G ++ LI R T +P 
Sbjct  365  PDEVIAYGATIEASGLAELVDAPEPKKPVNMVNVVPLNLSVALANGSVSELIQRETILPA  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GIPPM +G  +I+VTF +  
Sbjct  425  THTELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVAGIPPMSKGDAEIEVTFTVST  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L+V+A E+  GK+  + +TND  RLS A++  +V
Sbjct  485  KGVLSVTASERKAGKKT-LEVTNDPKRLSTADVAAIV  520

>PITG_03546
Length=569

 Score = 412 bits (1059),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 215/517 (42%), Positives = 333/517 (64%), Gaps = 6/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F   R++G+  +D   +  +K WPF ++ G+ +  Q+  Q  GE     P E  +++L  
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGS-EGAQVETQRNGEKHPVTPVEFMAVLLQN  123

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++E+AE F G+++++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  124  LKELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGLD  183

Query  191  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
            +         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGE+F   + +H  + 
Sbjct  184  EATSNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGENFTAAVFEHCAKS  243

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F RK + D+  NQ+   RLR ACE AKR+LS+  QA IE+DSL +G DF   ++R RFE+
Sbjct  244  FMRKTKLDVKTNQKTSSRLRIACETAKRSLSTQTQANIEVDSLMEGEDFALKLSRPRFEE  303

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY  +T+  ++ +L + +L K  +  VVLVGGSTRIP VQ L+  +F GK     ++
Sbjct  304  LITDYVNETITEIDAILEENELEKEDIDHVVLVGGSTRIPLVQNLVKKYFEGKNVRTQMS  363

Query  368  PDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDEAVA+GAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +P 
Sbjct  364  PDEAVAFGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPA  423

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P P+G  +I+VTF + +
Sbjct  424  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPQPKGDAEIEVTFTVSS  483

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L V+A E+  GK++ + +T D  RL+ A++  +V
Sbjct  484  KGVLTVTAAERKAGKKS-LEVTQDSKRLTPADVAAIV  519

>PYIR_24123
Length=567

 Score = 411 bits (1056),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 207/517 (40%), Positives = 331/517 (64%), Gaps = 5/517 (1%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +A NT+
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+   + + +  I+ W FK++              GE+    P E  S+++  
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            ++++AE F G+ V N V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGESVDNVVLSIPAHVTEKQKELLQAAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  191  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
               K      VL+FD+GG T DV+L++ ++G+FE+ AT+G  +LGGEDF   L +H  + 
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVATSGKDNLGGEDFTKALFEHCAKA  244

Query  248  FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
            F+RK + ++ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  245  FQRKTKLNVKDNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  304

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  +   F+GK  +  ++
Sbjct  305  LISDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVKKHFDGKTTHLHLS  364

Query  368  PDEAVAYGATVQAAILSG-NdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPT  426
            PDE VA+GAT++A++ +   +     + L  ++VTPL+L +  A G +  +I R+T +P 
Sbjct  365  PDEVVAHGATIEASLRADLANFESPKKALNHVNVTPLTLSVALANGSVAEVIHRDTVLPA  424

Query  427  KKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  486
              ++TF+T  DNQ  + +QV+EGER M +DN LL   ++ GI P P+G  +I+VTF ++ 
Sbjct  425  TATETFTTSQDNQTAIFLQVYEGERVMAKDNTLLASLSVAGIAPAPKGEAEIEVTFTVNT  484

Query  487  NGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L ++AVE++ GK+  + + ND  RL+  ++  ++
Sbjct  485  KGVLTITAVEQAAGKKT-LEVKNDPKRLTAKDVADII  520

>PPTG_16727
Length=217

 Score = 393 bits (1010),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 195/207 (94%), Gaps = 0/207 (0%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            M +  +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1    MTEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            QVAMNAHNTVFD KRLIGRKF+DP VQ+DIKHWPFK+  GA +KPQ+ VQFKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQP  120

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEISSMVLIKMREVAEAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGT  207
            TAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGT  207

>SPRG_11133
Length=676

 Score = 409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 227/448 (51%), Positives = 302/448 (67%), Gaps = 18/448 (4%)

Query  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
            MA  +    +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD  RL+GD AK+
Sbjct  1    MAGGSQSVVIGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKS  60

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            Q   NA NTVF+  R+IGR++ +   +        ++  G  + P I V  KGE+K   P
Sbjct  61   QAPRNAPNTVFNIMRIIGRRYDEVRKKT-------QVVCGPKNNPMIRVVEKGETKELHP  113

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EEI + +++K+++    +    +++AV+TVP  FN  QRQA +DA AIAGL   RI + P
Sbjct  114  EEILAELVVKLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAVRDACAIAGLAKYRISDAP  173

Query  181  TAAAIAYGLDKKGGER---NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            T AA+A+    KG  R   + ++ D+GGG   VSLL+IE+GIFEVKA AGD  LGGEDFD
Sbjct  174  TTAAVAH-TSIKGAPRCEVHDMVVDMGGGHLSVSLLAIEDGIFEVKAVAGDACLGGEDFD  232

Query  238  NRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
            + L DHF  EF R++RKD+T   RA+RRLRTACE+AKR LS S  A +E++ LF  IDF 
Sbjct  233  DVLFDHFAAEFARQYRKDMTTCDRAVRRLRTACEKAKRDLSISNTATLELEVLFGSIDFR  292

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            S+ITRARFED+C   FRK  +P+EKVLRDAK+ KSQV +VVL GGS R+PK+QQLLS FF
Sbjct  293  SSITRARFEDLCSGLFRKVTQPIEKVLRDAKIDKSQVRDVVLAGGSMRMPKMQQLLSSFF  352

Query  358  NGKEPNKS-----INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGG  412
              +  +K      +N +EA A+GATV AA+   +++S     LL+L V P S+G+ET GG
Sbjct  353  GERYADKKLCHSILNNNEAAAHGATVMAAL--NDETSPDDMHLLVLHVVPYSVGIETGGG  410

Query  413  VMTTLIARNTTVPTKKSQTFSTYADNQP  440
            VMTTLI+RNTT+P+KKS+ F       P
Sbjct  411  VMTTLISRNTTIPSKKSEKFKISQPQSP  438

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query  444  IQVFEGERSMTRDNNLLGKFNLDGI-PPMPRGVPQIDVTFDIDANGILN-VSAVEKSTGK  501
            I++F GERSM RDN  L    + G   P  R     DV FDID +G+L  +       G 
Sbjct  523  IKIFTGERSMVRDNTPLHTIAIHGFYDPTARS----DVAFDIDGDGLLTAIVTYTPHIGT  578

Query  502  ENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549
               I +  DKG LSQ ++ R+    E   + D+  + R+ A   L+ Y
Sbjct  579  NETIVVKLDKGYLSQHDVKRLTTNFE--AAADDRTRRRV-AHEELQTY  623

>PHALS_00390
Length=569

 Score = 400 bits (1027),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 220/544 (40%), Positives = 340/544 (63%), Gaps = 9/544 (2%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KRL+G+   +   +  +K W F ++  A +   +  Q  GE     P E  +++L  
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNA-EGVTVETQRNGEKHHVTPVEFMALLLQN  123

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAI-AGLNVLRIINEPTAAAIAYGL  189
            ++E+AE F G+++++ VI+ PA+  DS+     DA A  AG+NVL  ++EP AAAIAYG 
Sbjct  124  LKELAEDFTGEKLEHVVISKPAH-TDSRYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGF  182

Query  190  DKKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            D+         VL+FD+GG T DV+LL++++G+F+V A+ G   LGGE+F   + DH  +
Sbjct  183  DEAVNNEKPEYVLVFDIGGATHDVTLLNVDKGLFQVVASKGKDTLGGENFTAAVFDHCAK  242

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
             F RK + DI  NQ+A  RLR ACE AKR+LS+  Q+ IE+DSL +G DF   ++R RFE
Sbjct  243  AFLRKTKLDIKSNQKASSRLRIACEAAKRSLSTQTQSNIEVDSLMEGEDFALKLSRPRFE  302

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
            ++  ++  +T+  ++ +L +  L K  +  ++LVGGSTRIP VQ ++  +F GK     +
Sbjct  303  ELISNFVNETITEIDVILEENDLEKDDIDHIILVGGSTRIPLVQNVVKKYFEGKNVRTQL  362

Query  367  NPDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            +PDEAVA+GAT++A+ L      S+ ++ + ++++ PL+L L  A G +  LI R T +P
Sbjct  363  SPDEAVAFGATIEASCLVELVGVSKPIEPVNMVNMVPLNLSLALANGSVAELIHRETILP  422

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
               ++ F+T  DNQ  V +Q++EG+R M +DN L+ +  + GI P+P+G   I+VTF + 
Sbjct  423  ATVTEIFTTSCDNQETVYLQIYEGQRIMAKDNTLVAQLKVSGITPLPKGDAAIEVTFTVS  482

Query  486  ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIE-AKN  544
              G+L V+A E+  G ++ I +T D  RL+ A++  +V  AE    ED+     +E A+ 
Sbjct  483  TKGVLTVTASERMAGTKS-IQVTQDSKRLTPADVAAIVKNAEDAADEDDVLLGELEDAEK  541

Query  545  ALEN  548
            A EN
Sbjct  542  AAEN  545

>H310_12765
Length=560

 Score = 394 bits (1013),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 212/511 (41%), Positives = 315/511 (62%), Gaps = 7/511 (1%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAAN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K  D      +K W F +++     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAP--IAKILDGSRDIHAVEFCTIVL  120

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G  VKN+V+TVP  ++D Q+   ++A + A LNVLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGSSVKNSVLTVPEGYSDEQKALLQEAASAADLNVLRYISEPIAAAIAYG  180

Query  189  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            LD  KK   +  ++ D+GG + D++LLS+++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLAVVVDIGGASTDLTLLSVDKGLFNVIATASDHALGGEVFTNSVVEHCIK  240

Query  247  EFKRKHRKDIT-ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             F+R+ +  I  +N RAL R++ A E+AK++LS+  Q  IE+DSL DG D    ++R+RF
Sbjct  241  TFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQTQVTIEVDSLADGQDLIVKLSRSRF  300

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            EDM  D+ RK  + +  +L  A   K  +  V+L+GGSTRIPKVQ  + DFF+GK+   +
Sbjct  301  EDMVIDHIRKVTKDIAALLEGAGYEKDSIDHVLLIGGSTRIPKVQTAVEDFFDGKKALVT  360

Query  366  INPDEAVAYGATVQAAILSGNdssek-lqdlllldvtplslglETAGGVMTTLIARNTTV  424
            I PDEAVA+GATV++  LS           L  ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESGTLSETADWTLPEDPLNNVEAVPLNLSLGLADGTVYDMIHRGTIL  420

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            P    + F+T  DNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F +
Sbjct  421  PANHQEVFTTQVDNQHAVYLQVYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTV  480

Query  485  DANGILNVSA-VEKSTGKENKITITNDKGRL  514
               G L V A V  + G    + + +D  R+
Sbjct  481  TRKGQLTVKAHVRNAEGGSKALVVASDSKRV  511

>PHYCA_532207
Length=1118

 Score = 409 bits (1052),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 217/519 (42%), Positives = 333/519 (64%), Gaps = 7/519 (1%)

Query  10    VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
             +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++  +A NT
Sbjct  552   IGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNT  611

Query  70    VFDAKRLIGRKFSDPIVQAD-IKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
             +F  KRL+G K  D I   D +K WPF ++ GA    Q   +  GE     P E  +++L
Sbjct  612   IFHLKRLLG-KAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLL  670

Query  129   IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
               ++++AE F G+++++ VI+ PA+ ++   +    A   AG+NVL  ++EP AAAIAYG
Sbjct  671   QNLKDLAEDFTGEKLEHVVISKPAHTDEKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYG  730

Query  189   LDKKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
             LD+         VL+FD+GG T DV+LL+ ++G+FEV A+ G   LGGEDF   + +H  
Sbjct  731   LDEAANNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVASKGKDTLGGEDFTAAVFEHCA  790

Query  246   QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             + F RK + D+  NQ+A  RLR ACE AKRTLS+  QA IE+D+L +G DF   ++R RF
Sbjct  791   KSFLRKTKLDVKTNQKASSRLRIACETAKRTLSTQTQANIEVDTLMEGEDFALKLSRPRF  850

Query  306   EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
             E++  DY  +T+  ++ +L + +L K  +  +VLVGGSTRIP VQ L+  +F GK  +  
Sbjct  851   EELINDYVHETITEIDAILEENELEKEDIDHIVLVGGSTRIPLVQTLVKKYFEGKTVHTQ  910

Query  366   INPDEAVAYGATVQAAILSGNd-sseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             ++PDEAVAYGAT++A+ L+      E  + L +++V PL+L +  A G ++ LI R+T +
Sbjct  911   LSPDEAVAYGATIEASGLAELVDVPEPKKPLNMVNVVPLNLSVALANGSVSELIQRDTIL  970

Query  425   PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
             P   ++ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+VTF +
Sbjct  971   PATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVTFTV  1030

Query  485   DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
                G+L V+A E+  G ++ + +  D  RL+ A++  +V
Sbjct  1031  STKGVLTVTASERKAGNKS-LEVAQDAKRLTPADVAAIV  1068

>PYVX_17692
Length=551

 Score = 393 bits (1009),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 211/527 (40%), Positives = 333/527 (63%), Gaps = 17/527 (3%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A +TV
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F  KR++G+  +D   +  ++ WPF +++G G     T Q  G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  131  MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
            +R++A+ F G+ V++ V++VP + +++ R   +DA A A +NVL  I EPT         
Sbjct  125  LRDLAQDFTGETVEHVVLSVPPHADEAHRALIRDAAAAAEVNVLAYIPEPTPEP------  178

Query  191  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  250
                 + VL+FD+GG T DV+LL+ ++G+F+V AT GD  LGGEDF + + +H  + F+R
Sbjct  179  -----QYVLVFDIGGATHDVTLLTADKGLFDVTATQGDDALGGEDFTSAVFEHCAKAFQR  233

Query  251  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            K + D+  NQ+A  RLR ACE AKR+LS+  Q  IE+DSL +G DF+  ++R RFE++  
Sbjct  234  KTKLDVRGNQKASSRLRLACETAKRSLSTQTQVTIEVDSLLEGEDFSLKLSRPRFEELIN  293

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDE  370
            DY +K ++ VE +L   +L K  +  VVL+GGSTRIP VQ  +  FF+GK  +  ++PDE
Sbjct  294  DYVKKALDEVEALLEAQELDKEDIDHVVLIGGSTRIPLVQSSVKSFFDGKRTHLHLSPDE  353

Query  371  AVAYGATVQAA---ILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  427
             VA+GAT++AA    L G    +  +    ++ TPL+L +  A G ++ L+ R+T +P  
Sbjct  354  VVAHGATIEAAGRGDLVG--VPDPKKPANQVNATPLTLSVALANGSVSELVHRDTVLPAS  411

Query  428  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  487
             ++TF+T AD+Q  V +Q++EGER M +DN LL +  + GI  +P+G  +IDVTF +   
Sbjct  412  ATETFTTSADDQTAVFLQIYEGERLMAKDNTLLAQLAVTGITALPKGEAEIDVTFTVSTK  471

Query  488  GILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDE  534
            G+L V+A E+S GK+  + + +D  RL+ A++  +V + +    ED+
Sbjct  472  GVLTVTAEERSAGKKT-LEVKHDDKRLTAADVAAIVQKGKDAAEEDD  517

>SPRG_15695
Length=581

 Score = 392 bits (1008),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 214/512 (42%), Positives = 316/512 (62%), Gaps = 16/512 (3%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
             +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA N
Sbjct  29   CIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAAN  88

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K SD      IK W F + + A       V  K   +     E +S+VL
Sbjct  89   TVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEFASLVL  148

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G +VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAYG
Sbjct  149  GKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAYG  208

Query  189  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
             D  K    + +++ D+GG + D+SLLS ++G+F V    GD  LGGEDF   LV+H  +
Sbjct  209  FDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVVGHVGDDALGGEDFTYALVEHCVK  268

Query  247  EFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFE  306
             F+R+ + D+  N RAL R++ ACE+AK++LS+ +Q  IE+DSL DG D           
Sbjct  269  TFERQKKVDLKNNTRALYRIKLACEQAKKSLSTQSQVTIEVDSLADGQDLI---------  319

Query  307  DMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSI  366
             M GD+ RK +  +E +L +A L K  +  V+L GGSTRIPKVQ  +  FF+GK+ + +I
Sbjct  320  -MIGDHVRKMITDIEALLENANLDKESIDHVILAGGSTRIPKVQAAIEAFFDGKKASSTI  378

Query  367  NPDEAVAYGATVQAAILS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
             PDE +AYGATV+AA LS      +     L +++  PL+L L  A G +  +I RNT +
Sbjct  379  VPDEVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVL  438

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            P    + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++
Sbjct  439  PATTQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNV  498

Query  485  DANGILNVSA-VEKSTGKENK-ITITNDKGRL  514
                +L V A +  + G ++K +T+ +D  R+
Sbjct  499  TRKSVLTVKAHLRNAEGAKSKALTVESDSKRV  530

>H257_07650
Length=563

 Score = 387 bits (993),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/490 (43%), Positives = 309/490 (63%), Gaps = 6/490 (1%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            S+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA N
Sbjct  3    SIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAAN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
            TV+  KR++G+K  +      +K W F +++     P    +    S+     E  ++VL
Sbjct  63   TVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAP--IAKILDGSRDISSVEFCTIVL  120

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
             K++ +AE + G  VKNAV+TVP  ++D Q+   ++A   A L+VLR I+EP AAAIAYG
Sbjct  121  RKLKALAEDYTGVVVKNAVLTVPEGYSDEQKALLEEAATAADLSVLRYISEPIAAAIAYG  180

Query  189  LD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQ  246
            LD  KK   + V++ D+GG + D++LLSI++G+F V ATA D  LGGE F N +V+H  +
Sbjct  181  LDEDKKNESKLVVVVDIGGASTDLTLLSIDKGLFNVIATASDHALGGEVFTNSIVEHCVK  240

Query  247  EFKRKHRKDIT-ENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
             F+R+ +  I  +N RAL R++ A E+AK++LS+ +Q  IE+DSL DG D    ++R+RF
Sbjct  241  AFERQKKVTIAADNTRALHRVKVASEQAKKSLSTQSQVTIEVDSLADGQDLIVKLSRSRF  300

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
            EDM  D+ RK  + +  +L  A  +K  +  V+LVGGS+RIPK Q  + DFF+GK+   S
Sbjct  301  EDMVSDHVRKVTKDIAALLDGAGYAKDTIDHVLLVGGSSRIPKAQSAVEDFFDGKKALVS  360

Query  366  INPDEAVAYGATVQAAILSGNdssek-lqdlllldvtplslglETAGGVMTTLIARNTTV  424
            I PDEAVA+GATV++A LS              ++  PL+L L  A G +  +I R T +
Sbjct  361  IAPDEAVAFGATVESATLSETADWTLPTDPHNNVEAVPLTLSLGLADGTVYEMIHRGTVL  420

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDI  484
            P    + F+T ADNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F++
Sbjct  421  PANVQEVFTTNADNQDAVYLQVYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNV  480

Query  485  DANGILNVSA  494
               G L V A
Sbjct  481  TRKGQLTVKA  490

>PYIR_16738
Length=555

 Score = 385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/328 (60%), Positives = 261/328 (80%), Gaps = 1/328 (0%)

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
            DSL DG DF+ T++RARFE +  D F+KT+ PVEKVL+DA + KS+V E+VLVGGSTRIP
Sbjct  194  DSLLDGEDFSETLSRARFEKLNEDLFKKTLGPVEKVLKDAGVKKSEVDEIVLVGGSTRIP  253

Query  348  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslgl  407
            KVQQL+ D+FNGKEP++ +NPDEAVAYGA VQ  ILSG    E L D++L+DV PLS G+
Sbjct  254  KVQQLIKDYFNGKEPSRGVNPDEAVAYGAAVQGGILSG-AEQEGLGDMVLIDVVPLSQGI  312

Query  408  ETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDG  467
            ET GGVMT LI +NT +PTKKSQ FST+ DNQP V I+V+EGER++ +DN+LLGKF+L G
Sbjct  313  ETVGGVMTKLINKNTAIPTKKSQVFSTHVDNQPAVSIKVYEGERALVKDNHLLGKFDLTG  372

Query  468  IPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAE  527
            IPP PRGVPQI VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ EIDR++ EAE
Sbjct  373  IPPAPRGVPQIQVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRIIREAE  432

Query  528  KYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDA  587
            ++  ED+  K RI+++NALE+Y Y+++NS+ D+K+  K+ + DK  V   V + + WL+ 
Sbjct  433  QFAEEDKRVKERIDSQNALESYLYNVKNSVEDDKVAAKMEDEDKDAVLKSVQDAMDWLED  492

Query  588  HQSSEKEEYEAKQKELEGVANPVLQKVY  615
            +Q ++K++++AKQKE+E + NP+++KVY
Sbjct  493  NQEADKDDFDAKQKEVEKIVNPIMKKVY  520

 Score = 212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 128/165 (78%), Gaps = 2/165 (1%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  26   AKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  85

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
            Q  +N   T+FD KRLIGR ++D  VQAD K  P+KI    G KP I V  KGE K F P
Sbjct  86   QATINPEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDG-KPAIEVPIKGEKKLFSP  144

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDA  165
            EEIS+M+L KM+++AE ++GK++ +AV+TVPAYFND+QRQATKDA
Sbjct  145  EEISAMILTKMKQIAEGYLGKDIHDAVVTVPAYFNDAQRQATKDA  189

>PYAR_24704
Length=525

 Score = 383 bits (984),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/495 (40%), Positives = 302/495 (61%), Gaps = 12/495 (2%)

Query  26   NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPI  85
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NT+F  KR++G+   D  
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  86   VQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKEVKN  145
                +  W F ++ GA           G      P E  S++L  ++ +AE F G+ V +
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLKNLAEDFTGETVDS  120

Query  146  AVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD---KKGGERNVLIFD  202
             VI++ A+  ++Q++    A A AG+NVL  ++EP AAAIAYGLD   K       ++ D
Sbjct  121  VVISLSAHGGENQKELISAAAAKAGVNVLSYLSEPLAAAIAYGLDENTKNSHAEYAVVVD  180

Query  203  LGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA  262
            +GG T DV+L+SI++G+FE+  T G+  LGGEDF   + +H  + F+RK + ++ +N +A
Sbjct  181  IGGATHDVTLVSIDKGLFEIVGTHGNDSLGGEDFTKAVFEHCVKAFQRKTKLNVKDNAKA  240

Query  263  LRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEK  322
              RLR ACE AKRTLS+ +Q  IE+D+L +G DF   ++R RFE++  DY + +++ VEK
Sbjct  241  SSRLRVACEAAKRTLSTQSQVNIEVDTLMEGEDFALKLSRPRFEELIVDYVKTSLKEVEK  300

Query  323  VLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAI  382
            VL DA + KS V  V+L+GGS+RIP VQ  +  FF+GK+ +  ++PDE VA+GAT++AA 
Sbjct  301  VLEDADVDKSDVDHVILIGGSSRIPLVQTSVKKFFDGKKTHMHMSPDEVVAHGATLEAAA  360

Query  383  LS--GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQP  440
            +S   N    + +   +             G V  T++      PT  ++ F+T ADNQ 
Sbjct  361  ISELANFDPAESEQNNVAVTPLTLSVALANGSVSETVL------PTSATEVFTTSADNQD  414

Query  441  GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTG  500
             + IQV+EGER+M +DN LL +  +DGI P+P+G  +I+VTF + + G+L V+A E + G
Sbjct  415  AIFIQVYEGERAMAKDNTLLAQLRVDGISPLPKGEAEIEVTFAVSSKGVLTVTANEAAAG  474

Query  501  KENKITITNDKGRLS  515
            K+  + + ND  RL+
Sbjct  475  KKT-LEVKNDGARLT  488

>CCI47582
Length=582

 Score = 364 bits (935),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 204/553 (37%), Positives = 318/553 (58%), Gaps = 20/553 (4%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFK--GESKTFQPEEISSM  126
             VF  +RL+G+K+ +      +  W FK+     D+ Q     K  GE       E  ++
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L  ++ +A+ + G  +  AV+T   +  D Q+Q    A   A L+++  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVLTTSIHCTDRQQQLLTQAAKEAQLDIMSYLPDPIAAAIA  182

Query  187  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            YG D       KK  +     +L+ D+GG T  ++LLS+++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPNNYKKANQCQADLILVVDIGGATTAITLLSVDKGLFEIVADGGHEGRGGEDL  242

Query  237  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
               +VDH  Q F RK + DI +N++A+ RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAQSFLRKTKVDIHKNRKAMIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  356
            +  ++R RFE++   + R   E ++KVL +A   K  V  ++LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQKHVRFIFEEIDKVLVNADTEKENVDHIILVGGSCRIPLIQEKIQSY  362

Query  357  FNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV---  413
            F     +  ++PDE VA GAT++AA L          D L   V   ++ L  + G+   
Sbjct  363  FKDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLDQHVNVNAVPLSLSVGLVHG  422

Query  414  -MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  472
             + TLI R+  +P K ++TF+T+ DNQ  VLI+++EGER++   N LL +  + GI P+P
Sbjct  423  NVHTLIHRDAILPAKMTETFTTWEDNQTEVLIEIYEGERAIAEKNTLLARMCVSGIAPLP  482

Query  473  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKIT-ITNDKGRLS-QAEIDRMVAEAEKYK  530
            +G  +I +   + + G+L V A     G+E KI  I  D+ RL+ + ++D++V  A    
Sbjct  483  KGEAEIILQVQVSSKGVLTVKA--SMNGEEKKILEIHTDEARLADKKQLDQIVEAANDAI  540

Query  531  SEDEANKVRIEAK  543
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PYIW_19165
Length=1124

 Score = 374 bits (961),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/516 (38%), Positives = 309/516 (60%), Gaps = 26/516 (5%)

Query  11    GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
             GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +A NT+
Sbjct  585   GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  71    FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
             F  KR++G+   + + +  I+ W FK++              G++    P E  S+++  
Sbjct  645   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  131   MREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  190
             ++++AE F G+ V + V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  705   LKDLAEDFTGETVDDVVLSIPAHATEKQKELLQAAADKAGVNVLTFISEPIAAAIAYGLD  764

Query  191   ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
                K     +VL+FD+GG T DV+L++ ++G+FE+ AT+G   LGGEDF   L +H  + 
Sbjct  765   DSAKGSHPESVLVFDIGGATHDVTLINADQGLFEIVATSGKDDLGGEDFTKALFEHCAKT  824

Query  248   FKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
             F+RK   D+ +N++A  RLR ACE AKRTLS+ A   IEIDSL +G D +  +TR RFE+
Sbjct  825   FQRKTTLDVKKNKKASSRLRIACETAKRTLSTQAHVNIEIDSLMEGEDLSLKLTRPRFEE  884

Query  308   MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
             +  DY    ++ V+ +L  A + K  +  V+LVGGS+RIP +Q  +   F+GK  +  ++
Sbjct  885   LIYDYVTSALKEVDALLESANIEKEDIDHVILVGGSSRIPLLQNAVMKHFDGKTTHLHLS  944

Query  368   PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  427
             PDE VA+GAT++A++ +                       E+    +  +   N T P  
Sbjct  945   PDEVVAHGATIEASLRAD------------------IANFESPKKPLNHV---NVT-PLT  982

Query  428   KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  487
              S   +  +DNQ  + +QV+EGER M +DN LL   ++ GI   P+   +I+VTF +   
Sbjct  983   LSVALANGSDNQTAIFLQVYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTK  1042

Query  488   GILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMV  523
             G+L+++AVE++ G +  + + +D  RL+ A++  ++
Sbjct  1043  GVLSITAVEQAAGTKT-LEVKSDPKRLTAADVAAII  1077

>SDRG_05778
Length=618

 Score = 360 bits (923),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 199/240 (83%), Gaps = 6/240 (3%)

Query  7    GYS--VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            G+S  +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF + ERLIGDAAK Q A 
Sbjct  188  GFSEVIGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAAS  247

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NA NTVFDAKR+IGR FSDPIV+ D  H+PFKI  G  DKP I V FKGE K F PEEIS
Sbjct  248  NATNTVFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEIS  307

Query  125  SMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
            SMVL +M+E AE ++G+E+K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA
Sbjct  308  SMVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAA  367

Query  185  IAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            +AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFEVK+T GDTHLGGEDFD+ +
Sbjct  368  LAYGLDTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTHLGGEDFDSNM  427

 Score = 157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 122/196 (62%), Gaps = 9/196 (5%)

Query  409  TAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGI  468
            T G VM+ LI RNT +P KK++ ++T  D Q  V + ++EGER+    NN LG+F + GI
Sbjct  428  TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGI  487

Query  469  PPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEK  528
                RG PQ+ VTF+IDANGILNVSA++K T  + + TI N+ GRL+Q +IDRMVA+AEK
Sbjct  488  ERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEK  547

Query  529  YKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAH  588
            +K +D     +IEA+N+LE++ Y         +  E   E      ++ + E  +WL+ H
Sbjct  548  FKKDDAEVLKKIEARNSLESFIY---------RALELTREKGDAAAENTIREAREWLEDH  598

Query  589  QSSEKEEYEAKQKELE  604
            + +   E E K++ LE
Sbjct  599  EDATLRELEEKKRVLE  614

>CCA20229
Length=583

 Score = 356 bits (914),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 204/553 (37%), Positives = 315/553 (57%), Gaps = 20/553 (4%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFK--GESKTFQPEEISSM  126
             VF   RL+G+   +    A +  W FK+   + ++ Q     K  GE       E  ++
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +L  ++ +A+ + G  +  AVI+   +    Q+Q    A   A LNV+  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVISTSIHCTTEQKQVLAQAAKDAELNVMSYLPDPIAAAIA  182

Query  187  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            YG D       KK  +     +L+ D+GG T  V+LL++++G+FE+ A  G    GGED 
Sbjct  183  YGFDDWKPKNYKKANQSTAQLILVVDIGGATTAVTLLNVDKGLFEIVADGGSEFRGGEDL  242

Query  237  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
               +VDH  + F RK +  I  N++A  RL  ACE+AKR+LS+  Q  IE+DSL +  DF
Sbjct  243  TKIVVDHCAKSFLRKTKVAIQNNRKATIRLSLACEQAKRSLSAQNQVSIEVDSLLEDQDF  302

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  356
            +  ++R RFE++  D+ R   E ++ VL  A + K  V  V+LVGGS RIP +Q+ +  +
Sbjct  303  SMKLSRPRFEELIQDHVRFIFEEIDAVLEKADVDKENVDHVILVGGSCRIPLIQEKIQTY  362

Query  357  FNGKEPNKSINPDEAVAYGATVQAA----ILSGNdsseklqdlllldvtplslglETAGG  412
            F     +  ++PDE VA GAT++AA    +L      + L+    ++  PLSL +  A G
Sbjct  363  FGDVNMHFHLSPDEVVANGATIEAATLEKLLDEAIPLDSLEQHANVNAVPLSLSVGLAHG  422

Query  413  VMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMP  472
             + TLI R+  +P K  +TF+T+ DNQ   LI+++EGER++   N LL +  + GI P+P
Sbjct  423  NVHTLIHRDVVLPAKMMETFTTWEDNQTEALIEIYEGERAIAEKNTLLAQMCISGITPLP  482

Query  473  RGVPQIDVTFDIDANGILNVSAVEKSTGKENKIT-ITNDKGRLSQA-EIDRMVAEAEKYK  530
            +G  +I +   + + G+L V A+    G+E K+  I  D+ RL+ A ++D +V  A    
Sbjct  483  KGEAEIIIELQVSSQGLLTVRAI--LNGEEKKMLEIHTDQARLADAKKLDHIVEAANAAM  540

Query  531  SEDEANKVRIEAK  543
             ED+     IE K
Sbjct  541  DEDDTFLTEIENK  553

>PITG_15111
Length=186

 Score = 335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 171/180 (95%), Gaps = 0/180 (0%)

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFEVKATAGDTHLGGEDFDNR
Sbjct  7    PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNR  66

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
            LV+ F  EFKRKHRKD+T NQRALRRLRTACERAKRTL +SAQAYIEIDSL+DG+DFNST
Sbjct  67   LVEFFVTEFKRKHRKDMTSNQRALRRLRTACERAKRTLFTSAQAYIEIDSLYDGVDFNST  126

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ITRARFED+C DYFRKTM+PV +VLRD+KLSK+QV+E+VLVGGSTRIPKVQQLL DFFNG
Sbjct  127  ITRARFEDLCSDYFRKTMDPVAQVLRDSKLSKNQVNEIVLVGGSTRIPKVQQLLKDFFNG  186

>PYAR_24687
Length=618

 Score = 346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 208/546 (38%), Positives = 315/546 (58%), Gaps = 12/546 (2%)

Query  2    AQTTSGYSVGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAFTDT--ERLIGDA  57
            +Q ++ + + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  
Sbjct  32   SQDSAHHMIAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRD  91

Query  58   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT  117
            AK Q  +   NT FD K+L+GR F    VQ+ I   P+ I     +KP I V+ KGE++ 
Sbjct  92   AKQQALLQPKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIID-RDNKPFIQVEMKGETRE  150

Query  118  FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            F  EE+++MVL +M++ AEA++G+E++NAV+TVPA F D+QR+A K A A+AGL   R++
Sbjct  151  FSVEEVTAMVLTRMKQFAEAYLGEEIENAVVTVPASFEDAQREAMKAACAMAGLTTRRVL  210

Query  178  NEPTAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            NEPTAA + +G+  K   ER VL+    GG  D +LL I+EGI EV  T   +H  G++ 
Sbjct  211  NEPTAATMGFGIKPKTQHERKVLVVHFDGGALDATLLEIDEGIVEVLVT--KSHRIGDEV  268

Query  237  DNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
              R++DH   ++K     DI+ + R L+RLR   ER +  LS   +A + I+S       
Sbjct  269  TQRVMDHCISQWKYDKHVDISTDPRMLQRLRLEAERVQHALSEQTEAVVTIESSSGSAVL  328

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  356
              + +RA  E M  D     +E VE  L +  ++K +V  +V  GG++RIP ++QL+ + 
Sbjct  329  TQSFSRATLETMTRDLAEPLVEIVEIALMNGGVAKQEVDGIVFAGGASRIPMLRQLMVER  388

Query  357  FNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  416
            F   E    ++ +E V +GA   A I+ G  + +   +L +L     SLG+ETAGGVM  
Sbjct  389  FGWIELQCDVDEEEVVVHGAAAIADIIHGQ-AVDATAELNILPWIVNSLGVETAGGVMLP  447

Query  417  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVP  476
            +++R+   PT+ +QT ST   NQ  + I+VFEGER +T+DN+ +G+  L G+ P P+GVP
Sbjct  448  VLSRHRLTPTRATQTVSTLHANQLDITIRVFEGERLLTKDNHFIGQLRLSGLAPAPQGVP  507

Query  477  QIDVTFDIDANG-ILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEA  535
            +I+V F+ DA G  L  +A  + T   + +TI   K      E  R     E  K ED  
Sbjct  508  RIEVEFETDAMGETLFATARVEGTNLADSLTIQVAKHAFEHDEAVRKA--GEDAKDEDTK  565

Query  536  NKVRIE  541
             K RIE
Sbjct  566  VKARIE  571

>PYIW_17145
Length=443

 Score = 335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 252/391 (64%), Gaps = 18/391 (5%)

Query  189  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEF  248
            +DK  G + + +FDLGGGTFDVS+L I  G+FEVK+T GDT LGGEDFD  L+ +   EF
Sbjct  1    MDKADG-KVIAVFDLGGGTFDVSILEISGGVFEVKSTNGDTLLGGEDFDEELLRYLVGEF  59

Query  249  KRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID------FNSTITR  302
            K++   D++ +  A++RLR A E+AKR L   AQ  I +   F   D       N  ITR
Sbjct  60   KKETSIDLSGDNLAMQRLREAAEKAKRELDGLAQTDISLP--FITADATGPKHLNMKITR  117

Query  303  ARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEP  362
            A FE +      +TM P +K ++DA L K  ++EV+LVGG +R+PKVQ  + DFF GK+P
Sbjct  118  ATFEKLVNHLIERTMGPCKKCVKDAGLDKKDINEVILVGGMSRMPKVQTTVEDFF-GKKP  176

Query  363  NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNT  422
            +K +NPDE VA GA +Q  +L G+     L D+  L +       ET GGV T LI RNT
Sbjct  177  SKGVNPDEVVAMGAAIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLITRNT  231

Query  423  TVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  482
            T+PTKKSQ FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+F
Sbjct  232  TIPTKKSQVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSF  291

Query  483  DIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEA  542
            DIDANGI+NV+A +K+TGKE  I I +  G LS +EI+RMV EAE     D   K  IEA
Sbjct  292  DIDANGIVNVAARDKATGKEQNIVIQS-SGGLSDSEIERMVQEAEMNAEADLKRKELIEA  350

Query  543  KNALENYAYSLRNSL--NDEKLKEKIPEADK  571
            KN  ++ AY+   +L  ++EKL ++  EA K
Sbjct  351  KNEADSVAYTTEKTLKEHEEKLDKETVEAVK  381

>PHYSO_549561
Length=361

 Score = 328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 251/366 (69%), Gaps = 11/366 (3%)

Query  240  LVDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS  298
            +V+H   EFKRK+R  D + + RA+RRLRTACE AKR LS++  A +E+DSLF+G+DF+S
Sbjct  1    MVEHLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSS  60

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN  358
            T+TRA+FE +  + F++  E V KVL DAK+    V E+VLVGGSTRIPKVQ +LS  F 
Sbjct  61   TVTRAKFESLNEELFKRCEETVLKVLEDAKMKPEDVTELVLVGGSTRIPKVQTMLSTLFG  120

Query  359  GKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLI  418
            GKE +KSINPDEAVAYGA VQ AIL G   ++    LLL+DVTPLSLG+ET G VM+ LI
Sbjct  121  GKELSKSINPDEAVAYGAAVQGAILDG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLI  179

Query  419  ARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI  478
             RNT +P +K++ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ+
Sbjct  180  KRNTAIPVRKTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQV  239

Query  479  DVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKV  538
            +VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ +IDRMVAEA+K+K +D     
Sbjct  240  EVTFEIDANGILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLR  299

Query  539  RIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEA  598
            RIEA+N LE + Y         +  E   E     V+  + +   WL+ H+ +   E E 
Sbjct  300  RIEARNDLEQFIY---------RAIEMAREKGDTNVESAIRDARDWLEDHEEATLRELED  350

Query  599  KQKELE  604
            K++ LE
Sbjct  351  KKRMLE  356

>PHYKE_2977
Length=220

 Score = 318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 165/170 (97%), Gaps = 0/170 (0%)

Query  446  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  505
            VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI
Sbjct  1    VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  60

Query  506  TITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEK  565
            TITNDKGRLSQA+IDRMVAEAEKYKSEDEANK+RIEAKNALENYAY+LRN+LNDEKLK++
Sbjct  61   TITNDKGRLSQADIDRMVAEAEKYKSEDEANKIRIEAKNALENYAYNLRNTLNDEKLKDQ  120

Query  566  IPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANPVLQKVY  615
            I E DKK +DDKVTETI WLDA+QS+EKEE+E KQKELEGVANP+LQK+Y
Sbjct  121  ITEDDKKAIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  170

>PITG_16528
Length=561

 Score = 328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 213/505 (42%), Positives = 304/505 (60%), Gaps = 29/505 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTER--LIGDAAKN-Q  61
             +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F    +   +G+ A   +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLE  80

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT-FQP  120
             +    NT+   KRL+G+KF    V     +  ++++  A     + V  +G+ K   QP
Sbjct  81   TSEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQV-VRGQKKVQVQP  139

Query  121  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            EE+S+ VL +++  A+A+     K  N VITVPAYF+D+QR+AT  + ++AG   +R++N
Sbjct  140  EEVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRKATIASASMAGFKAVRLLN  199

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSIE+G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIEDGKFEVLGIGGDTNLGGEDINN  258

Query  239  RLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             L+DH      R+H  ++T  Q     + RL+   E+AK  LS    A I +  + D   
Sbjct  259  TLLDHVLDVLYRRH--NVTRAQVGQADMVRLKREVEKAKIELSEQEDAEISVHDIADVST  316

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  355
            F  T+TR +FE +C   ++K +  V  VLRDA++  S + EV+LVGGSTRIP ++  +S+
Sbjct  317  FTYTLTRRKFEQLCDAIWKKCLRIVSSVLRDAEVEPSDIDEVILVGGSTRIPVLRTKISE  376

Query  356  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  415
             FNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  377  AFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSME  435

Query  416  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  473
             ++ RN  +PT  ++ F TY D Q G+ ++V+EGE+ + ++N+ +  FN      +PR  
Sbjct  436  VILLRNARIPTTVTKYFQTYEDEQRGLTVEVYEGEKEVAKENDHICYFNF----ALPRDK  491

Query  474  ----GVPQIDVTFDIDANGILNVSA  494
                G     VTF ++A+GIL V A
Sbjct  492  VGKAGEFAHPVTFTMNASGILQVQA  516

>PHYSO_493381
Length=562

 Score = 325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 211/505 (42%), Positives = 303/505 (60%), Gaps = 28/505 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERL--IGDAA-KNQ  61
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  T +   +G+AA + +
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT-FQP  120
                  NTV   KRL+G+KF          +  +K+ S A     + V   G+ K   QP
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVARIYATYKVVSTAQGNAAVQVARGGQKKVHVQP  140

Query  121  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            EE+S+ VL +++  AEA+    VK  N VITVPAYF+DSQR+AT  + ++AG   +R++N
Sbjct  141  EEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMAGFKAVRLLN  200

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +N
Sbjct  201  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDINN  259

Query  239  RLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             LVDH  +   + H  D+   Q     + RL+   E+AK  LS+   A IE+  +     
Sbjct  260  ILVDHLLEVLYKHH--DVARAQVGEGDMVRLKREVEKAKIELSAEDYAEIELQGIAGVKT  317

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  355
            F  T+ R +FE +C   ++K +  V  VL++A++    + EV+LVGGSTRIP ++  +S+
Sbjct  318  FTYTLMRRKFEQLCDPIWKKCLRIVTSVLKEAEVEAVDIDEVILVGGSTRIPILRTKISE  377

Query  356  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  415
             F GKE   S+N DE V  GA +QAAILSG       +D+L++D  PL +GLETA G M 
Sbjct  378  AFGGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDALPLPIGLETADGSME  436

Query  416  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  473
             ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR  
Sbjct  437  VILPRNARIPTTVTKYFQTFEDDQLGLTVEVYEGEKEIAKENDHICYFNF----ALPRDK  492

Query  474  ----GVPQIDVTFDIDANGILNVSA  494
                G     VTF ++A+GIL V A
Sbjct  493  IGKAGEFAHPVTFTMNASGILQVQA  517

>PYU1_G002895
Length=561

 Score = 325 bits (833),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 210/505 (42%), Positives = 307/505 (61%), Gaps = 26/505 (5%)

Query  7    GYSVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAF---TDTERLIGDAAK  59
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F   ++    +G AA 
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  60   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQ  119
             Q      NTV   KRL+G+K++   V+       + ++S       + V    +    Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  120  PEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            PEE+S+ +L  ++  AEA+  GK + N VITVPAYF+DSQR+AT  + ++AG  V+R++N
Sbjct  140  PEEVSACILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMAGFKVIRLMN  199

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N
Sbjct  200  EPTAAAMAYGL-FVAGTKIVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNN  258

Query  239  RLVDHFTQEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             ++DH ++   + H   R  +T N   + +L+T  ERAK  LS+   A I +  +     
Sbjct  259  VIIDHLSELLHKHHDVARSRLTMND--MIQLKTQAERAKIELSNEDTAKIRLRDVAGIPA  316

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  355
            F  T+TR +FE +C   ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +SD
Sbjct  317  FEYTLTRHKFEQLCESIWKKCLRIVSSVLKEAEVEVADVDEVVMVGGSTRIPILRSKISD  376

Query  356  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  415
            FFNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  377  FFNGKELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETADGRME  435

Query  416  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  473
             +I +N  +P   ++ F T+ DNQ G+ I+V+EGE  + ++N+ +  FN      +PR  
Sbjct  436  VIIPKNARIPVSLTKYFQTFEDNQRGLTIEVYEGENEVAKENDHICYFNFT----LPRDK  491

Query  474  ----GVPQIDVTFDIDANGILNVSA  494
                G     VTF ++A+G+L V A
Sbjct  492  VGKAGEFAHPVTFTMNASGVLQVQA  516

>PHYRA_79054
Length=563

 Score = 324 bits (830),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 206/506 (41%), Positives = 303/506 (60%), Gaps = 30/506 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F D      D     VA+
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRF-DPSSQAADVGNAAVAL  79

Query  65   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT-FQ  119
                   NT+   KRL+G+KF          +  +++   A     + V   G+     Q
Sbjct  80   ETCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQ  139

Query  120  PEEISSMVLIKMREVAEAFI--GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            PEE+S+ VLI+++  AEA+   G+ ++N VITVPAYF+DSQR+AT  + ++AG   +R++
Sbjct  140  PEEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMAGFKAVRLL  199

Query  178  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  200  NEPTAAAMAYGL-FLSGRKVVTVFDFGGGTLDVSLLSIDDGKFEVLGIGGDTNLGGEDIN  258

Query  238  NRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLFDGI  294
            N L DH  +   + H  D+T  Q     + RL+   E+AK  LS+   A + +  +    
Sbjct  259  NTLCDHLLEVLYKHH--DVTRAQVGDVDMVRLKREVEKAKIELSTEEYADVTVHGIAGVK  316

Query  295  DFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLS  354
             F  ++ R++FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++  +S
Sbjct  317  TFTYSLLRSKFEQLCDPIWKKCLRIVSSVLKEAEMEAADIDEVILVGGSTRIPILRTKIS  376

Query  355  DFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVM  414
            + FNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M
Sbjct  377  EAFNGKELCMSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGSM  435

Query  415  TTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-  473
              ++ RN  +PT  ++ F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR 
Sbjct  436  EVILPRNARIPTTVTKNFQTFEDDQRGLTVEVYEGEKDIAKENDHICYFNF----ALPRD  491

Query  474  -----GVPQIDVTFDIDANGILNVSA  494
                 G     VTF ++A+GIL V A
Sbjct  492  KIGKAGEFAHPVTFTMNASGILQVQA  517

>PHYCA_6458
Length=560

 Score = 322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 210/509 (41%), Positives = 302/509 (59%), Gaps = 37/509 (7%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     + +
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSV-DVGNVAIGL  78

Query  65   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQ---FKGESKT  117
                   NT+   KRL+G+KF+         +  ++++      PQ  V     +G+ K 
Sbjct  79   ETSEPVGNTIRSVKRLMGQKFASKATDVARIYASYEVAP----TPQGNVAAQVVRGQKKV  134

Query  118  -FQPEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVL  174
              QPEE+S+ +L +++  AE +   +VK  N VITVPAYF+DSQR+AT  A ++AG   +
Sbjct  135  QVQPEEVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMAGFKAV  194

Query  175  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGE  234
            R++NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGE
Sbjct  195  RLLNEPTAAAMAYGL-FLSGTKMVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGE  253

Query  235  DFDNRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERAKRTLSSSAQAYIEIDSLF  291
            D +N LVDH  +   + H+  +T  Q     + RL+ A E+AK  LS      I +  + 
Sbjct  254  DINNVLVDHLLEVLYKHHK--VTRAQVGEADMVRLKRAVEKAKIELSEEEDVEITVHDIA  311

Query  292  DGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQ  351
                F  T+TR +FE +C   ++K +  V  VL++A++  + + EV+LVGGSTRIP ++ 
Sbjct  312  GVEKFAFTLTRRKFEQLCDPIWKKCLRIVSSVLKEAQVEAADIDEVILVGGSTRIPILRT  371

Query  352  LLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  411
             +SD FNGKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA 
Sbjct  372  KISDAFNGKELCLSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETAD  430

Query  412  GVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPM  471
            G M  ++ RN  +PT  ++ F TY D Q G+ ++V+EGE+   ++N+ +  FN      +
Sbjct  431  GTMEVILPRNARIPTTVTKYFQTYEDGQRGLTVEVYEGEKENAKENDHICYFNF----AL  486

Query  472  PR------GVPQIDVTFDIDANGILNVSA  494
            PR      G     VTF ++A+GIL V A
Sbjct  487  PRDKIGKAGEFAHPVTFTMNASGILQVQA  515

>SDRG_17122
Length=361

 Score = 313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/370 (48%), Positives = 242/370 (65%), Gaps = 20/370 (5%)

Query  75   RLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREV  134
            R+IGR++ +    A       ++  G+ + P I V  KG++K   PEE+ + +++K+++ 
Sbjct  2    RIIGRRYDEVRKTA-------QVVRGSMNNPIIRVIEKGDAKELHPEEVLAELVVKLKDD  54

Query  135  AEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY----GLD  190
              A+    +++A++TVP  FN  QRQA +DA AIAGL   RI +  T AA+ +    G+ 
Sbjct  55   VAAYTNARIEHAIVTVPTGFNLLQRQAVRDACAIAGLTNYRIKDVSTTAAVGHTSIKGMP  114

Query  191  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKR  250
            ++ G    ++ DLGGG   V LL IE GIFEV+A AG T LGGEDFD+ L DHF  EF R
Sbjct  115  RREGHD--MVVDLGGGHLSVPLLMIENGIFEVEAVAGITCLGGEDFDDHLYDHFVAEFSR  172

Query  251  KHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCG  310
            KHRKD+T   RA+RRLRTACE+ KR LS S  A +E++ LF  IDF S+ITRARFE +C 
Sbjct  173  KHRKDMTTCNRAVRRLRTACEKVKRDLSVSNTATLELEMLFGDIDFCSSITRARFEALCS  232

Query  311  DYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS-----  365
            + F K  + +EKVLRDAK++KSQV +VVL GGS R+PK+QQLLS FF G   +K      
Sbjct  233  ELFSKVTKLIEKVLRDAKINKSQVRDVVLAGGSMRMPKMQQLLSTFFGGANVDKKLCHSI  292

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
            +N +EA A+GATV AA + G   +      L+LD    S+G+ET GGV+T+LI+RNTT+P
Sbjct  293  LNNNEAAAHGATVMAAAVYGE--TWPDSRFLVLDAVSDSVGIETDGGVLTSLISRNTTIP  350

Query  426  TKKSQTFSTY  435
             KKS+ F  +
Sbjct  351  AKKSKKFEIF  360

>PPTG_05819
Length=561

 Score = 319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 206/504 (41%), Positives = 302/504 (60%), Gaps = 27/504 (5%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F    + + D     V +
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSV-DVGNVAVGL  79

Query  65   NAH----NTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT-FQ  119
                   NT+   KRL+G++F +  V     +  ++++  A     + V  +G  K   Q
Sbjct  80   ETSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQV-VRGHKKVQVQ  138

Query  120  PEEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            PEE+S+ VL +++  AEA+   + K  N VITVPAYF+D+QR+AT  + ++AG   +R++
Sbjct  139  PEEVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMAGFKAVRLL  198

Query  178  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FEV    GDT+LGGED +
Sbjct  199  NEPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIGGDTNLGGEDIN  257

Query  238  NRLVDHFTQEFKRKHRKDITE-NQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
            N L+DH      ++H     +  Q  + R++   E+AK  LS    A I +  +     F
Sbjct  258  NTLLDHLLDVLYKRHNVTRAQVEQGDMVRVKREVEKAKIELSEQESADITVYEIAGVSTF  317

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  356
              T+TR +FE +C   ++K +  V  VL+ A++  + + EV+LVGGSTRIP ++  +S+ 
Sbjct  318  KYTLTRRKFEQLCDPIWKKCLRIVASVLKHAEVDAADIDEVILVGGSTRIPVLRTKISEA  377

Query  357  FNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  416
            FNGKE  KS+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M  
Sbjct  378  FNGKELCKSVNADEVVCEGAAIQAAILSG-MDQRVFRDVLMMDVLPLPIGLETADGTMEV  436

Query  417  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  473
            ++ RN  +PT  ++ F TY D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR   
Sbjct  437  ILPRNARIPTTVTKYFQTYEDDQRGLTVEVYEGEKEIAKENDHICYFNF----ALPRDKI  492

Query  474  ---GVPQIDVTFDIDANGILNVSA  494
               G     VTF ++A+GIL V A
Sbjct  493  GKAGEFAHPVTFTMNASGILQVQA  516

>PYAR_14579
Length=567

 Score = 318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 207/507 (41%), Positives = 306/507 (60%), Gaps = 28/507 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIGDAAKNQV  62
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +  E L+G+AA  + 
Sbjct  22   CIGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIARE  80

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESK-TFQPE  121
                 NTV   KRL+G++F    VQ   K     I + A     + VQ  G+     QPE
Sbjct  81   YEPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPE  140

Query  122  EISSMVLIKMREVAEAFI----GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  177
            EI++ VL +++  AEA+      K + N VITVPAYFNDSQR+AT  +  +AG   +R++
Sbjct  141  EIAAEVLRELKASAEAYWEQTHSKRIDNVVITVPAYFNDSQRKATILSAQMAGFKAVRLL  200

Query  178  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
            NEPTAAA+AYGL    GE++V++ D GGGT DVSLL+I +G F+V    GDT+LGGED +
Sbjct  201  NEPTAAAMAYGL-FVSGEKHVVVVDFGGGTLDVSLLAIHDGKFQVLGIGGDTNLGGEDIN  259

Query  238  NRLVDHFTQEFKRKHRKDITENQRA-LRRLRTACERAKRTLSSSAQAYIEIDSL---FDG  293
            + ++ H  +  +R+     +   R+ L +++   ERAK  LS+     +E+ +L      
Sbjct  260  DLVMAHVLENLQRQRSVPRSALSRSDLIQIKREVERAKVALSTDESVELELPNLGPLAKQ  319

Query  294  IDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLL  353
              F   +TR +FE +CG  + + ++ VE VLR+A +   ++ EV++VGGSTRIP V+  +
Sbjct  320  KPFTLVLTRTKFESLCGSIWTRCLDIVEDVLREAGVETHEIDEVIMVGGSTRIPIVRSKV  379

Query  354  SDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGV  413
            S FF+ KE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLE A G 
Sbjct  380  SAFFHDKELCVSVNADEVVCEGAAIQAAILSG-IDKRVFRDVLMMDVIPLPIGLEKADGR  438

Query  414  MTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  473
            M  L+A+N+ +P   ++ F T+ D Q G+ +QV+EGE+ M ++N+ +  F+     P+PR
Sbjct  439  MEVLLAKNSRIPVSVTKYFETFEDGQRGLTVQVYEGEKEMAKENDHISDFSF----PLPR  494

Query  474  ------GVPQIDVTFDIDANGILNVSA  494
                  G  +  VT  ++A+G+L V A
Sbjct  495  DKIGKAGEFRHPVTLTMNASGVLQVQA  521

>H310_03911
Length=570

 Score = 311 bits (798),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 204/516 (40%), Positives = 301/516 (58%), Gaps = 26/516 (5%)

Query  9    SVGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAFT-DTERLIG-DAAKNQ  61
             +GIDLGTT SCVG W+        V  +  D  ++T PS V+F       +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHE  80

Query  62   VAMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
              +     T+  AKRL+G+  ++  V  + K+  + +     D   + +    +     P
Sbjct  81   QKLEPDTVTIRSAKRLMGKTLAE--VGDEQKYLSYSLCD---DGDHVAIDLPSKKTVVAP  135

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
             E+S+++L  +++  E  +G +V N V+TVPA+FN+SQRQAT  A A+AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKAAAMAGFQGIRLLNEP  195

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    G+THLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGKFAVDGVGGNTHLGGEDINHVL  254

Query  241  VDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST  299
             D+  +  + ++    +T ++ A+ +L+ A E AK TLSS  +  I +D +         
Sbjct  255  YDYMLESIQNQNGGTPLTLDRTAIIQLQQAAEHAKVTLSSQKEVSIYLDDIGGVKSHKLK  314

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +TR++FE +C     + ++    VL    L+ + + EVVLVGGSTRIP ++  LS  FNG
Sbjct  315  LTRSKFESLCDPLLTRCIDITLNVLASIDLTPNDIDEVVLVGGSTRIPALRNKLSALFNG  374

Query  360  KEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIA  419
            KE   S+N DE VA GA +QAAILSG  +   LQD+L+LDV PLS+G+E A G M  LI 
Sbjct  375  KEMCTSMNADEVVASGAAIQAAILSG-VNKRVLQDVLMLDVIPLSIGIEKADGTMEVLIP  433

Query  420  RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------  473
            +N+ +P   ++ F T  D+Q G+ ++VFEGE+ + RDN  L  FN      +PR      
Sbjct  434  KNSRIPIAVTKHFETLDDDQRGITVEVFEGEKPVARDNVFLTYFNF----TLPRHKAGKA  489

Query  474  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  509
            G  Q  VT  +DANGIL V A  +    +N++ I+N
Sbjct  490  GEFQHAVTLSMDANGILQVKAGAQHDIDDNEVAISN  525

>PYIW_17320
Length=563

 Score = 310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/498 (40%), Positives = 299/498 (60%), Gaps = 16/498 (3%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAF---TDTERLIGDAAKNQV  62
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F   ++    +G AA  Q 
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQE  82

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEE  122
                 NT+   KRL+G+K++   V+       + I++       + V    ++   QPEE
Sbjct  83   TQPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEE  142

Query  123  ISSMVLIKMREVAEAFIG-KEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            +++ +L  ++  AEA+   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPT
Sbjct  143  VAACILADLKASAEAYFDDKRIDNVVITVPAYFNDSQRKATLTSASMAGFKAVRLLNEPT  202

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAA+AYGL    G + V++FD GGGT DVSL+SI +G FEV    GDT+LGGED +N + 
Sbjct  203  AAAMAYGL-FVAGTKMVVVFDFGGGTLDVSLMSISDGRFEVLGIGGDTNLGGEDLNNAIT  261

Query  242  DHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            DH  +   + H     T   + + +L+T  E+AK  LSS     IE+  +     F  T+
Sbjct  262  DHLIELLHKHHDVSRATLTMQDMIQLKTQAEQAKIALSSDDSTEIELRDVAGIAKFKYTL  321

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TR +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +SDFF+GK
Sbjct  322  TRHKFEQLGEAIWKKCLRIVHSVLKEAEVEVADVDEVVMVGGSTRIPLLRTKVSDFFDGK  381

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M T+I +
Sbjct  382  ELCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGRMETIIPK  440

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR----GVP  476
            N+ +P   ++ F T+ DNQ G+ ++V+EGE  + ++N+ +  FN   + P  +    G  
Sbjct  441  NSRIPVSLTKYFQTFEDNQRGLTVEVYEGEHEVAKENDHICYFNF--VLPHDKVGKAGEF  498

Query  477  QIDVTFDIDANGILNVSA  494
               VTF ++A+G+L V A
Sbjct  499  AHPVTFTMNASGVLQVQA  516

>PHALS_02692
Length=557

 Score = 308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 202/505 (40%), Positives = 300/505 (59%), Gaps = 29/505 (6%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLI--GDAAKN-QV  62
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  T + +  G AA + + 
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQF-KGESKT-FQP  120
            +    NT+   KRL+G+K+          +  ++++  A  +  + VQ  +G  K   QP
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTA--QKNVAVQLVRGHKKVQVQP  135

Query  121  EEISSMVLIKMREVAEAFIGKEVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            EE+S+ +L +++  AEA+   + +  N VITVPAYF+D+QR+AT  +  +AG   +R++N
Sbjct  136  EEVSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRKATITSALMAGFKAVRLLN  195

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAA+AYGL    G + V +FD GGGT DVSLL I++G FEV    GDT+LGGED +N
Sbjct  196  EPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLRIQDGKFEVLGIGGDTNLGGEDINN  254

Query  239  RLVDHFTQEFKRKH---RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             ++DH  +   ++H   R  +T     L RL+   E+ K  LS    A + +  L     
Sbjct  255  LVLDHVLEVLNKRHNVIRSQVTGAD--LVRLKQEVEKLKIQLSVEESADVIVRDLAGVPR  312

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  355
               T+TR +FE +C   ++K +  +  VL++A++  + + EV+LVGGSTRIP ++  +S 
Sbjct  313  VTVTLTRRKFEQLCDPIWKKCLRIMSSVLKEAQVDAADMDEVILVGGSTRIPCLRSKISK  372

Query  356  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  415
             F+GKE   S+N DE V  GA +QAAILSG       +D+L++DV PL +GLETA G M 
Sbjct  373  AFHGKELCMSVNADEVVCEGAAIQAAILSG-IDQRVFRDVLMMDVLPLPIGLETADGTME  431

Query  416  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR--  473
             ++ RN  +PT  ++ F+TY DNQ G+ I+V+EGE+ + ++N+ +  FN      +PR  
Sbjct  432  VILPRNARIPTTVTKYFTTYEDNQRGITIEVYEGEKDIAKENDHICYFNF----ALPRNK  487

Query  474  ----GVPQIDVTFDIDANGILNVSA  494
                G     VTF ++A+GIL V A
Sbjct  488  IGKAGEYSHPVTFTMNASGILQVQA  512

>PYIR_13638
Length=543

 Score = 307 bits (787),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 194/499 (39%), Positives = 296/499 (59%), Gaps = 38/499 (8%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQG-NRTTPSYVAFTDTERLIGDAAKNQVAMN  65
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS     +T  +            
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPS----VETAPV------------  66

Query  66   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
              NT+   KRL+G+K++    +       +KI++       + V    +  T +PEE+S+
Sbjct  67   -GNTIRSIKRLMGQKYTSKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSA  125

Query  126  MVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             +L  ++  AE +   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPTAAA
Sbjct  126  CILSDLKASAEVYFDNKRIDNVVITVPAYFNDSQRKATITSASMAGFKAIRLMNEPTAAA  185

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGL    G + V++FD GGGT DVSL+SI++G FEV    GDT+LGGED +N + DH 
Sbjct  186  MAYGL-FVAGTKMVVVFDFGGGTLDVSLMSIQDGRFEVLGIGGDTNLGGEDLNNVITDHL  244

Query  245  TQEFKRKHRKDITENQRALR---RLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTIT  301
             +   + H  D+   + ++    +L+T  E+AK  LSS   A IE+  +     F  T+T
Sbjct  245  IELLHKHH--DVPRAKLSMADMIQLKTQAEQAKIALSSDDSAEIELHDVAGVPKFKYTLT  302

Query  302  RARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            R +FE +    ++K +  V  VL++A++  + V EVV+VGGSTRIP ++  +S+FF+GKE
Sbjct  303  RHKFEQLGESIWKKCLRIVSSVLKEAEVEIADVDEVVMVGGSTRIPILRTKISEFFDGKE  362

Query  362  PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARN  421
               S+N DE V  GA +QAAILSG       +D+L++DV PL +GLET  G M  +I +N
Sbjct  363  LCMSVNADEVVCEGAAIQAAILSG-MDRRVFRDVLMMDVIPLPIGLETHDGTMEVIIPKN  421

Query  422  TTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GV  475
            + +P   ++ F T+ DNQ G+ ++V+EGE+ + ++N+ +  FN      +PR      G 
Sbjct  422  SRIPVSLTKYFQTFEDNQRGLTVEVYEGEQKVAKENDHICYFNF----VLPRDKIGRAGE  477

Query  476  PQIDVTFDIDANGILNVSA  494
                VTF ++A+G+L V A
Sbjct  478  FAHPVTFTMNASGVLQVQA  496

>SPRG_01255
Length=566

 Score = 307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 200/500 (40%), Positives = 290/500 (58%), Gaps = 24/500 (5%)

Query  9    SVGIDLGTTYSCVGVW--QNDRVEII---ANDQGNRTTPSYVAFTDT-ERLIGDAAKNQV  62
             +GIDLGTT SCVG W    + V+I+   A D   +T PS V+F  T    +G AA    
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  63   AMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPE  121
            A +A   TV  AKRL+G+  +D     D K+  + +  G  +   +++       +  P 
Sbjct  84   ASDADVVTVRSAKRLLGQSLAD--ASPDQKYLSYTLCDG--ESGHVSIALPARKTSVTPS  139

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            E+++++L K++  AEA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPT
Sbjct  140  EVAALLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPT  199

Query  182  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            AAA+AYGL   G +R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N L 
Sbjct  200  AAAMAYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNILF  258

Query  242  DHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI  300
            DH  Q   +KH    +      + +L+ A E AK  LS+  +  + + ++        T+
Sbjct  259  DHVLQAIAKKHGPVSLPLATHDMVQLQRAVEAAKVALSTDDETVLRLTNVGHVALHEMTL  318

Query  301  TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGK  360
            TR + + +C   ++K +    +VL+   +  S V EVVLVGGSTRIP ++  L  FFN K
Sbjct  319  TRRKLDALCDPLYKKCLRITREVLKSIDVDPSDVDEVVLVGGSTRIPAIRARLRAFFNDK  378

Query  361  EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIAR  420
            E   S+N DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +
Sbjct  379  ELCTSVNADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIQK  437

Query  421  NTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------G  474
            N+ +P   ++ F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G
Sbjct  438  NSRIPVSVTKYFDTAIDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKVRGKAG  493

Query  475  VPQIDVTFDIDANGILNVSA  494
              Q  VT  ++ANG+L V A
Sbjct  494  AIQHPVTLSMNANGLLQVKA  513

>CCI45261
Length=558

 Score = 305 bits (782),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 194/507 (38%), Positives = 308/507 (61%), Gaps = 35/507 (7%)

Query  9    SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDTERLIGDAAKNQVA  63
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  T+  +    +  V 
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  64   MNA----HNTVFDAKRLIGRKFSD---PIVQADIKHWPFKISSGAGDKPQITVQFKGESK  116
            + A     NT+   KRL+G+++++     +Q+   H    +S+  G+     +  K +  
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQI--VSTKRGNVGICIITEKNDES  141

Query  117  TFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  175
              +PE++++ +L+K++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG   +R
Sbjct  142  IVEPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQRKATIRAASMAGFRKIR  201

Query  176  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGED  235
            ++NEPTAAA+AYGL    G + VL+FD GGGT DVSL+ I+EG F+V A  GDT+LGGED
Sbjct  202  LMNEPTAAAMAYGL-FIAGHKQVLVFDFGGGTLDVSLMRIDEGKFKVVAIGGDTNLGGED  260

Query  236  FDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID  295
             +  +  H    F+++    +T +Q+    ++ + E AK  LS S +A +E+      + 
Sbjct  261  INQIIYHHILCSFEKRGILKLTIDQQT--AMKQSIEEAKIQLSDSMEATVELKVATRLLQ  318

Query  296  FNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSD  355
            +N  + R  FE +C   +++ +  +EKVL+DA L    V EVV+VGGSTRIPK++  +S+
Sbjct  319  YN--LRRDVFESICDSVWKRCISTIEKVLKDASLEPCDVDEVVMVGGSTRIPKLRSSISE  376

Query  356  FFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMT  415
            FF+ KE   S+N D  V  GA +QAA+LSG    + LQD+L+LDV PLS+GLET  G M 
Sbjct  377  FFDKKELCDSVNADRVVCEGAAIQAAVLSG-MDRKTLQDVLMLDVIPLSMGLETVDGRME  435

Query  416  TLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGV  475
             ++++N+ +P + ++ F T+ D+Q G+ + V+EGE S+ R+N  + +F+     P+P   
Sbjct  436  IILSKNSQIPAEVTKYFQTFEDDQRGISVDVYEGENSIARENEHICRFDF----PIPS--  489

Query  476  PQID--------VTFDIDANGILNVSA  494
             +ID        VTF ++ NG+L VSA
Sbjct  490  LKIDKAGRIFHPVTFKMNENGVLQVSA  516

>H257_01680
Length=571

 Score = 296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 198/518 (38%), Positives = 293/518 (57%), Gaps = 29/518 (6%)

Query  9    SVGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF-TDTERLIG-DAAKNQ  61
             +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F +     +G DA +++
Sbjct  21   CIGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHE  80

Query  62   VAMNAHN-TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
                    T+  AKRL+G+  ++  +  + K+  + +    G    + +    +     P
Sbjct  81   QKYEPDTVTIRSAKRLMGKTLAE--MADEQKYLSYTLCDADG---HVAIDLPSKESIATP  135

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
             E+S+++L  +++ AE  +G +V N V+TVPAYFN+SQRQ+T  A  +AG   +R++NEP
Sbjct  136  SEVSAILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQSTLKAATMAGFQGIRLLNEP  195

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAA+AYGL   G +R V IFD GGGT DVS+LSI+ G F V    GDTHLGGED ++ L
Sbjct  196  TAAAMAYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGTFAVDGVGGDTHLGGEDINHLL  254

Query  241  VDHF----TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
            VD      +QE        +   + A+ +L+ A E AK TLS+     I +  +      
Sbjct  255  VDFMLDSISQEQNGGKPLPLPLTRTAIIQLQQAAEHAKVTLSTQKDVSIYLKDVGGIKAH  314

Query  297  NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF  356
               ++RA+ E +C     + ++    VL    L+   + EVVLVGGSTRIP ++  LSD 
Sbjct  315  KMKLSRAKLESLCAPLLTRCVDITRDVLASIGLTPQDIDEVVLVGGSTRIPALRTKLSDL  374

Query  357  FNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  416
            F+GK    S+N DE VA GA +QAAILSG       QD+L++DV PLS+G+E A G M  
Sbjct  375  FDGKVLCTSVNADEVVASGAAIQAAILSG-VDKRVFQDVLMMDVIPLSIGIEMADGRMEV  433

Query  417  LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  473
            LI +N+ +P   +++F TY D+Q G+ ++VFEG+  + RDN  L  FN      +PR   
Sbjct  434  LIPKNSRIPISVTKSFDTYEDHQKGITVEVFEGDHPVARDNVYLTYFNF----TLPRHKL  489

Query  474  ---GVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  508
               G  Q  VT  ++ NG+L V A  +    EN+  ++
Sbjct  490  GKAGEFQHAVTLSMNENGVLQVKAGAQHEIDENEAAVS  527

>PHALS_00667
Length=142

 Score = 280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)

Query  453  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  512
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  513  RLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKK  572
            RLSQAEIDRMVAEA+KYKSEDEANKVR+EAKNALENYAYSLRNSLN+EK+KE IP+ADKK
Sbjct  61   RLSQAEIDRMVAEADKYKSEDEANKVRVEAKNALENYAYSLRNSLNEEKMKESIPKADKK  120

Query  573  VVDDKVTETIQWLDAHQSSEKE  594
            VVDDKVTE IQWLDAHQSSEKE
Sbjct  121  VVDDKVTEVIQWLDAHQSSEKE  142

>PYVX_13615
Length=585

 Score = 293 bits (751),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 202/528 (38%), Positives = 305/528 (58%), Gaps = 51/528 (10%)

Query  9    SVGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF--TDTERLIG-DAA  58
             VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F     + L+G +A 
Sbjct  21   CVGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQVLVGNEAI  79

Query  59   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKG-ESKT  117
             +++     NTV   KRL+G+ F    V+   K   FK+         I++   G ++ T
Sbjct  80   AHELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDRSGSKTDT  139

Query  118  FQPEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
              PE++S+ VL +++  AEA+   E + + VITVPAYFNDSQR+AT +A   AG + +R+
Sbjct  140  VLPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQRRATLEAATSAGFSAVRL  199

Query  177  INEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            +NEPTAAA+AYGL    G + V++FD GGGT DVSL+ I++G FEV    GDT+LGGED 
Sbjct  200  LNEPTAAAMAYGL-FLAGTKLVVVFDFGGGTLDVSLMQIQDGKFEVLGIGGDTNLGGEDI  258

Query  237  DNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEI-DSLFD  292
            ++ L+DH  + F +    HR+ +      + +L+   E+AK  LS+   A +E+  +   
Sbjct  259  NHLLLDHVLEMFDKHFGVHREQLRPED--MVKLKREVEKAKIELSTEESAVVELRGAAGS  316

Query  293  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  352
                  T+ R +FE +C   +++ +  V  VL++A+   +++ EV+LVGGSTRIP V+  
Sbjct  317  SKTMTVTLHRRKFELLCESIWKRCLRIVSNVLKEAEADVTEIDEVILVGGSTRIPVVRSR  376

Query  353  LSDFFNGK--------------------EPNKSINPDEAVAYGATVQAAILSGNdssekl  392
            LS+FFN K                    E   S+N DE V  GA +QAAILSG    +  
Sbjct  377  LSEFFNDKWMVCLTVRIRSTNGVSGVEQELCMSVNADEVVCEGAAIQAAILSG-MDHKVF  435

Query  393  qdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERS  452
            +D+L++DV PL +GLETA G M  L+ +N+ +P   ++ F T+ D Q G+ ++V+EGE +
Sbjct  436  RDVLMMDVIPLPIGLETADGAMEVLLPKNSRIPVSLTKYFETFEDGQRGLTVEVYEGEHA  495

Query  453  MTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  494
            + + N+ +  FN      +PR      G  +  VTF +  +G+L V A
Sbjct  496  VAKQNDHICYFNF----ALPRDKIGKAGEFRHPVTFTMTPSGVLQVQA  539

>PHALS_12790
Length=214

 Score = 281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)

Query  453  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  512
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  513  RLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKK  572
            RLSQA+IDRMV+EAEKYKSEDEANKVRIEAKN LENYAY+LRN+LNDEKLK ++ + DKK
Sbjct  61   RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNGLENYAYNLRNTLNDEKLKGQLSDDDKK  120

Query  573  VVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANPVLQKVY  615
             +DDKVTETI WLDA+QS+EKEE+E KQKELEGVANP+LQK+Y
Sbjct  121  AIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  163

>SDRG_16621
Length=531

 Score = 291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 189/493 (38%), Positives = 282/493 (57%), Gaps = 44/493 (9%)

Query  25   QNDRVEIIANDQGN---RTTPSYVAFTDTERLIGDAAKNQVAMNAHN------TVFDAKR  75
              + V+I+ +  G+   +T PS V+F  T    G  A   VA+ A        TV  AKR
Sbjct  1    HANHVKIVNHSTGDAKAKTLPSVVSFPST----GAPAVGFVAVAAEASDADVVTVRSAKR  56

Query  76   LIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVA  135
            L+G+  +D +   D K+  +K+  G  +   +++       +  P E+++++L ++++ A
Sbjct  57   LLGQSLADAL--PDQKYLSYKLCEG--ESGHVSIALPARKTSVTPSEVAALLLSELKKAA  112

Query  136  EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  195
            EA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPTAAA+AYGL   G +
Sbjct  113  EAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPTAAAMAYGLFVAGTK  172

Query  196  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---  252
            R V++FD GGGT DVS+L I +G F V+   GDTHLGGED +N + DH  Q   +KH   
Sbjct  173  R-VVVFDFGGGTLDVSVLHIADGTFTVEGVGGDTHLGGEDINNIVFDHVLQSIAKKHGPL  231

Query  253  -----RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFED  307
                   D+ + QRA+       E AK  LS+  +  + + ++        T+TR + + 
Sbjct  232  ALPLATPDMVQLQRAV-------EAAKIALSTDDETVLRLTNVGHVALHEMTLTRRKLDA  284

Query  308  MCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN  367
            +C   F+K +    +VL+   +  S V+EVVLVGGSTRIP ++  L  FFN KE   S+N
Sbjct  285  LCDPLFKKCLRITREVLKAIDVDPSDVNEVVLVGGSTRIPAIRARLRAFFNDKELCTSVN  344

Query  368  PDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTK  427
             DE VA GA +QAAILSG    +  QD+L+LDV P+S+G+E A G M  LI +N+ +P  
Sbjct  345  ADEVVAEGAAIQAAILSG-VDKKVFQDVLMLDVIPMSIGIEKADGAMEVLIPKNSRIPVS  403

Query  428  KSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVT  481
             ++ F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G  Q  VT
Sbjct  404  VTKYFDTAVDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKTRGKAGSIQHPVT  459

Query  482  FDIDANGILNVSA  494
              ++ANG+L V A
Sbjct  460  LSMNANGLLQVKA  472

>PYAP_19903
Length=527

 Score = 291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 195/504 (39%), Positives = 297/504 (59%), Gaps = 25/504 (5%)

Query  23   VWQNDR--VEIIAN-DQGNRTTPSYVAFT--DTERLIGDAAKNQVAMNAHNTVFDAKRLI  77
            +W  +R  V+I+ N D   RTTPS V F     E ++G+AA  +      NTV   KRL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  78   GRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT-FQPEEISSMVLIKMREVAE  136
            G++F    V+   +     I         ++V+  G+     QPEE+SS VL++++  AE
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELKASAE  120

Query  137  AFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  195
            A+   E V N VITVPAYFNDSQR+AT  +  +AG   +R++NEPTAAA+AYGL    G+
Sbjct  121  AYWDDERVDNVVITVPAYFNDSQRKATILSAQMAGFKAIRLLNEPTAAAMAYGL-FLSGQ  179

Query  196  RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKH---  252
            ++V++FD GGGT DVSLLSI +G FEV    GDT+LGGED ++ +V H      ++H   
Sbjct  180  KHVVVFDFGGGTLDVSLLSINDGRFEVLGIGGDTNLGGEDINDLVVGHVVDMLHQQHGLT  239

Query  253  RKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGID-FNSTITRARFEDMCGD  311
            R D++ +   L +++   E+AK  LSS     IE+  +      +   +TR  FE +C  
Sbjct  240  RNDLSRSD--LIQIKRETEKAKVELSSEESIAIELKGIGKKKQAYKIKLTRPAFEKICAS  297

Query  312  YFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEA  371
             + + +  V  VL +A +  S + EV++VGGSTRIP V+  +S+FF+ KE   S+N DE 
Sbjct  298  IWSRCLVIVTDVLEEAGVHTSDIDEVIMVGGSTRIPIVRAKVSEFFDNKELCLSVNADEV  357

Query  372  VAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQT  431
            V  GA +QAAILSG       +D+L++DV PL +GLE A G M  L+ +N+ +P   ++ 
Sbjct  358  VCEGAAIQAAILSG-LDKRIFRDVLMMDVLPLPIGLEKADGEMEILLPKNSRIPVTMTKY  416

Query  432  FSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDID  485
            F T+ D+Q G+ +QV+EGE ++ ++N+ +  FN     P+PR      G  +  VTF ++
Sbjct  417  FETFEDDQRGLTVQVYEGENAVAQENDHICDFNF----PIPRDKIGKAGEFKHPVTFTMN  472

Query  486  ANGILNVSAVEKSTGKENKITITN  509
            A+G+L V+A      +E  +++T+
Sbjct  473  ASGVLQVTAGIHHDSEETPMSLTS  496

>SDRG_01068
Length=621

 Score = 291 bits (746),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 200/619 (32%), Positives = 308/619 (50%), Gaps = 28/619 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDTERLIGDAAKNQVAMNAHN  68
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD  RL+G  AK   A +A N
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVL  128
             VF   R +GR   D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE    VL
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEE----VL  120

Query  129  IKMREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
              + E  +A + ++  V    +TVPA F  +QR A  DA AIAGLNV +++N PTAA + 
Sbjct  121  ATLLEHTKAMVDEQLTVGYVTLTVPAAFTTTQRHAVLDAAAIAGLNVRKLLNAPTAALVT  180

Query  187  YG--LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            Y     +   ER VL    G G+  V++   E  +    AT+G+ HLGG D D RLV H 
Sbjct  181  YMNMHPRMREERTVLTVTAGAGSLGVAITVDESALSTAVATSGNAHLGGLDIDERLVRHC  240

Query  245  TQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRAR  304
               F+R    D+  + R L+RLRTACE AK  LS++    +E+  L    D    ++R +
Sbjct  241  IAAFERTIGCDVRLSPRGLQRLRTACEEAKIALSTATTTTVEVPRLSGENDLVVVVSRDQ  300

Query  305  FEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNK  364
               +  +   +    V K L+ AKL K+ + ++VL GG  R+P ++  L D F+G+    
Sbjct  301  LNQLAREMMAQLTALVVKALQTAKLDKNNIDDIVLAGGLVRMPLLKTTLVDLFHGQRVRL  360

Query  365  SINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTV  424
              NPDEA+  GAT+  A    N +       +L      +             +AR  T 
Sbjct  361  VGNPDEAIVTGATLYTA----NATLRATGRDVLACQCLPTPFWVATEARHPQYLARGATD  416

Query  425  PTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVT  481
                ++   T   NQP + + V+EG       ++L GK+    + P+P G+P+   + V 
Sbjct  417  YFSTTEDMFTTQANQPDITLLVYEGLLGQRDTSHLQGKWR---VGPLPNGIPRGATVQVG  473

Query  482  FDI-DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRI  540
            F I  A G L +SA    T  +  I  TN+    ++  + R++ EA   +  D    +  
Sbjct  474  FQICHATGTLQISA----TVDDKPIPATNELAPTTRGRMCRLIQEAATRRQVDGRQHIHA  529

Query  541  EAKNALE---NYAYSLRNSLNDEKL-KEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEY  596
                A      Y   LR + + + + + ++ E  +  +DD +   ++WL  H ++   EY
Sbjct  530  ARAAAKAAATEYTMRLREAWHGDAISRNRVSEVTRDELDDALALALKWLILHPNANTVEY  589

Query  597  EAKQKELEGVANPVLQKVY  615
            E  + +LE V + V++ +Y
Sbjct  590  EVVRFKLEAVGSRVVEALY  608

>CCA22305
Length=561

 Score = 289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 192/511 (38%), Positives = 305/511 (60%), Gaps = 40/511 (8%)

Query  9    SVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTDTERLIGDAAKNQVA  63
            ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +   +  +    K  + 
Sbjct  24   AIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKEAIE  83

Query  64   MN----AHNTVFDAKRLIGRKF-SDPIVQADIKHWPFKISSGAGDKPQITVQFKGES---  115
            +       NT+   KRL+G+K+ +D I           +S+  G+     +Q  G+    
Sbjct  84   LESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVSTQRGNA---AIQIDGDHGDD  140

Query  116  --KTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLN  172
               + +PEE+++ +LIK++  AEA+   K ++N V+TVPA+FND QR+AT  A ++AG  
Sbjct  141  KRTSVEPEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQRKATIRAASMAGFK  200

Query  173  VLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLG  232
             +R++NEPTAAA+AYGL    G++ VL+FD GGGT DVSL+ I EG F V A  GDT+LG
Sbjct  201  KIRLLNEPTAAAMAYGL-FIAGKKQVLVFDFGGGTLDVSLMQIHEGRFRVVAIGGDTNLG  259

Query  233  GEDFDNRLVDHFTQEFKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLF  291
            GED +  ++DH  Q F+ K     +T +Q+A   ++ + E+AK  LS++ +A I+ +   
Sbjct  260  GEDINQMIIDHILQSFEEKEGILQLTIDQKA--AMKQSIEQAKIQLSNAMEAVIKFEHKT  317

Query  292  DGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQ  351
                +   ++R  FE +C   + + +  ++ VL+DA +    V EVV+VGGSTRIPK++ 
Sbjct  318  TWRQY--ALSRDVFESICDSVWTRCISTIQGVLQDASVDPCDVDEVVMVGGSTRIPKLRS  375

Query  352  LLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  411
             +S+ F+ K   +S+N D+ V  GA +QAA+LSG    + LQD+L+LDV PLS+GLETA 
Sbjct  376  KISEVFDNKALCESVNADQVVCEGAAIQAAVLSG-MDRKVLQDVLMLDVIPLSMGLETAD  434

Query  412  GVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPM  471
            G M  ++ +N+ +P + ++ F T+ D+Q G+ + V+EGE  + R+N  + +F+     P+
Sbjct  435  GRMEVILPKNSQIPAQVTKYFQTFEDDQRGISVDVYEGEHPIARENEHICRFDF----PI  490

Query  472  PRGVPQID--------VTFDIDANGILNVSA  494
            P    +ID        VTF ++ NG+L+V+A
Sbjct  491  P--TSKIDTAGRIFHPVTFRMNENGVLHVTA  519

>HYAP_01857
Length=492

 Score = 286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 189/467 (40%), Positives = 271/467 (58%), Gaps = 23/467 (5%)

Query  42   PSYVAFTDTERLI--GDAA-KNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKIS  98
            PS V F    + +  GDAA + +      NT+   KRL+G+KF    V     +  + + 
Sbjct  2    PSVVHFDPQSQHVDVGDAAVEFETEPPVGNTIRSIKRLLGQKFVSKAVDVARIYASYSVV  61

Query  99   SGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGKE--VKNAVITVPAYFND  156
              A     + V   G+    QPEE+ + VL +++  AEA+   +  + N VITVPAYF+D
Sbjct  62   PTAQGNVVLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSD  121

Query  157  SQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIE  216
            SQR+AT  + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE
Sbjct  122  SQRKATLTSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIE  180

Query  217  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRA---LRRLRTACERA  273
            +G FEV    GDT+LGG+D DN LVDH  +   R H  ++T  Q     + RL+   E A
Sbjct  181  DGKFEVLGIGGDTNLGGDDIDNVLVDHLIEMLDRHH--NLTRAQVGDENMVRLKREVENA  238

Query  274  KRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  333
            K  LS    A + +D + +      T+TR + E++CG   +K +  V  VL +AK+  S 
Sbjct  239  KIKLSEEEHAVVTVD-MANVPRITYTLTRRKLEELCGPIRKKCLRIVSSVLEEAKVESSN  297

Query  334  VHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklq  393
            V EV+LVGGSTRIP ++Q +S+ F GKE   S+N DE V  GA +QAAIL G       +
Sbjct  298  VDEVILVGGSTRIPILRQQISEAFGGKELCMSVNADEVVCEGAAIQAAILCG-VDQRVFR  356

Query  394  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSM  453
            D+L++DV PL +GLETA G M  ++ +N  +PT  ++ F TY DNQ G+ ++V+EGE  +
Sbjct  357  DVLMMDVLPLPIGLETADGSMEVILPKNARIPTTMTKYFQTYEDNQRGLTVEVYEGENKI  416

Query  454  TRDNNLLGKFNLDGIPPMPR------GVPQIDVTFDIDANGILNVSA  494
             ++ + +  FN      +PR      G     VTF ++ANGIL V A
Sbjct  417  AKECDHICYFNF----VLPRDKIGKAGEFAHPVTFTMNANGILQVRA  459

>PHYRA_51904
Length=129

 Score = 271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/128 (98%), Positives = 128/128 (100%), Gaps = 0/128 (0%)

Query  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  64
            TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM
Sbjct  2    TSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  61

Query  65   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEIS  124
            NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFK++SGAGDKPQITVQFKGESKTFQPEEIS
Sbjct  62   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEIS  121

Query  125  SMVLIKMR  132
            SMVLIKMR
Sbjct  122  SMVLIKMR  129

>SPRG_00183
Length=609

 Score = 285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 192/610 (31%), Positives = 313/610 (51%), Gaps = 20/610 (3%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            + + ID+G +   VGVW+N R  ++A D  N   P+ VAFTDT  L G+ AK     +  
Sbjct  6    HCIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQNDPT  64

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMV  127
            N VF+   L+GR+ +DP VQA +   PF+I + +   P I VQ +  + T+ P+EI  M+
Sbjct  65   NVVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEIVGML  124

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L   +++AE  +G  + +AV+TVPA +  SQRQA  DA  +AGL V R+++  TA  IA+
Sbjct  125  LEHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAVGIAH  184

Query  188  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQE  247
                   +R +L+ D G  +   S+++ E   F   A+A DT LGG   D RL  H    
Sbjct  185  TQATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQLGGFAMDARLAAHCMST  244

Query  248  FKRKHR-KDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLF-DGIDFNSTITRARF  305
            +    R  D+     A +RL +ACE A+  LS+S +  + I     DG+    T++R + 
Sbjct  245  WTPSTRGHDLI---LAKQRLLSACEAARCALSTSDETDVCIPHRSQDGMRL--TLSREKL  299

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
              +      K +  V KVL+ A+  K  V ++VLVGG   +P +Q  LS+ F GK+    
Sbjct  300  NALVHHLMDKVVAHVLKVLQQAQCCKEDVDDIVLVGGVALMPCLQTTLSNLFGGKQVAWF  359

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
              P EAV  GA +   I S   SS+       +     +     A G   T + R+  + 
Sbjct  360  PTPSEAVVAGAALY--IASTTASSDATVRPFAIHDALSTPIWAAAAGHHWTTVFRSPALS  417

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  485
            +  + TF +   + P VL+ V+EG+      ++L G+++++ +P        IDV F +D
Sbjct  418  SMATHTFVSTG-SSPFVLL-VYEGDVGFPASSHLQGQWHIESLP----HTRFIDVAFVVD  471

Query  486  -ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
               G+L V+A +KS+ K   + +TN     S+ E+  + A+A           +   AK 
Sbjct  472  ECTGVLRVTASDKSSQK--ALPVTNTDCATSRRELQHLCAQATARYHTTRQTVLLARAKA  529

Query  545  ALENYAYSLRNSLN-DEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKEL  603
            A  ++ YSLR++ + DE  + ++ +A +  +DD +   I+WL  H  +  ++Y+  + +L
Sbjct  530  AANDFTYSLRSTWHSDEASRRRVGDAARDELDDALAAAIKWLLLHPQATIDQYDDVRVQL  589

Query  604  EGVANPVLQK  613
            E V+  VL +
Sbjct  590  EAVSRRVLAR  599

>H257_16775
Length=291

 Score = 264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 160/266 (60%), Positives = 185/266 (70%), Gaps = 54/266 (20%)

Query  352  LLSDFFNGK--EPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglET  409
            +LSDF   +  +P     PDEAVA+GATVQAAILSGNDSS++LQD               
Sbjct  43   ILSDFCKKQVGQP-----PDEAVAFGATVQAAILSGNDSSDRLQD---------------  82

Query  410  AGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIP  469
                +  L     ++  K+  TFST  DNQPG LIQVFEGERSMTRDNNLLGKF+ DGIP
Sbjct  83   ----LLFLHVTPLSLGLKQPATFST--DNQPGALIQVFEGERSMTRDNNLLGKFSFDGIP  136

Query  470  PMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKY  529
            PM RGVPQ+DVTFDIDANGILNVS +EKSTGKE  ITITN KGRLS+ +I          
Sbjct  137  PMHRGVPQVDVTFDIDANGILNVSTIEKSTGKE--ITITNAKGRLSKDDI----------  184

Query  530  KSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQ  589
                      IE  N LENYAY+LRN+LN EKL+ K+ EADKKV++DKVTETI+WLDA  
Sbjct  185  ----------IERMNGLENYAYNLRNTLNVEKLQGKLDEADKKVMEDKVTETIKWLDA--  232

Query  590  SSEKEEYEAKQKELEGVANPVLQKVY  615
               KEEYEAKQKELEGVANP++QK+Y
Sbjct  233  --TKEEYEAKQKELEGVANPIMQKLY  256

>PHYSO_525236
Length=246

 Score = 260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 162/224 (72%), Gaps = 4/224 (2%)

Query  3    QTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            +TT G S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTD++ L+GDAA +Q 
Sbjct  4    KTTGGPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAAADQR  63

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGD----KPQITVQFKGESKTF  118
              NA NTVF   RL+GRKFSDP VQ  IKHWPFK+  G  D     P + VQF+G++K F
Sbjct  64   LQNAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQTKIF  123

Query  119  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
             P +I S++L +MR + E + GKE   AV+TVPA+FN SQRQA KDAGAIA + V+R+I+
Sbjct  124  HPVQILSLLLSEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAEIQVMRMIS  183

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  222
              TAA+I+YG++KKG ER VL+ DLG  T DVS++ IE+G FEV
Sbjct  184  RSTAASISYGINKKGSERRVLVVDLGASTLDVSVVEIEDGNFEV  227

>SPRG_00182
Length=615

 Score = 271 bits (692),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 194/618 (31%), Positives = 311/618 (50%), Gaps = 36/618 (6%)

Query  12   IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNTV  70
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTD+ RL G  AK   A    N +
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  71   FDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIK  130
            F   R +G    D  V+AD    PF++ + + DKPQ+ V   G+  TF  EE+ +M+L  
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLL--  124

Query  131  MREVAEAFIGKE--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
              E  +A + ++  V++  +TVPA F  +QR+A  DA AIAGL V +++N PTAA +AY 
Sbjct  125  --EHTKAMVDEQLAVRHVTLTVPASFTTTQRRAVLDAAAIAGLTVRKLLNAPTAALVAYM  182

Query  189  L---DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT  245
                 +   +R V+    G G+  V++      +    AT G+ HLGG + D RLV H  
Sbjct  183  ATHPSRMHQDRTVVTVTAGAGSLGVAITIDSNDVSTAVATTGNAHLGGIEIDERLVRHCI  242

Query  246  QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARF  305
              F+R   +D+  + R L+RLRTACE AK  LS++    IE+  L    D    ++R + 
Sbjct  243  AAFERTIGRDVHLSPRGLQRLRTACEDAKIALSTATTTTIEVPRLSGENDLVVCVSRDQL  302

Query  306  EDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKS  365
              +  D   +    V + LR AK+ K+ V  +VL GG  R+P +Q  L D F+G+     
Sbjct  303  NALARDVMTQLTALVVEALRMAKMEKANVDAIVLAGGLGRMPLLQTTLVDLFHGQRVRLI  362

Query  366  INPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
             NP EA+  GAT+      G+  + +         T                + R +T  
Sbjct  363  GNPSEAIVTGATLYTP--DGDVLALQSLPTPFWVATEARHPE---------YLLRGSTEY  411

Query  426  TKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVTF  482
               ++ F T  + Q  + + V+EG       ++L GK+    + P+P+ +P+   + V+F
Sbjct  412  FSTTEDFYTTQNKQSDITLLVYEGLVGQRETSHLQGKWR---VGPLPKSIPRGASVQVSF  468

Query  483  DI-DANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEA---NKV  538
             I DA G L+VSA     GKE  I   N+    ++  + R++ EA   +  D     N  
Sbjct  469  QILDATGTLDVSATVD--GKE--IPTANELAPTTRGRMRRLIEEAATRRRVDGGQVVNAA  524

Query  539  RIEAKNALENYAYSLRNSLNDEKL-KEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYE  597
            R  AK A   Y   LR + + + + + ++ EA +  +DD +   ++WL  + ++   EY 
Sbjct  525  RAAAKAATTEYTMRLREAWHGDAVSRNRVSEATRDELDDALAVALKWLILNPNATIVEYN  584

Query  598  AKQKELEGVANPVLQKVY  615
            A + +LE V + V++ ++
Sbjct  585  AVRFQLEAVGSRVIEGLW  602

>SDRG_01067
Length=611

 Score = 263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 189/617 (31%), Positives = 311/617 (50%), Gaps = 26/617 (4%)

Query  3    QTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
             +++ + V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTDT  L G  AK   
Sbjct  1    MSSNTHCVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYA  59

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEE  122
              +  N V +A +L+GR+ +DPIVQA +   PF+I + +   P I VQ +  + T+ P+E
Sbjct  60   QDHPTNVVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQE  119

Query  123  ISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  182
            I +M+L  +R  AE  +G  + +AV+TVPA +  SQRQA  DA  +AG  V R+++  TA
Sbjct  120  IIAMLLEHVRTSAECHLGSCLDHAVVTVPATYTTSQRQAIVDAATMAGWTVDRLLSATTA  179

Query  183  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVD  242
            AAIA        +R +L+ D G      S+++ E   F   A+A D H+ G   D RL  
Sbjct  180  AAIAQVHATGADKRRLLVVDAGASAVTASVVTAEYDTFTAHASASDMHVSGSAMDARLAA  239

Query  243  HFTQEFKRKHRKDITENQRAL-----RRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFN  297
            +    +    R  I  N  A      +RL +ACE A+  LS++ +  + I  L+   D  
Sbjct  240  YCMSSW----RPSIIGNDFAFSASTKQRLLSACEAARCALSTTNETQLCIPRLYRDEDVA  295

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
             +++R + + +      K +  V KVL+ AK  K  V ++VLVGG   +P +Q  LS+ F
Sbjct  296  LSLSREKLDALVDHLMDKVVVLVRKVLQQAKCVKDDVEDIVLVGGVASMPYLQSTLSNVF  355

Query  358  NGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTL  417
             GK       P  AV  GA +  A  + +  S      +   +         AG    T+
Sbjct  356  CGKTVACLATP--AVVAGAALYVASTTASSDSVVRPIAIHDALLTPIWAA-AAGHHWRTV  412

Query  418  IARNTTVPTKKSQTFSTYADNQPG-VLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVP  476
                  VP        T+  N  G  ++ ++EG+   +  ++L G+++++ +    R   
Sbjct  413  F----NVPVLSGTATHTFQSNGSGPFVLLMYEGDVGFSDSSHLQGRWHIETL----RSTR  464

Query  477  QIDVTFDID-ANGILNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEA  535
             IDV F ID   G+L V+A +KST  +  +++ N     S+ ++  + A+A         
Sbjct  465  FIDVAFVIDEGTGVLRVAAFDKST--QEGLSVVNSDSATSRRKLQHLCAQAMARHHIARQ  522

Query  536  NKVRIEAKNALENYAYSLRNSLN-DEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKE  594
              +   AK A  ++ YSLR++ + DE  + ++ +  +  +DD +   I+WL  + ++  E
Sbjct  523  KVLLARAKAAANDFTYSLRSTWHSDEASRHRVGDPSRDELDDALAAAIKWLLLNPNATIE  582

Query  595  EYEAKQKELEGVANPVL  611
            EY+  + +LE V+  VL
Sbjct  583  EYDDVRVQLETVSRRVL  599

>PYAP_18643
Length=804

 Score = 254 bits (648),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 194/680 (29%), Positives = 313/680 (46%), Gaps = 88/680 (13%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K          + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  130  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQAIAAAANEGVRPAYAVMSCPGFYTDVQRRALLNATKIAGMNCLRLLNEHTAIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  D+G  ++ VS+++  +G  +VKA   D  LGG DFD  L 
Sbjct  184  IYKSARNLFHESEPQHVMFIDMGHASYTVSIVAFVQGKLQVKAATFDRFLGGRDFDYALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                ++F+ KH+ +   + +A  +L  ACE+AK+ LS       Y+ I+ L D  D++  
Sbjct  244  VDVAKQFEEKHKINALNDAKARIKLLAACEKAKKNLSPHGVNATYVNIECLADEKDYSGQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  358
            +T   FE++      +  +P+++ L+DA + KSQ+  V +VGG+TR+  V++ LSD    
Sbjct  304  VTLEHFEELIAPLLNRLEDPIQRALKDAGIDKSQLASVEIVGGATRVSSVKRRLSDILGL  363

Query  359  GKEP-----NKSINPDEAVAYGATVQAAILS------------------------GNdss  389
             KE      + ++N DE+VA G  +Q AILS                        GN   
Sbjct  364  DKEAQNYGLSTTLNADESVARGCALQCAILSPVFKVKEFHIADKVHLPVRVTWEDGN---  420

Query  390  eklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG  449
                 +   D     + +E AG     +  R    P  K  TF   A       I     
Sbjct  421  -ASAPMDTADDNDEDVNMEAAGDSTIVIFDRKDDYPKTKRITFRRDA----AFSIDAAYD  475

Query  450  ERS---MTRDNNL-LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE-------  496
            E +   +  D  L LGK+ + G+P   +G  VP+I V    D NGI +V++ +       
Sbjct  476  ETAQPYLPPDYVLNLGKYTISGLPAGEKGAEVPKIRVNVSQDINGIFSVASSQLMQEIKE  535

Query  497  ------------------------KSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSE  532
                                    K   ++ ++ +  +   LS  EI     +      +
Sbjct  536  EEKPAEEAKEGEAKEAEEKPAEPKKKRFRKVELKVEANVPGLSPTEITSATEQELAMAHQ  595

Query  533  DEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQS  590
            D   +     +N LE++ Y +R  + D +L E I   +K  ++DK+ E   WL  D    
Sbjct  596  DRVIEETFNKRNELESFVYDMRAQVTD-RLAEYISSDEKNALEDKLNEVEDWLYSDEGFD  654

Query  591  SEKEEYEAKQKELEGVANPV  610
            S K  Y++K  E+  + +PV
Sbjct  655  STKSVYQSKLDEMRKITSPV  674

>PHYSO_249932
Length=232

 Score = 237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 154/212 (73%), Gaps = 13/212 (6%)

Query  150  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  209
            +P +FN SQRQA K+AGA+AGLNV+R I   TAA+I YG +K G  R +L+FD+GG   D
Sbjct  2    MPLHFNQSQRQAIKNAGALAGLNVVRSIAGSTAASIGYGFEKTG-LRAILVFDMGGSALD  60

Query  210  VSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTA  269
            +SL++I++ I+EV AT G  HLGG              FKR H KD+  N RA+ RLR+A
Sbjct  61   LSLVTIDDDIYEVLATLGVPHLGGV------------PFKRTHGKDLRTNSRAMVRLRSA  108

Query  270  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKL  329
            CE+AKR +S+S +A IE++SL++GID NSTI+R RF D+C D F K +  V KVLRDAK 
Sbjct  109  CEQAKRAVSTSTEAQIELESLYEGIDLNSTISRPRFNDLCADLFDKALGAVSKVLRDAKK  168

Query  330  SKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            SK++V E+VLVGGS RIP++QQLL DFFNGK+
Sbjct  169  SKTRVDEIVLVGGSPRIPRMQQLLEDFFNGKK  200

>PYVX_13288
Length=810

 Score = 253 bits (647),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 192/679 (28%), Positives = 316/679 (47%), Gaps = 84/679 (12%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +     A     I +Q+  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYAVLSCPGFYTDVQRRAVLNASKIAGVNCLRLLNEHTAVALAYG  183

Query  189  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN         V+  D+G  ++ VS+++  +G  +VKA A D  LGG DFD  
Sbjct  184  IYKSA--RNLFHESEPQYVMFIDIGHASYTVSIIAFVQGKLQVKAAAYDRFLGGRDFDMA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  297
            +      +F  K++ D   N ++  +L +ACE++K+ LS       ++ I+ L D  D++
Sbjct  242  IAKDAAAQFSAKYKTDPLANPKSRIKLLSACEKSKKNLSPYGVTATHLNIECLADDRDYS  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            + IT  +FE+M      +   P+E  L+DA + KSQ+  V ++GG TR+  V++ LS+  
Sbjct  302  AQITLEQFEEMIAPLLARLDAPIESALKDAGIDKSQLANVEIIGGGTRVASVKRHLSEVL  361

Query  358  N-GKEP-----NKSINPDEAVAYGATVQAAILSGNdsse------------------klq  393
               KE      + ++N DE+VA G  +Q AILS     +                     
Sbjct  362  GLDKEAQNYGLSTTLNADESVARGCALQCAILSPMFKVKEFSITDAVHLPIRVSWDGAAS  421

Query  394  dlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSM  453
                       + +E +      +  R    P  K  TF     +Q   +  V++   + 
Sbjct  422  APTDAAENDEDVNMEASSDSSIVIFHRKDEYPKTKRITFRR---DQSFAIDAVYDESATP  478

Query  454  TRDNNLL---GKFNLDGIPPMPRG--VPQIDVTFDIDANGILNV----------------  492
                + L   GKF + G+P + +   +P+I V    D NG+ +V                
Sbjct  479  YLPPDYLMSIGKFTVSGLPSLAKDAELPKIRVNVTQDINGLFSVASSQLMQEVKEEEKPA  538

Query  493  -------------SAVEKSTGKENK------ITITNDKGRLSQAEIDRMVAEAEKYKSED  533
                         +A +KS   + K      + +T + G L+ +++     +  K   +D
Sbjct  539  EEEAKEGAEGDAKAAEDKSEQPKKKRFRKIELQVTAEVGGLTTSDVAAATEQELKMAQQD  598

Query  534  EANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSS  591
               +     +N LE++ Y +RN ++D +L   I  ++K  +++K+ E   WL  D    S
Sbjct  599  RVIEETFNKRNELESFVYEMRNHVSD-RLANFITSSEKATLEEKLLEAEDWLYTDEGFDS  657

Query  592  EKEEYEAKQKELEGVANPV  610
             K  Y+ K  +L  ++NPV
Sbjct  658  TKSVYQTKLDDLRKLSNPV  676

>HYAP_06818
Length=316

 Score = 240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 194/300 (65%), Gaps = 14/300 (5%)

Query  317  MEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            M P +K ++DA L KS+++EV+LVGG +R+PKVQ  +  FF GK+P+K +NPDE VA GA
Sbjct  1    MGPCKKCVKDAGLEKSEINEVILVGGMSRMPKVQTTVEAFF-GKKPSKGVNPDEVVAMGA  59

Query  377  TVQAAILSGNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYA  436
             +Q  +L G+     L D+  L +       ET GGV T LI RNTT+PTKKSQ FST A
Sbjct  60   AIQGGVLRGDVKDILLLDVTPLSLGI-----ETLGGVFTKLIPRNTTIPTKKSQVFSTAA  114

Query  437  DNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVE  496
            D+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI+NV A +
Sbjct  115  DSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGIVNVGARD  174

Query  497  KSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNS  556
            K+TGKE  I I +  G LS AEI++MVA+AE     D+  K  IEAKN  ++  Y+   +
Sbjct  175  KATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAVADQQRKELIEAKNEADSVLYTTEKT  233

Query  557  LNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEK-EEYEAKQKELEGVANPVLQKVY  615
            L  E+ KEKI +AD     +KV   +  L     SE  EE +A  KE++ +A  + + VY
Sbjct  234  L--EEHKEKI-DADTL---EKVKVALSDLRQKSESENTEEIKAALKEVQEMAMKIGEAVY  287

>SPRG_06720
Length=425

 Score = 243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 146/391 (37%), Positives = 210/391 (54%), Gaps = 23/391 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  66
            +SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  31   HSVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  90

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGE-SKTFQPEEISS  125
             +T+F+AKR IGR F   +   +  H+ F +      +    +   G  ++   P ++ +
Sbjct  91   RHTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGA  150

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++ +++  A  ++G  ++ +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA
Sbjct  151  HIVSQLKTSAMRYLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  210

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  211  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  270

Query  245  TQEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  287
               F+             L R             +R   E+ KR L    S++A   IE 
Sbjct  271  VARFEELLATPALPPLSTLARTSDESAFPCTVSGMRGVAEKLKRDLSALPSAAASCVIEA  330

Query  288  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             +        +T+  TR  +E +      +T+ P+  +L    ++ + + EVVLVGGS+R
Sbjct  331  STAQHAAGSLATVEMTRQEWEALVAPMLSRTLTPIHDMLDGNGMAPTDIDEVVLVGGSSR  390

Query  346  IPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            IP +Q  L+  F G+EPN  I+PD AVA GA
Sbjct  391  IPWIQHALAALF-GREPNAHIDPDVAVAVGA  420

>PHALS_09281
Length=465

 Score = 240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 147/397 (37%), Positives = 217/397 (55%), Gaps = 32/397 (8%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+    ++ 
Sbjct  68   HVVGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREARTHRTIDP  127

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFK-----ISSGAGDKPQITVQFKGESKTFQPE  121
             +T+F+AKR IG+ + D +++++    P++     +     D     +      +   P 
Sbjct  128  QHTIFNAKRFIGQSYDD-VIKSENGTMPYEFNIKPLQRNEYDGICFALNLPNHPECVTPV  186

Query  122  EISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EI + ++  +  +A  ++G  +V  AV+ VP  FN+ QR ATK A   AGL V R++ EP
Sbjct  187  EIGTAIVRHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAAFRAAGLEVSRVLEEP  246

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D RL
Sbjct  247  TAAAIAYGLHQDQNINFMLVFDFGGGTLDVSLLFARNGAITVVDTLGDNHLGGEDLDARL  306

Query  241  VDHFTQEFKRKHRKDI------TENQRALRR----------LRTACERAKRTLS-----S  279
                   F+ + +K I      TE +R L+           +R A E  KR L+     +
Sbjct  307  SAWLLMRFESQLKKKISTHNTKTEGKRVLKDRPEPPCTMAGVRQAAELLKRQLTNLSVVT  366

Query  280  SAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
            +A  + E D   + I     +TR +FE++C     +TM PV  +L    +   ++  VVL
Sbjct  367  AACVWNEGD---ESIQIEVDVTRLQFEELCKPLLERTMIPVRDILAANNIGTEEIDAVVL  423

Query  340  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            VGGS+RIP V+Q L++ F+G+ P  +I+PD AVAYGA
Sbjct  424  VGGSSRIPWVRQRLTEMFHGRAPLSNIDPDLAVAYGA  460

>SDRG_16559
Length=461

 Score = 239 bits (611),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 148/391 (38%), Positives = 213/391 (54%), Gaps = 24/391 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  66
            +SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + + 
Sbjct  68   HSVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDP  127

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGES-KTFQPEEISS  125
             +T+F+AKR IGR F D  V+ +  H+ F +     ++    +   G + +   P ++ +
Sbjct  128  RHTIFNAKRFIGRAF-DAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGA  186

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++ +++  A   +G  ++ +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA
Sbjct  187  HIVSQLKASAMRHLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAA  246

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGLD+K     VL+FD GGGT DVSLL ++ G FEV  TAGD HLGGED D+ L  H 
Sbjct  247  LAYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVIDTAGDNHLGGEDLDDVLATHL  306

Query  245  TQEFKRKHRKDITENQRALRR-------------LRTACERAKRTL----SSSAQAYIEI  287
               F+            +L R             +R   E+ KR L    S++A   +E 
Sbjct  307  VARFEALLATPALPALSSLARTSDASAFPCTVSGMRGVAEKLKRDLSATPSAAASCVVEA  366

Query  288  DSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             +        +T+  TR  +E +      +T+ P+ ++L    ++ S V EVVLVGGS+R
Sbjct  367  ATPQHAAGDLATLEMTRVEWEALVAPLLSRTLSPIHEMLSGNGMAPSDVDEVVLVGGSSR  426

Query  346  IPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            IP +Q+ L   F G+EPN  I+PD AVA GA
Sbjct  427  IPWIQEALGALF-GREPNAHIDPDVAVAVGA  456

>CCA15913
Length=857

 Score = 247 bits (631),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 192/693 (28%), Positives = 318/693 (46%), Gaps = 105/693 (15%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQA+I    FK    A     I +++     TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  130  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  163  KMQIIATSANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  222

Query  189  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN         V+  D+G  ++ V+++S   G  +V++ A D  LGG DFD  
Sbjct  223  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVSFVLGKLQVRSVAFDRFLGGRDFDYA  280

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  297
            L     + F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  281  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  340

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L+D  
Sbjct  341  SQITLEHFEELIAPLLDRLEAPITQALNDAGIEKSQLSNVEVVGGGTRVASVKRRLADIL  400

Query  358  NGKEP------NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  411
            +  +       + ++N DE+VA G  +Q AILS      K   +      P+ +  ET+ 
Sbjct  401  SLDKSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYYPVRVSWETSA  459

Query  412  GVMTTLIARNTTVPTK---------------KSQTFSTYADNQPGVLIQVFEGERSMTRD  456
             V         +VP +                S    T+AD  P      F  E S + D
Sbjct  460  DV---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRREDSFSVD  510

Query  457  NNL---------------LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  496
                              +GKF + G+P + +G  +P+I V    D NG++ +S+ +   
Sbjct  511  AKYDESAKALLPPDYDLGIGKFTISGLPEIEKGGEIPKIRVNIQHDLNGLVGISSSQLMQ  570

Query  497  -------------------------------------KSTGKENKITITNDKGRLSQAEI  519
                                                 K   ++ ++ I  +   L+ +E+
Sbjct  571  ELKEEKPADEAKETQENEENKEKKEGGKADEKAPEPKKKRFRKVELKIEAETKGLNVSEV  630

Query  520  DRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVT  579
            ++      +   +D   +     +N LE++ Y +RN ++D +L++ I E +K  ++  + 
Sbjct  631  NKATEIELEMAHQDRVIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKSKLESSLA  689

Query  580  ETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
            E  +WL  D    S K  Y+ K   L  ++ P+
Sbjct  690  EVEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  722

>PHALS_04095
Length=803

 Score = 246 bits (628),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 192/674 (28%), Positives = 312/674 (46%), Gaps = 77/674 (11%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +     A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIASAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ D   N ++  +L +ACE+AK+ LS        + I+ L D  D+N+ 
Sbjct  244  KDVAAKFAEKYKTDPLGNPKSRIKLLSACEKAKKNLSPYGVTATNLNIECLADDRDYNAQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +T   FE++      +  +PVE+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  LTLEEFEELIAPLLLRLNDPVERALADAGIDKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  360  KEPNK------SINPDEAVAYGATVQAAILSGNdsseklqdlll-----------ldvtp  402
             +  +      ++N DE+VA G  +  AILS     ++                      
Sbjct  364  DKEQQNFGLSTTLNADESVARGCALNCAILSPMFKVKEFSVTDCVHLPVRVSWDGSAAAG  423

Query  403  lslglETAGGV-MTT------LIARNTTVPTKKSQTFSTYADNQPGVLIQVFE--GERSM  453
                 E  G V M T      + +R    P  K  TF     ++P  +  +++   +  +
Sbjct  424  TPSAAEEDGDVNMETEDSSLVIFSRKDEYPKTKRITFRR---DKPFSIDAMYDESAKSYL  480

Query  454  TRDNNL-LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSA----------------  494
              D ++ +GK+ + G+P    G  +P+I V    D NG+ +VS+                
Sbjct  481  PPDYDMDIGKYTISGMPSQEAGTEIPKIRVNVQQDMNGLFSVSSSQLMQEILEEEKPAVA  540

Query  495  --VEKSTGKENKITITNDKGRLSQAEIDRMVA-------------EAE-KYKSEDEANKV  538
               E    K++   +   K R  + E+    A             E E K   +D   + 
Sbjct  541  DGAEVEGEKKDDKPVEPKKKRFRKVELSVHAAVSGLSAGDVAAATEQELKMAQQDRVIEE  600

Query  539  RIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEY  596
                +N LE++ Y +RN + D KL   I   +K  ++ K+TET  WL  D    S K  Y
Sbjct  601  TFNKRNELESFVYEMRNQITD-KLAGFITSGEKSNLESKLTETEDWLYTDEGFDSTKSVY  659

Query  597  EAKQKELEGVANPV  610
            + K  ++  +++PV
Sbjct  660  QQKLDDMRKLSSPV  673

>SPRG_10476
Length=270

 Score = 231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 186/276 (67%), Gaps = 10/276 (4%)

Query  329  LSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNds  388
            +  +++ E+VLVGGSTRIPKVQ +LS  F GKE +KSINPDEAVAYGA VQ AILSG   
Sbjct  1    MKPNEITELVLVGGSTRIPKVQNMLSAVFGGKELSKSINPDEAVAYGAAVQGAILSG-IR  59

Query  389  seklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFE  448
            ++    LLL+DVTPLSLG+ET G VM+ LI RNT +P KK++ ++T +D Q  V + ++E
Sbjct  60   NDATNSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPVKKTRVYTTESDYQTQVNVVIYE  119

Query  449  GERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  508
            GER+    NN LG+F + GI    RG PQ++VTF+IDANGILNVSA +K T  + + TI+
Sbjct  120  GERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDANGILNVSARDKKTNAKAETTIS  179

Query  509  NDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPE  568
            N+ GRLSQA+IDRMV EAEK+K ED     +IEA+N+LE + Y         +  E   E
Sbjct  180  NNHGRLSQADIDRMVEEAEKFKKEDAEALKKIEARNSLEGFIY---------RALELTRE  230

Query  569  ADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELE  604
                  ++ + E  +WL+ H+ +   E E K++ LE
Sbjct  231  KGDAAAENTIREAREWLEDHEDATLRELEEKKRVLE  266

>H257_04453
Length=423

 Score = 236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 147/389 (38%), Positives = 215/389 (55%), Gaps = 22/389 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDP  91

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQIT--VQFKGESKTFQPEEIS  124
             +T+ +AKR IGRKF D  ++AD   + F +         +   +   G      P +I 
Sbjct  92   KHTISNAKRFIGRKF-DATIEADASLYDFPLLGNTTGDHHVCFGLSVPGHPSCVSPVDIG  150

Query  125  SMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  183
              V+  ++E A A++G  ++  AVI +PA F+ +QR+AT  A   AGL V  ++ EPTAA
Sbjct  151  YFVVKTLKETAMAYLGHDQIYGAVIAIPAGFDANQRKATVAAFERAGLKVRNVLVEPTAA  210

Query  184  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDH  243
            A+AYGL  K    NVL+FD GGGT DVSLL +++G F+V  TAGD HLGGED D++L  H
Sbjct  211  ALAYGLHTKPNVHNVLVFDFGGGTLDVSLLYLQKGSFQVMDTAGDNHLGGEDLDDQLSGH  270

Query  244  FTQEFKR----KHRKDITENQR------ALRRLRTACERAKRTLS------SSAQAYIEI  287
               +F++        D+  +            +R   E+ KR LS      +S      +
Sbjct  271  LKHQFEQLVGGHSLPDLQTSDEPNVFPCTAAGIRGVAEQLKRQLSFDVEGEASCVVQEAV  330

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             S+  G      +TR+ +E +C    ++TM PV++VL    ++   + EVVLVGGS+RIP
Sbjct  331  GSVAVGDVLRLRMTRSEWEALCLPTLQRTMAPVKEVLEGNMMTTDDIDEVVLVGGSSRIP  390

Query  348  KVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
             +Q  L+  F G+EPN  I+PD AVA GA
Sbjct  391  WIQAQLAQMF-GREPNSHIDPDVAVAVGA  418

>PYAR_15468
Length=769

 Score = 244 bits (624),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 187/656 (29%), Positives = 308/656 (47%), Gaps = 74/656 (11%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    +  NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    F           + +++  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVRPAYAVLSCPGFYTDVQRRALLNAAKIAGVNCLRLLNEHTAVALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  L 
Sbjct  184  IYKSARNLFAESEPQHVMFIDMGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
            +    +F+ K++ +  ++ +A  +L + CE+AK+ LS       ++ ++SL +  D++  
Sbjct  244  EDVAAQFEAKYKVNPLKDAKARIKLLSGCEKAKKNLSPHGVTATFLNVESLAEDRDYSGQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +T  RFE++      +   P+++ L DA + K+Q+  V +VGG+TR+     +LS  F  
Sbjct  304  VTLERFEELIAPLLNRLEGPIQRALADAGIDKAQLASVEIVGGATRVSSC-AILSPVFKV  362

Query  360  KE---PNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAGGVMTT  416
            KE    +K+  P        +      +G+                  + +E AG   T 
Sbjct  363  KEFHIADKTHFPVRVSWENGSANTTDAAGD-------------NDEEDVNMEAAGSDSTL  409

Query  417  LIA-RNTTVPTKKSQTFSTYADNQPGVLIQVFEGERS---MTRDNNL-LGKFNLDGIPPM  471
            +I  R    P  K  TF   A       I     E +   +  D +L LGK+ + GIP  
Sbjct  410  VIFDRKDEYPKTKRITFRRDA----AFAIDAAYDETATPFLPADYSLALGKYTISGIPKT  465

Query  472  PRGVPQIDVTFDIDANGILNVSAVE----------------------KSTGKENK-----  504
               +P+I V    D NGI +V++ +                      K    E+K     
Sbjct  466  GDEIPKIRVNVQQDLNGIFSVASSQLMQEIKEEEKSAEEAKEGADEAKDKAAEDKPAEPK  525

Query  505  --------ITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNS  556
                    + +  D   LS  EI     +      +D   +     +N LE++ Y +RN 
Sbjct  526  KKRFRKVELKVDADVPGLSPQEISSATEQELAMAHQDRVIEETFNKRNELESFVYDMRNH  585

Query  557  LNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
            +  E+L E I E++K  ++DK+TE   WL  D    S K  Y+ K  EL  +++PV
Sbjct  586  IT-ERLAEYISESEKASLEDKLTEAEDWLYSDEGFDSTKSVYQGKLDELRKLSSPV  640

>PHYRA_53570
Length=395

 Score = 234 bits (598),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 151/395 (38%), Positives = 210/395 (53%), Gaps = 29/395 (7%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNAHN  68
            VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     +  +
Sbjct  1    VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  69   TVFDAKRLIGRKFSDPIVQAD-----IKHWPFKISSGAGD---KPQITVQFKGESKTFQP  120
            T+F+AKR IGRK+ D +V+++     I  + F +    G+       ++    +     P
Sbjct  61   TIFNAKRFIGRKY-DEVVRSEADSNGITPYEFVVKPAQGNVHGGVCFSLDLPEQPDCVTP  119

Query  121  EEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  179
             +I S V+  +R +A  F+G  ++  AVI VP  F+  QR AT  A   AGL V R++ E
Sbjct  120  VQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVEFDAQQRDATVAAFREAGLEVSRVLEE  179

Query  180  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            PTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D  
Sbjct  180  PTAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAL  239

Query  240  LVDHFTQEFKRKHRKDIT------------ENQRA----LRRLRTACERAKRTLS--SSA  281
            L D   ++F+ +    IT            E+  A    L  +R A E  KR L+  S+A
Sbjct  240  LADWLAKQFEAQLGTPITSRGTEANVKNFDEDGMAPPCTLAGVRHAAELLKRQLTDFSTA  299

Query  282  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  341
             A          +      TR +FE +CG    +TM PV ++L    +   ++  VVLVG
Sbjct  300  SAACVWRKGTKVVRAEVKTTRTQFEALCGSLLERTMVPVREILEANNMETEEIDAVVLVG  359

Query  342  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            GS+R+P V+Q L++ F G+ P  +I+PD AVAYGA
Sbjct  360  GSSRVPWVRQHLTEMFQGRAPLSNIDPDLAVAYGA  394

>CCI46709
Length=819

 Score = 243 bits (621),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 189/693 (27%), Positives = 317/693 (46%), Gaps = 105/693 (15%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQA+I    F+    A     I +++     TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  130  KMREVA-EAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQIIATTANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  183

Query  189  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN         V+  D+G  ++ V++++   G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVAFVLGKLQVKSVAFDRFLGGRDFDYA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  297
            L     + F+ KH+ D  +  ++  +L +ACE++K+ LS    A  ++ I+ L +  D++
Sbjct  242  LAKDAAKNFQEKHKIDPLKEPKSRMKLLSACEKSKKNLSPHGVASTFMNIECLAEEYDYS  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            S IT   FE++      +   P+ + L DA + KSQ+  V +VGG TR+  V++ L+D  
Sbjct  302  SQITLDHFEELIAPLLDRLEAPINQALNDAGIIKSQLSNVEIVGGGTRVASVKRRLADIL  361

Query  358  NGKEP------NKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETAG  411
            +          + ++N DE+VA G  +Q AILS      K   +      P+ +  ET+ 
Sbjct  362  SLDNSAQNYGLSTTLNADESVARGCALQCAILSP-LFKVKEFSIADRVYFPVRVSWETSA  420

Query  412  GVMTTLIARNTTVPTK---------------KSQTFSTYADNQPGVLIQVFEGERSMTRD  456
             +         +VP +                S    T+AD  P      F  + S + D
Sbjct  421  DI---------SVPMETGDDNEDGDLGNDGANSIVIFTHADEYPKTKRITFRRDNSFSID  471

Query  457  NNL---------------LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---  496
                              +GKF + G P + +G  +P+I V    D NG++ +++ +   
Sbjct  472  AKYDESAKALLPPDYDLAIGKFTVSGFPELEKGGEIPKIRVNIQHDLNGLVGIASSQLMQ  531

Query  497  -------------------------------------KSTGKENKITITNDKGRLSQAEI  519
                                                 K   ++ ++ I ++   L+ AE+
Sbjct  532  ELKEEKPVEEPKEAQESDEKKEKKEGEQAEEKASEPKKKRFRKVELKIESEIKGLNVAEV  591

Query  520  DRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVT  579
            ++      +   +D   +     +N LE++ Y +RN ++D +L++ I E +K  ++  + 
Sbjct  592  NKATETELEMAHQDRIIEETCNKRNELESFVYEMRNQISD-RLRDFITEEEKAKLESSLA  650

Query  580  ETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
            E  +WL  D    S K  Y+ K   L  ++ P+
Sbjct  651  EAEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  683

>PYIR_21692
Length=468

 Score = 235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 149/404 (37%), Positives = 217/404 (54%), Gaps = 30/404 (7%)

Query  3    QTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ  61
            Q T    VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+  
Sbjct  60   QCTYMALVGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAH  119

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFK----GESKT  117
               +  +T+F+AKR IGR + D     D + + + ++  +  +P+  V F+    G  K 
Sbjct  120  RTKDPEHTIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKC  179

Query  118  FQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  176
              P  + S ++  +R +A +F+G  ++  AVI VP  F+  QR AT+ A A AGL V RI
Sbjct  180  VTPVSVGSAIVRHLRAMAHSFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRI  239

Query  177  INEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDF  236
            + EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED 
Sbjct  240  LEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDI  299

Query  237  DNRLVDHFTQEFKRK-------HRKDITENQRALRR-----------LRTACERAKRTLS  278
            D+++ +  T+    +          D+ E    L             +R A E  KRTLS
Sbjct  300  DSQVAELLTEAIAARIGTTLTSMASDMEETDSELHEDPGQLPCTPAGIRRAAELLKRTLS  359

Query  279  SSAQAYIEIDSLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKS  332
            S             G    S       +TRA+FED+CG+  ++T+ PV++++    ++  
Sbjct  360  SEGSGSASCIVQRSGTLLQSAEKVTIDMTRAQFEDICGEILKRTLTPVQEIISANHMTPE  419

Query  333  QVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            ++  VVLVGGS+RIP V++ L++ F+G+ P   I+PD AVAYGA
Sbjct  420  EIDAVVLVGGSSRIPWVREHLAELFDGRAPLSDIDPDIAVAYGA  463

>H310_12260
Length=424

 Score = 234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 148/391 (38%), Positives = 213/391 (54%), Gaps = 25/391 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++ 
Sbjct  32   HLVGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDP  91

Query  67   HNTVFDAKRLIGRKFSDPIV-QADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
             +T+ +AKR IGR+F + I  +A +  +P   ++         +   G      P +I  
Sbjct  92   KHTISNAKRFIGRQFDESIAAEAALYDFPLLANTTGDSHVCFGLNLPGHPSCISPVDIGY  151

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             V+  ++E A AF+G  ++  AVI +PA F+ SQR+AT  A   AGL V  ++ EPTAAA
Sbjct  152  YVVKALKETAMAFLGHDQIYGAVIAIPAGFDASQRKATVAAFERAGLKVRNVLVEPTAAA  211

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            +AYGL  K     VL+FD GGGT DVSLL ++ G F+V  TAGD HLGGED D+ L  H 
Sbjct  212  LAYGLHTKPNVHYVLVFDFGGGTLDVSLLYLQNGSFQVMDTAGDNHLGGEDLDDLLSAHL  271

Query  245  TQEFKR-------------KHRKDITENQRALRRLRTACERAKRTLS------SSAQAYI  285
              EF++                 D+     A   +R   E+ KR LS      +S     
Sbjct  272  KHEFEQVVGGHSLPDVQTSGDMPDVFPCTAA--GVRGVAEQLKRRLSFANDGEASCVVQQ  329

Query  286  EIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTR  345
             +     G      +TRA +E++C    ++TMEPV++VL    ++   V EVVLVGGS+R
Sbjct  330  AVGEYVVGDTLRLRMTRAEWEELCLPTLQRTMEPVKEVLVGNMMTAGDVDEVVLVGGSSR  389

Query  346  IPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            IP +Q  L++ F G+ PN  I+PD AVA GA
Sbjct  390  IPWIQGQLTEMF-GRAPNGHIDPDVAVAVGA  419

>PPTG_09003
Length=449

 Score = 234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 151/396 (38%), Positives = 204/396 (52%), Gaps = 27/396 (7%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V + Q + V  I + +G    PS VAF      L+G  A+    ++ 
Sbjct  49   HVVGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHRTLDP  108

Query  67   HNTVFDAKRLIGRKFSDPIV-QAD---IKHWPFKI---SSGAGDKPQITVQFKGESKTFQ  119
             +TVF+AKR IG+ + D +  +AD   +  + F +        D    T+   G+     
Sbjct  109  QHTVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQPGCVT  168

Query  120  PEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P EI + V+  +R +A  F+G  ++  AVI VP  FN  QR AT  A   AGL V R++ 
Sbjct  169  PVEIGTAVVRHLRSMAHNFVGHDQITKAVIAVPVDFNARQRDATVAAFRAAGLEVSRVLE  228

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  229  EPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  288

Query  239  RLVDHFTQEFKRKHRKDIT----------------ENQRALRRLRTACERAKRTLS--SS  280
            RL     ++F+ +    IT                E    +  +R A E  KR L+  S 
Sbjct  289  RLSAWLLKQFEAQLGAAITSRGSESEGKVSENGSNEPPCTMAGVRQAAELVKRQLTDVSV  348

Query  281  AQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLV  340
              A          +    T+TRA+FE++C     +TM PV  VL    +   ++  VVLV
Sbjct  349  TTAACISSGNKKPVRVEVTVTRAQFEELCDSLLERTMIPVRDVLESNNMDTDEIDAVVLV  408

Query  341  GGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            GGS+RIP V+Q L+D F G+ P   I+PD AVAYGA
Sbjct  409  GGSSRIPWVRQRLTDMFQGRPPLSDIDPDLAVAYGA  444

>PHYCA_120845
Length=444

 Score = 234 bits (596),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 207/392 (53%), Gaps = 25/392 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+     + 
Sbjct  50   HVVGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHRTTDP  109

Query  67   HNTVFDAKRLIGRKF--SDPIVQADIKHWPFKISSGAGDKPQ---ITVQFKGESKTFQPE  121
             +T+F+AKR IG+ +  +    +  +  + F +     D+      ++  +G+     P 
Sbjct  110  QHTIFNAKRFIGQSYVMTSETNEKGVTPYEFVVKQMHRDEHDGICFSLSLQGQPDCVTPV  169

Query  122  EISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            +I + V+  +R +A  F+G  ++  AVI VP  FN  QR+AT  A   AGL V R++ EP
Sbjct  170  QIGTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAFRGAGLEVSRVLEEP  229

Query  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            TAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D +L
Sbjct  230  TAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDAQL  289

Query  241  VDHFTQEFKRKHRKDITENQRA----------------LRRLRTACERAKRTLSSSAQAY  284
                  EF+ +    IT                     L  +R A E  KR L+ ++ A 
Sbjct  290  TAWLVGEFEAQLGTAITSRGTGDEVKTFDNDGKDPPCTLSGVRHAAELVKRQLTDASTAT  349

Query  285  IEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGST  344
                S  +G      ITR +FE++CG    +TM PV +VL    +   ++  VVLVGGS+
Sbjct  350  AACISGNEGAKVE--ITRTQFEELCGSLLERTMVPVREVLEANNMESDEIDAVVLVGGSS  407

Query  345  RIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            RIP V++ L+D F G+ P   I+PD AVAYGA
Sbjct  408  RIPWVRRRLTDMFQGRAPLSDIDPDLAVAYGA  439

>PITG_17383
Length=438

 Score = 231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 152/398 (38%), Positives = 204/398 (51%), Gaps = 29/398 (7%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNA  66
            + VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  +   L+G  A+     + 
Sbjct  36   HVVGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHRTTDP  95

Query  67   HNTVFDAKRLIGRKFSDPIV-QADIKHW-PFKIS-----SGAGDKPQITVQFKGESKTFQ  119
             +T+F+AKR IG+ + D +  +AD     P++ S         D    T+  +   K   
Sbjct  96   QHTIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHPKCVT  155

Query  120  PEEISSMVLIKMREVAEAFIGKE-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P  I + V+  +R +A  F+G E +  AVI VP  FN+ QR AT  A   AGL V R++ 
Sbjct  156  PVNIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQRDATVAAFRAAGLAVSRVLE  215

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D 
Sbjct  216  EPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAISVLDTLGDNHLGGEDLDA  275

Query  239  RLVDHFTQEFKRKHRKDIT------------------ENQRALRRLRTACERAKRTLS--  278
            RL     +EF+      IT                  E    +  +R A E  KR L+  
Sbjct  276  RLSAWLLKEFEAHLGTAITSRGAETETKATSVDNDSKEPPCTVAGVRQAAELLKRQLTDA  335

Query  279  SSAQAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVV  338
            S A A    +     +      TR +FE +CG    +T+ PV +VL    +   ++  VV
Sbjct  336  SVATAACIWNDGKKTVRVEVRATRVQFEKLCGSLLERTIIPVREVLEANNMDTDEIDAVV  395

Query  339  LVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            LVGGS+RIP V+Q L+D F G+ P   I+PD AVAYGA
Sbjct  396  LVGGSSRIPWVRQRLTDMFEGRPPLSDIDPDLAVAYGA  433

>PYIW_19956
Length=459

 Score = 229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/394 (37%), Positives = 208/394 (53%), Gaps = 25/394 (6%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            + VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+     +  
Sbjct  61   HVVGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARAHRTRDPK  120

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMV  127
            +T+F+AKR IGR + D +   D   + + ++          +   G  K   P  I S +
Sbjct  121  HTIFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSVAGHPKCVTPVAIGSAI  180

Query  128  LIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            +  +R +A  F+G  ++  AVI VP  F+  QR AT+ A A AGL V R+++EPTAAAIA
Sbjct  181  VSHLRAMAHRFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRVLDEPTAAAIA  240

Query  187  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFT-  245
            YGL +      +L+FD GGGT DVSLL    G   V  T GD HLGGED D+++    T 
Sbjct  241  YGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVVDTIGDNHLGGEDIDSQVAAFLTE  300

Query  246  -----------------QEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  288
                             +E   +H +D  +       +R A E  KRTLSS + +     
Sbjct  301  AIAARIGTTLTSMASDMEESDSEHNEDPEQLPCTPAGIRRAAELLKRTLSSHSASSASCV  360

Query  289  SLFDGIDFNST------ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGG  342
                G    S       +TRA+FE+MC +   +T+ PV++++    ++  ++  VVLVGG
Sbjct  361  VQHSGTLLQSGEKVTIDVTRAQFEEMCAEILGRTLVPVQEIISANHMTPEEIDAVVLVGG  420

Query  343  STRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            S+RIP V+  L+  FNG+ P   I+PD AVAYGA
Sbjct  421  SSRIPWVRSNLATMFNGRAPLSDIDPDVAVAYGA  454

>PYIW_14231
Length=1243

 Score = 239 bits (611),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 181/571 (32%), Positives = 296/571 (52%), Gaps = 64/571 (11%)

Query  8    YSVGIDLG-----TTYSCVGVWQNDRVEII-ANDQGNRTTPSYVAFTDTERLIGDAAKNQ  61
            + +GID+G     TT S  GV  +  +E    +D      P+YV+ TD++ ++G  A+ +
Sbjct  12   WCIGIDIGAHFFSTTVSKDGVAVDVPLEEHEQDDTKTHLLPAYVSVTDSDFIVGSEARKR  71

Query  62   VAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKT----  117
                  NT+FD  R++GRK SD +   D+  WPFK+  G  DK  + ++      T    
Sbjct  72   AKSGDSNTIFDFVRIVGRKISD-LNAGDLSKWPFKVVPGDNDKAVVEIRTSTNGSTASVS  130

Query  118  ---FQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVL  174
               F PEE+ ++++  ++E  E  +G  V +AV+ VP  FN +Q +A ++A  IAGL   
Sbjct  131  FRMFHPEELLAVLVRCIKEKVEMMLGAVVDSAVVCVPGGFNHTQCRAVRNAFTIAGLRTE  190

Query  175  RIINEPTAAAIAYGLDKKGGERN-----VLIFDLGGGTFDVSLLSIEEGIFEVKATAGDT  229
            +++   TA AI++GLD +    N     VL+ D+G  T D++L+S+    FEVKA   D 
Sbjct  191  KLLGAATATAISFGLDIRTDIANAAMQLVLVVDIGASTTDIALVSVLANKFEVKAVDSDL  250

Query  230  HLGGEDFDNRLVDHF----TQEFKRKHRKDITENQ---RALRRLRTACERAKRTLSSSAQ  282
             LGG+DF +R+  H     TQE        +   Q   + + ++R ACE AK+ LSSS  
Sbjct  251  GLGGDDFTDRIAAHCHRKKTQEVTPSGENAVANTQGYVKGVHQIRHACELAKKLLSSSLT  310

Query  283  AYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVH  335
            A +       GIDF +       T+TR  FE +C D ++  +E V +V++++  SK  + 
Sbjct  311  AVV-------GIDFPTSDTFGYYTVTRTGFEALCMDPWQHALERVHRVIQESSASKDDIT  363

Query  336  EVVLVGGSTRIPKVQQLLSDFF-------NGKEPNKSINPDE-AVAYGATVQAAILSGNd  387
             V+LVGGS +IP++Q L  + F        G +    ++P   A A+ + V+  +     
Sbjct  364  TVLLVGGSFQIPRLQTLFKESFPSQEVVVAGAQSPPILSPARGAAAFSSAVRRGVPGAE-  422

Query  388  sseklqdlllldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVF  447
                     LL+VTPLSLG+++  G    +I RNT++P  KS  F  YA+ Q  V++ V 
Sbjct  423  ---------LLEVTPLSLGIQSVAGTRIMMIPRNTSIPVHKS--FLYYANCQHAVIVYVI  471

Query  448  EGERSMTRDNNLLGKFN---LDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENK  504
            EG+ + ++ N +L + +   +DG       V +ID+T DI++   + V+A E+S+G++  
Sbjct  472  EGD-NFSKPNEILHRLSSIRVDGSLATKHLVLKIDITIDINSLDQMTVTAAERSSGRKIA  530

Query  505  ITITNDKGRLSQAEIDRMVAEAEKYKSEDEA  535
              I+ D   +S   I    A  E   ++  A
Sbjct  531  TAISGDDTGMSANAIAHANARLENRIADSTA  561

>H257_16484
Length=795

 Score = 235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 183/674 (27%), Positives = 306/674 (45%), Gaps = 82/674 (12%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKFS P VQ +I+++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  130  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            K++ +A  A  G      V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANDGVNPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L 
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S 
Sbjct  244  KDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSVLNIECLVDEIDYASK  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  357
            ++   FE +     ++   P++  L DA L+  ++  V +VGG  R+  V++ L++    
Sbjct  304  VSLDEFETLIAPLLQRLEGPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLAEILGL  363

Query  358  NGKEPN----KSINPDEAVAYGATVQAAILSG------------Ndsseklqdlllldvt  401
            + ++PN     ++N DEAVA G  +Q AILS             N+   ++         
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILSPLFKVKDFSISDINNYPIRVSWEGAASAD  423

Query  402  plslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMTRDNNL--  459
              +   ET G V T   A +  + T+K        D+ P      F    ++  + N   
Sbjct  424  DDTNEDETDGAVQTPANANSILILTRK--------DDFPTTKRITFRRSEALVVEANYDE  475

Query  460  -------------LGKFNLDGIPPMPRG-VPQIDVTFDIDANGILNVSAVEKSTG-----  500
                         LGKF + G+     G  P++ V    D +G+  V++ +         
Sbjct  476  TATPFLPPSPYTNLGKFTISGMSAGENGEAPRVRVNVRQDIHGLFEVASGQMMVEIKEEE  535

Query  501  ----------------------KENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKV  538
                                  ++  + + +    L+ A+++R   E      +D   + 
Sbjct  536  TKEAEAKEGEEKKEEGPKKKRFRKVDLKVESQVNGLTAADVNRASEEELTMAQQDRVIEE  595

Query  539  RIEAKNALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEY  596
                +N LE + Y  RN L+D K  E +  +D+   D K+ +   WL  D    S K  +
Sbjct  596  TANKRNELETFVYDNRNHLSD-KYSEFVSTSDRDAFDAKLNDMEDWLYSDEGFDSTKSVF  654

Query  597  EAKQKELEGVANPV  610
            + K  EL  +  PV
Sbjct  655  QTKLDELRALLKPV  668

>PYU1_G006843
Length=481

 Score = 227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 142/397 (36%), Positives = 206/397 (52%), Gaps = 30/397 (8%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNAHN  68
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+     +  +
Sbjct  80   VGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLVGRDARAHRTKDPAH  139

Query  69   TVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQ---ITVQFKGESKTFQPEEISS  125
            T+F+AKR IGR + D +   D   + F +S    D        V   G  K   P  I +
Sbjct  140  TIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNVPGHRKCVSPIAIGA  199

Query  126  MVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  184
             ++  +R +A AF+G  ++  AVI VP  F+  QR AT+ A   AGL+V RI+ EPTAAA
Sbjct  200  TIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKAFFAAGLHVSRILEEPTAAA  259

Query  185  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHF  244
            IAYGL +      +L+FD GGGT DVSLL    G   V  T GD +LGGED D ++ +  
Sbjct  260  IAYGLHQDPSVNFILVFDFGGGTLDVSLLFTRAGSINVVDTIGDNNLGGEDLDAKVAEVL  319

Query  245  TQEFKRKHRKDITENQR-------------------ALRRLRTACERAKRTLS--SSAQA  283
            T +   +    +T                        L  +R A E  KRTLS  +SA A
Sbjct  320  THKIAERIGTTLTSATSDMEETYSDRTNDDPDQLPCTLAGIRRAAELLKRTLSYETSATA  379

Query  284  YIEIDSLFDGIDFNSTI----TRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
               +    + +    T+    TR   E++C +   +T+ PV++++    ++  ++  VVL
Sbjct  380  SCVVQMSGELLQARETVSIEMTRTELEEICSELLARTLVPVKEIIEANHMTSEEIDAVVL  439

Query  340  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            VGGS+RIP V++ L+  F+G+ P   I+ D AVAYGA
Sbjct  440  VGGSSRIPWVREHLAKMFDGRAPLSDIDRDVAVAYGA  476

>PHALS_08498
Length=895

 Score = 236 bits (601),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 162/543 (30%), Positives = 262/543 (48%), Gaps = 61/543 (11%)

Query  4    TTSGYSVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            T      G+D G  Y  V  V      EI+ N    R T + VAF   ERL G  A    
Sbjct  20   TIDAIVAGVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVG  79

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
                       +RL+G K SDP V A  D +H P+++   A     + +Q  G+ + F  
Sbjct  80   VRRPQTAYMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQH-GKKQFFHA  138

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+ +MV    R++ + F    VK+ V+TVP YF+ +QRQA  DA  I+G+ VL +INE 
Sbjct  139  EELVAMVFTHARQITDTFAEASVKDWVLTVPTYFSQAQRQAMLDAADISGVRVLSLINEN  198

Query  181  TAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEE-------------GIFEVK  223
            TAAA+   +    D +   + +L +++G  +  VS+                   IF+  
Sbjct  199  TAAALQLAVHSSFDPEEKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISIFQTI  258

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQA  283
            + A D  LGG  FD RL +H  QEF  K  +DI +  R + ++R   ++ K  LS++ + 
Sbjct  259  SNAWDESLGGAKFDLRLAEHLAQEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEI  318

Query  284  YIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGS  343
             + + SL + IDF +++TR + E +  D F +T++PVE  L  A L+ + + E+ L+GG 
Sbjct  319  PVVMQSLHNDIDFFTSMTRTKLEALSSDLFERTLKPVEVALEKAGLTAADIDEIELIGGG  378

Query  344  TRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtpl  403
             R+PK+QQ LS+FF GK+    +N DEA+A GA  +AA LS +    ++    +      
Sbjct  379  VRMPKIQQQLSEFFVGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIATYPIG  438

Query  404  slglETAGGVMT---------------TLIARNTTVPTKKSQTFSTYAD-------NQPG  441
               ++ +   +T                L + +  +  +KS +FS  +D       ++P 
Sbjct  439  VRLVDLSSSELTNNKEEEDMKQWMKRAALFSESHRLGVRKSVSFSHSSDLSCTFRYDKPS  498

Query  442  VL-IQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVS  493
            +L + V          N  +G FN+ G+            G P++ +TF++D+NGI  ++
Sbjct  499  MLPVGV----------NVHIGTFNVTGVEKFAARMADKNLGEPKVTLTFELDSNGIAQIA  548

Query  494  AVE  496
              E
Sbjct  549  KAE  551

>PYU1_G008851
Length=795

 Score = 233 bits (593),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/393 (35%), Positives = 214/393 (54%), Gaps = 20/393 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G +   AV++VP Y+ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDGVQPGYAVVSVPGYYTDVQRRALLNASKIAGLNTLRLINEHTAIALAYG  183

Query  189  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSIVAFVQGKLQVKSAAYDRFLGGRDFDYA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  297
            L     ++F+ K++ D     ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKKFQEKYKTDPLAEAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            S IT   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ LS+  
Sbjct  302  SQITLELFEELIEPLLQRLEGPIERALNDAGVEKSQLTSVEIVGGGTRVSSVKRRLSEIL  361

Query  358  NGKEP------NKSINPDEAVAYGATVQAAILS  384
               +       + ++N DE+VA G  +Q AI S
Sbjct  362  GLDKDAQNYGLSTTLNADESVARGCALQCAISS  394

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 83/185 (45%), Gaps = 32/185 (17%)

Query  457  NNLLGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------------  496
            N  +GKF + GIP + +G  +P+I V    D NG+  V++ +                  
Sbjct  486  NTTIGKFTVSGIPELEKGAELPKIRVNVQQDINGLFAVASSQLMQEIKEEEKPAEEGKEG  545

Query  497  ---------KSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALE  547
                     K   ++  + +T + G LS +++     +  K   +D   +     +N LE
Sbjct  546  EAEKPTEPKKKRFRKVDLKVTAEVGGLSSSDVLAATEQELKMAHQDRIIEETFNKRNELE  605

Query  548  NYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKELEG  605
             + Y +RN ++D KL E + +++K  ++DK+ E   WL  D    + K  Y+AK  EL  
Sbjct  606  TFVYEMRNQVSD-KLAEFVTDSEKAALEDKLNEMEDWLYSDEGFDTTKSVYQAKLDELRQ  664

Query  606  VANPV  610
              +P+
Sbjct  665  STSPL  669

>PPTG_19375
Length=809

 Score = 231 bits (590),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 210/391 (54%), Gaps = 16/391 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVKSAAFDRFLGGRDFDMAIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ +  EN ++  +L ++CE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSSCEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +T   FE +     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L+D    
Sbjct  304  VTLEEFETLIEPLLKRLDGPIERALADAGIDKSQLTNVEIVGGGTRVTSVKRHLADVLGL  363

Query  360  KEPNK------SINPDEAVAYGATVQAAILS  384
             +  +      ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 79/188 (42%), Gaps = 38/188 (20%)

Query  460  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAV--------------------EK  497
            +GKF + G+P    G  +P+I V    D NG+ +VS+                     E 
Sbjct  491  IGKFTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEAEGEQKEG  550

Query  498  STGKENK-------------ITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKN  544
               KE+K             +T+    G LS A++     +  K   +D   +     +N
Sbjct  551  EDKKEDKPAEPKKKRFRKIELTVQAQVGGLSVADVTTATEQELKMAQQDRVIEETFNKRN  610

Query  545  ALENYAYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKE  602
             LE++ Y +RN + D KL   I   +K  ++ K+ ET  WL  D    S K  Y+ K  +
Sbjct  611  ELESFVYEMRNQITD-KLAGFITSDEKNTLESKLMETEDWLYTDEGFDSTKSVYQQKLDD  669

Query  603  LEGVANPV  610
            +  +++PV
Sbjct  670  MRKLSSPV  677

>PHYCA_504114
Length=887

 Score = 232 bits (592),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 157/541 (29%), Positives = 270/541 (50%), Gaps = 70/541 (13%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+DLG  +  +  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  70   VFDAKRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMV  127
                +RL+G + SDP V +  D +H+P+++   A     I+++  G+S+TF  EE+ +MV
Sbjct  88   YAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKH-GKSQTFHAEELVAMV  146

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
                R++ + F    VK+ V+TVP++F+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  147  FAHARQITDTFAEAAVKDWVLTVPSFFSQAQRQALLDAAEISGVRVLSLINENTAAALQL  206

Query  188  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  230
             +    D +   + +L +++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  231  LGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  290
            LGG  FD RL +H   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGAKFDLRLAEHLATEFSEKIGEDIRKIPRPMAKIRAQAKKTKTVLSANEEIPVVMQSL  326

Query  291  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  350
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK+Q
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFDRTLKPVETALEKAGLTAADIDEIEIIGGGVRMPKIQ  386

Query  351  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglETA  410
            Q LS+FF+GK+    +N DEA+A GA  +AA LS +    ++    L         ++ +
Sbjct  387  QQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDLATYPIGVRLVDLS  446

Query  411  G---------GVMT-------TLIARNTTVPTKKSQTFS-------TYADNQP-----GV  442
                       V T       +L + +  +  +KS +FS       T+  ++P     GV
Sbjct  447  ATEPKDNNDDDVETKQWMKRASLFSESHRLGLRKSVSFSHSNDISCTFRYDKPSMLPAGV  506

Query  443  LIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAV  495
             +Q+               KFN+ G+            G P++ ++F++D+NGI  ++  
Sbjct  507  SVQI--------------AKFNITGVEKFAARMADKNLGEPKVTLSFELDSNGIAQIAKA  552

Query  496  E  496
            E
Sbjct  553  E  553

 Score = 37.4 bits (85),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 54/98 (55%), Gaps = 8/98 (8%)

Query  521  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN--DEKLKE-KIPEADKKVVDDK  577
            RM+ E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++KE  +PE   + +  K
Sbjct  643  RMLNEMEKTDNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPE-QVESLQRK  698

Query  578  VTETIQWL-DAHQSSEKEEYEAKQKELEGVANPVLQKV  614
            + ET +WL D     E  EY+ K  EL    + +L +V
Sbjct  699  LEETEEWLYDDGDKVEAAEYKKKMDELNKDLSAILFRV  736

>PHYCA_111740
Length=810

 Score = 231 bits (588),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 212/391 (54%), Gaps = 16/391 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +IK   +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE T+ A+AYG
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTSIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+NS 
Sbjct  244  KDVAAKFAEKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNSQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            +T   FE++     ++   P+E+ L DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFEELIAPLLQRLDGPIERALADAGIEKSQLANVEIVGGGTRVTSVKRHLAEVLGL  363

Query  360  KEPNK------SINPDEAVAYGATVQAAILS  384
             +  +      ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

>H310_06229
Length=800

 Score = 230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/392 (34%), Positives = 214/392 (55%), Gaps = 18/392 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N  NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKFS P VQ +IK++ FK       +  I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  130  KMREVAEAFIGKEVKNA--VITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            K++ +A A   + V+ A  V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ Y
Sbjct  124  KLQNIA-AVANENVRPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGY  182

Query  188  GLDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRL  240
            G+ K       +    +V+  D+G   + VS+++  +G  +VKA A D  LGG +FD  L
Sbjct  183  GIYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAYDRFLGGRNFDFAL  242

Query  241  VDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNS  298
                 ++F+ KH+K+   + ++  +L +ACE+ K+ LS      + + I+ L D ID+ S
Sbjct  243  AKDVAEKFEAKHKKNPLADAKSRLKLLSACEKTKKNLSPQGVTSSALNIECLVDEIDYAS  302

Query  299  TITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--  356
             ++   FE +      +   P++  L DA L+  ++  V +VGG  R+  V++ L+D   
Sbjct  303  KVSLEEFETLIAPLLERLEAPIQSALADAGLTADKLSCVEIVGGGVRVASVKRRLADILG  362

Query  357  FNGKEPN----KSINPDEAVAYGATVQAAILS  384
             + ++PN     ++N DEAVA G  +Q AILS
Sbjct  363  LDKEKPNMGLSTTLNADEAVARGCALQCAILS  394

>HYAP_07918
Length=897

 Score = 229 bits (585),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 212/396 (54%), Gaps = 21/396 (5%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+DLG+ +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  29   GVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRKPQTA  88

Query  70   VFDAKRLIGRKFSDPIVQADI--KHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMV  127
                +RL+G K SDP V + +  +H+P+++ S A     I ++   ++ TF  EE+ +MV
Sbjct  89   YAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDA-TFHAEELVAMV  147

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
            L   R++   F    VK+ V+TVP +F+ +QRQA  DA  IAG+ VL +IN+ TAAA+  
Sbjct  148  LTHARQITNTFAEVPVKDYVLTVPTFFSQAQRQALLDAAEIAGVRVLSLINDNTAAALQL  207

Query  188  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  230
             +    D     + VL ++LG     VS+ ++   +             FE  + A D  
Sbjct  208  AVHTSYDPTEAPKRVLFYNLGSTALQVSIAAMSSQVVPDGFKKNKTVSTFETLSNAWDES  267

Query  231  LGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  290
            LGG  FD RL +H   EF ++  +DI    RA+ ++R    + K  LS++ Q  + + SL
Sbjct  268  LGGSKFDLRLAEHLATEFSQQIGQDIRTVPRAMAKIRAQAMKTKTVLSANEQIPVVMQSL  327

Query  291  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  350
             + +DF +++TR + E++  D F +T++PVE+ L  A L+ + + E+ L+GG  R+PK+Q
Sbjct  328  HNDVDFFTSMTRTKLEELSSDLFERTLKPVEQALEKAGLTVADIDEIELIGGGVRMPKIQ  387

Query  351  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
              LS FF GK+    +N DEA+A GA  +AA LS +
Sbjct  388  HQLSQFFAGKDLGVHLNGDEAMALGAAFRAANLSNS  423

 Score = 34.7 bits (78),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query  521  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN---DEKLKEKIPEADKKVVDDK  577
            +M+ E E   ++  AN   +EAKN+LE + Y   ++++   DE  +  +PE   + +  K
Sbjct  649  QMLTEMENADNKRHAN---LEAKNSLETFIYKTHDAISAHEDEMKQVTVPE-QIEALKKK  704

Query  578  VTETIQWL-DAHQSSEKEEYEAKQKELEGVANPVLQKV  614
            + ET +WL D  +  E  EY+ K   L+   + +L +V
Sbjct  705  LEETEEWLYDDGERVEAVEYKKKMDALDSDLSAILFRV  742

>PHYRA_82545
Length=806

 Score = 228 bits (582),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 212/391 (54%), Gaps = 16/391 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ ++    +K    A     + + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAFG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSVVAFVQGRLTVKSAAFDRFLGGRDFDMVIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                 +F  K++ +  EN ++  +L +ACE+AK+ LS       ++ I+ L D  D+N+ 
Sbjct  244  KDVATKFADKYKTNPLENPKSRIKLLSACEKAKKNLSPYGVTATHLNIECLADDRDYNAQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFN-  358
            +T   FE +      +  +PVE+ L+DA + KSQ+  V +VGG TR+  V++ L++    
Sbjct  304  VTLEEFETLIAPLLERLDDPVERALKDAGIDKSQLTNVEIVGGGTRVTSVKRHLAEVLGL  363

Query  359  GKEP-----NKSINPDEAVAYGATVQAAILS  384
             KE      + ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNFGLSSTLNADESVARGCALNCAILS  394

>PITG_15771
Length=883

 Score = 228 bits (582),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/396 (33%), Positives = 215/396 (54%), Gaps = 21/396 (5%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  70   VFDAKRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMV  127
                +RL+G   SDP V +  D +H+P+++   A     I+++  G+ +T+  EE+ +MV
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKH-GKEQTYHAEELVAMV  146

Query  128  LIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  187
                R++ + F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+  
Sbjct  147  FTHARQITDTFAEAPVKDWVLTVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQL  206

Query  188  GL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  230
             +    D +   + +L F++G  +  VS+      +             F+  + A D  
Sbjct  207  AVHASYDPEDKPKKILFFNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWDES  266

Query  231  LGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  290
            LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +  + + SL
Sbjct  267  LGGAKFDLRLAEHLAKEFSDKIGEDIRKVARPMAKIRALAKKTKTVLSANEEIPVVMQSL  326

Query  291  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  350
            ++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + EV ++GG  R+PK+Q
Sbjct  327  YNDIDFFTSMTRSKLEELSSDLFERTLKPVEVALEKAGLTAADIDEVEIIGGGVRMPKIQ  386

Query  351  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            Q LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  387  QQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

>PHYKE_6664
Length=804

 Score = 227 bits (579),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 211/391 (54%), Gaps = 16/391 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    ++    A     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALMNATKIAGLNCLRLINEHTAIALAFG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  DLG  ++ VS+++  +G   V++ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSIVAFVQGRLTVQSAAFDRFLGGRDFDMVIA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
                ++F  K++ D   + ++  +L +ACE+AK+ LS       +I I+ L D  D+N+ 
Sbjct  244  QDVAKKFAEKYKTDPLAHPKSRLKLLSACEKAKKNLSPYGVTATHINIECLADDRDYNAQ  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNG  359
            ++   FE +     ++   P+E+ L+DA + KSQ+  V +VGG TR+  V++ L+D    
Sbjct  304  VSLEEFEVLIAPLLKRLDGPIERALKDAGIDKSQLTSVEIVGGGTRVTSVKRQLADVLGL  363

Query  360  KEPNK------SINPDEAVAYGATVQAAILS  384
             +  +      ++N DE+VA G  +  AILS
Sbjct  364  DKEQQNYGLSTTLNADESVARGCALNCAILS  394

>PHYRA_73661
Length=884

 Score = 228 bits (580),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 161/545 (30%), Positives = 270/545 (50%), Gaps = 76/545 (14%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  68
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  27   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVGVRRPQ  84

Query  69   TVFDA-KRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            T +   +RL+G   SDP V A  D +H+P+ +   A     I+++  G+ + FQ EE+ +
Sbjct  85   TAYSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLK-HGKDQAFQAEELVA  143

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MV    R++   F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  144  MVFAHARQITNTFAEAPVKDWVLTVPTFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  203

Query  186  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  228
               +    D +   + +L ++LG  +  VS+      +             FE  + A D
Sbjct  204  QLAVHASYDPEDKPKKILFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTISTFETISNAWD  263

Query  229  THLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  288
              LGG  FD RL ++   EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  264  ESLGGAKFDLRLAEYLATEFSEKIGEDIRKVARPMAKIRAQAKKTKTVLSANEEIPVVMQ  323

Query  289  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  348
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ L+GG  R+P+
Sbjct  324  SLYNDIDFFTSMTRSKLEELSADLFERTIKPVEVALEKAGLTVADIDEIELIGGGVRMPR  383

Query  349  VQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglE  408
            +QQ LS+FF GK+ +  +N DEA+A GA  +AA LS +    ++    +         ++
Sbjct  384  IQQQLSEFFEGKDLSVHLNGDEAMALGAAFRAANLSNSFRVRQVGMTDIASYPVGVRLVD  443

Query  409  TAGG-----------VMT-------TLIARNTTVPTKKSQTFS-------TYADNQP---  440
             +             V T        L + +  +  +KS +FS       T+  ++P   
Sbjct  444  LSASEPKDNDNNDDEVETKQWMKRAALFSESHRLGLRKSVSFSHSNDVSCTFRYDKPSML  503

Query  441  --GVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILN  491
              GV +Q+              GKFN+ G+            G P++ ++F++D+NGI  
Sbjct  504  PAGVSVQI--------------GKFNITGVEKFVARMADKNLGEPKVTLSFELDSNGIAQ  549

Query  492  VSAVE  496
            ++  E
Sbjct  550  IAKAE  554

 Score = 35.4 bits (80),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 12/100 (12%)

Query  521  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEK---IPEADKKVVDDK  577
            RM+ E EK  ++  AN   +EAKN+LE + Y   ++L+ ++ + K   +PE   + +  K
Sbjct  646  RMLTEMEKADNKRSAN---LEAKNSLETFIYKAHDALSAQESQIKQVTVPE-QVESLQSK  701

Query  578  VTETIQWLDAHQSSEK---EEYEAKQKELEGVANPVLQKV  614
            + ET +WL  ++  EK    EY+ K   L+   + +L +V
Sbjct  702  LEETEEWL--YEDGEKVDAAEYKKKMDTLDSDLSAILFRV  739

>PYAP_19741
Length=885

 Score = 226 bits (576),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 211/394 (54%), Gaps = 21/394 (5%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  28   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTC  87

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGES-KTFQPEEISSM  126
                +R +G    DP + + ++  ++P+++     +  + TV  K E+ + F  EE+ +M
Sbjct  88   YAQVRRFLGTTPEDPAIASLLQEEYFPYELLQ---NDTRGTVALKHENDQVFHAEELVAM  144

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    R++ +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L +INE TAAA+ 
Sbjct  145  VFTHARQITDAFAEVPVKDWVLTVPDFFTQAQRQAMLDAAEISGVRALSLINENTAAALQ  204

Query  187  YGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  232
              +     E R VL +++G  +  VS++     +             FEV + A D  LG
Sbjct  205  LAVHSTFPEPRRVLFYNMGSTSLQVSIVEFSSQVVPDGFKKNKTVSGFEVLSKAWDPLLG  264

Query  233  GEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  292
            G  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ Q  + + SL+ 
Sbjct  265  GAKFDLRLAEHLAAEFSEKLGEDVRQIPRPMAKIRAQAKKTKIVLSANEQIPVVMQSLYK  324

Query  293  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  352
             IDF +++TR +FE+MC D F + M+PVE+ L  A L+ + +HE+ ++GG  R+PK+QQ 
Sbjct  325  DIDFFTSMTRGKFEEMCKDLFAQAMKPVEQALEKAGLTPADIHEIEIIGGGVRMPKIQQQ  384

Query  353  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            L +FF+GK+    +N DEA+A GA   AA LS +
Sbjct  385  LKEFFSGKDLGVHLNGDEAMALGAAFHAANLSNS  418

>CCA27145
Length=463

 Score = 216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 137/403 (34%), Positives = 206/403 (51%), Gaps = 35/403 (9%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNA  66
            + +GIDLGTTYS V + Q++ V II +   +   PS V F  +   L+G  A+     + 
Sbjct  57   HVIGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYRTKDP  116

Query  67   HNTVFDAKRLIGRKFSDPIVQADIKHW---PFKISSGAGDK----PQITVQFKGESKTFQ  119
             +T+++AKR IGR +++ I  A+   +   PF+  S +  +    P  ++   G      
Sbjct  117  RHTIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHPACVT  176

Query  120  PEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  178
            P EI S+++  +  +A  F+   ++   VI VP  F  +QR+AT  A   AGL V R++ 
Sbjct  177  PIEIGSLIIRHLHLMAHEFVKHNQLDRVVIAVPVDFKPAQRRATVQAYEKAGLKVARVLE  236

Query  179  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDN  238
            EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G   V  T GD +LGGED DN
Sbjct  237  EPTAAAIAYGLHQAPNVNFILVFDFGGGTLDVSLLFVRSGSISVVDTLGDNNLGGEDLDN  296

Query  239  RLVDHFTQEFK------------------RKHRKDITENQRALRRLRTACERAKRTLSSS  280
             + +H T + +                   +  +D  +    +  +R A E  KR LS S
Sbjct  297  LVSNHLTSQLEALLGMKLAEASSEVMETDSEKNEDPDQLPCTIAGIRRAAEILKRKLSFS  356

Query  281  AQAYIEIDSLFDGIDF-------NSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQ  333
              A         G            +++R  FE +C     + + PV ++LRD  ++   
Sbjct  357  DSAIASCIVQEPGGKLIPQDNRVEISMSRIEFEALCEPILERALIPVRQILRDNHMNPKS  416

Query  334  VHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            + EVVLVGGS+RIP +   L + F GK+P  +I+PD AVA+GA
Sbjct  417  IDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFGA  458

>PYAR_16202
Length=893

 Score = 224 bits (570),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 151/528 (29%), Positives = 254/528 (48%), Gaps = 54/528 (10%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  33   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGEERLYGADAATVGVRRPQTC  92

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGES-KTFQPEEISSM  126
                +R +G    DP + A I+  ++P+++     +  + TV  K +  + F  EE+ +M
Sbjct  93   YAQIRRFLGTTKEDPAISALIQDEYFPYEL---LHNDTRGTVALKHDKGQVFSAEELVAM  149

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    R + +AF    VK+ V+TVP +F  +QRQA  DA  I+G+  L ++NE TAAA+ 
Sbjct  150  VFTHARHITDAFAEVPVKDWVVTVPDFFTQAQRQAMLDAAEISGVRALSLLNENTAAALQ  209

Query  187  YGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  232
              +     E R VL ++LG  +  VS+      +             FEV + A D  LG
Sbjct  210  LAVHSTFAEPRRVLFYNLGSTSLQVSIAEFSSQVVPDGFKKNKTVSGFEVLSKAWDASLG  269

Query  233  GEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFD  292
            G  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ Q  + + SL+ 
Sbjct  270  GAKFDLRLAEHLAAEFSEKLGEDVRQLPRPMAKIRAQAKKTKIVLSANEQIPVVMQSLYK  329

Query  293  GIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQL  352
             +DF +++TR++ E++C D F + M+PVE+ L  A L K  +HE+ ++GG  R+PK+QQ 
Sbjct  330  DVDFFTSMTRSKLEEICKDLFAQAMKPVEQALEKAGLKKDDIHEIEIIGGGVRMPKIQQQ  389

Query  353  LSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglET--A  410
            L DFF GK+    +N DEA+A GA   AA LS +     +    +         ++   A
Sbjct  390  LKDFFEGKDLGVHLNGDEAMALGAAFHAANLSNSFRVRHVGMTDIAPYAVGVRLVDIDHA  449

Query  411  GG--------VMTTLIARNTTVPTKKSQTF-------STYADNQPGVLIQVFEGERSMTR  455
            G            +L   ++ +  +K+ +F       +T+  ++P  L            
Sbjct  450  GSDDSDKHWVKRASLFTESSKLGLRKAVSFLHSKDISATFRYDKPSSL---------PVG  500

Query  456  DNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVE  496
             ++ + KFN+ GI            G P++ +TF++D +G+  ++  E
Sbjct  501  ASSHIAKFNITGIEEFAAKFADKNLGEPKVSLTFELDGSGVTKIAKAE  548

 Score = 35.8 bits (81),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 49/97 (51%), Gaps = 6/97 (6%)

Query  521  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSL--NDEKLKEKIPEADKKVVDDKV  578
            RM+ E E   ++  AN   +EAKN LE+Y Y+ R++L   +E+          + +  K+
Sbjct  652  RMLREMELADNQRRAN---LEAKNKLESYVYTARDTLGAQEEEFTAVTTSEQLEKLRTKL  708

Query  579  TETIQWL-DAHQSSEKEEYEAKQKELEGVANPVLQKV  614
             ET +WL D  +     EY  K K L+   + +L ++
Sbjct  709  EETEEWLYDEGEKVSAAEYNKKVKSLDTDFSAILFRI  745

>PHYSO_255506
Length=1228

 Score = 225 bits (574),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/398 (34%), Positives = 221/398 (56%), Gaps = 25/398 (6%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  68
            G+D G  +  V + +     EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  364  GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT--VGVRRPQ  421

Query  69   TVF-DAKRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            T +   +RL+G   SDP V A  D +H+P+++   A     +++Q   + + F  EE+ +
Sbjct  422  TAYAQIRRLLGTTLSDPQVAALLDEEHFPYQLLQNATRGGTVSLQH-AKDRVFHAEELVA  480

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TA+A+
Sbjct  481  MVFAHARQITDTFAEAPVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTASAL  540

Query  186  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  228
               +    D +   + +L +++G  +  VS+      +             F+  + A D
Sbjct  541  QLAVHASYDPEDKPKRILFYNMGSTSLQVSVAEFSSQVVPDGFKKNKTISTFQTLSNAWD  600

Query  229  THLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  288
              LGG  FD RL +H  +EF  K  +DI +  R + ++R   ++ K  LS++ +  + + 
Sbjct  601  ESLGGAKFDLRLAEHLAKEFSDKIGEDIRKVPRPMAKIRAQAKKTKTVLSANEEIPVVMQ  660

Query  289  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  348
            SL++ IDF ++ITR++ E++  D F +T++PVE  L  A L+ + + E+ ++GG  R+PK
Sbjct  661  SLYNDIDFFTSITRSKLEELSADLFDRTLKPVEVALEKAGLTVADIDEIEIIGGGVRMPK  720

Query  349  VQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            +QQ LS+FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  721  IQQQLSEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  758

 Score = 35.0 bits (79),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 54/98 (55%), Gaps = 8/98 (8%)

Query  521   RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN--DEKLKE-KIPEADKKVVDDK  577
             RM+ E EK  ++  AN   +EAKN+LE + Y   ++L+  + ++KE  +PE   + +  K
Sbjct  982   RMLTEMEKADNKRRAN---LEAKNSLETFIYKAHDALSAQESQIKEVTVPE-QVESLQTK  1037

Query  578   VTETIQWL-DAHQSSEKEEYEAKQKELEGVANPVLQKV  614
             + ET +WL D     +  EY+ K   L+   + +L +V
Sbjct  1038  LEETEEWLYDDGDKVDAAEYKKKMDALDSDLSAILFRV  1075

>PYU1_G000896
Length=711

 Score = 219 bits (559),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 167/562 (30%), Positives = 278/562 (49%), Gaps = 69/562 (12%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEI----------IANDQGNRTTPSYVAFTDTERLIGDA  57
            + +GID GT + C      D + +          I +++     P++V+ TDT  LIG  
Sbjct  58   WVLGIDFGT-HLCSAAVSRDGIVVDVPVPGDAAAIDDNKSPLAVPAFVSVTDTGYLIGTE  116

Query  58   AKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGES--  115
            A+        NTVFD  RL+GRK  D +  AD   WPF + +G  DK  + +     S  
Sbjct  117  ARTLARRGDLNTVFDLTRLVGRKVGD-LSDADQARWPFHVVAGDHDKVLVAILGTNNSVS  175

Query  116  --KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNV  173
              +   PEE+ +++ ++++E AEA +  +++ AV+ VP  FN +QR+A ++AG IAGL+V
Sbjct  176  NPRKLYPEELLAVLFLQLKENAEALLHTKLQTAVLCVPEGFNHTQRRAVRNAGMIAGLSV  235

Query  174  LRIINEPTAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSIE-EGIFEVKATAGD  228
             R++   TAAA+++G+          R ++  D+G    +++L++++   +FEVKA A D
Sbjct  236  TRLVCAATAAAVSFGIGSSVPSSLSTRVIMTVDIGASATNMALVAVKNRTVFEVKAVASD  295

Query  229  THLGGEDFDNRLVDHFTQEFKRKHRK------------DITENQ-RALRRLRTACERAKR  275
             +LGG D    +V H  +       +            D +E+Q   +R++R A E AK+
Sbjct  296  LNLGGHDLTEAIVAHCQRRRPTPSPRFCVSSASASTPADTSESQLHGMRQIRHASEVAKK  355

Query  276  TLSSSAQAYIEIDSLFDGIDFN-STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  334
             LS+S  A + ID   D   F    +TRA FE +C +++++  E + ++L+++  +K  +
Sbjct  356  LLSTSTNAVVGID-FPDPSAFGYYNVTRACFEALCEEHWQRIRELMNQLLQESLATKEGI  414

Query  335  HEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYG----ATVQAAILSGNdsse  390
              +VL+GGS  IP+VQ L+ + F          P   V Y     ++ + A L G  S  
Sbjct  415  DAIVLLGGSAWIPRVQTLVQESF----------PLHHVLYTPEDVSSARGAALCGGKSRN  464

Query  391  klqdlllldv------tplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLI  444
                +           T L LG+++A G    +I  NT +P  KS  F  YA+ Q  V+ 
Sbjct  465  TQNGISTAPAVELPDVTLLPLGIQSANGTKIVMIPSNTKLPVHKS--FLYYANCQHAVVF  522

Query  445  QVFEGERSMTRDNNL-----------LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVS  493
             V EG     +  +L           L    +DG       V +ID+TFD+D    + V+
Sbjct  523  HVIEGRVFNIKPGSLSKNPASAALHELASVRVDGRHATTHVVLKIDITFDVDTLDQIIVT  582

Query  494  AVEKSTGKENKITITNDKGRLS  515
            A E+S+G++  + I  D+  LS
Sbjct  583  ATERSSGRKVTVCIDGDETSLS  604

>PHYKE_9011
Length=902

 Score = 222 bits (565),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 219/398 (55%), Gaps = 25/398 (6%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  68
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA   V +    
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAA--TVGVRRPQ  85

Query  69   TVFDA-KRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            T +   +RL+G K  +P V+A ++  H+P+ +         ++++ + +   +Q EE+ +
Sbjct  86   TAYQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHR-DGHIYQAEELVA  144

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MV    R++ + F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  145  MVFTHARQITDTFAEAAVKDWVVTVPAFFSQAQRQALLDAAEISGVRVLSLINENTAAAL  204

Query  186  AYGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGD  228
               +    D +   R +L +++G  +  VS+      +             F+  + A D
Sbjct  205  QLAVHASYDPEDKPRRILFYNMGSTSLQVSIAEFSSQVVPDGFKKNKTISTFQTISNAWD  264

Query  229  THLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEID  288
              LGG  FD RL +H   EF  K  +D+ +  R + ++R   ++ K  LS++ +  + + 
Sbjct  265  ESLGGARFDLRLAEHLATEFSEKIGEDVRKVPRPMAKIRAQAKKTKMVLSANEEIPVVMQ  324

Query  289  SLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPK  348
            SL++ IDF +++TR++ E++  D F +T++PVE  L  A L+ + + E+ LVGG  R+PK
Sbjct  325  SLYNDIDFFTSMTRSKLEELSADLFERTLKPVEVALEKAGLTVADIDEIELVGGGVRMPK  384

Query  349  VQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            +QQ L++FF+GK+    +N DEA+A GA  +AA LS +
Sbjct  385  IQQQLAEFFDGKDLGVHLNGDEAMALGAAFRAANLSNS  422

 Score = 36.6 bits (83),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 54/98 (55%), Gaps = 8/98 (8%)

Query  521  RMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLN---DEKLKEKIPEADKKVVDDK  577
            RM+ E EK  ++ +AN   +EAKN+LE + Y   ++L+    E  K  +PE   + +  K
Sbjct  648  RMLKEMEKADNKRKAN---LEAKNSLETFIYKAHDALSAQESEIKKVTVPE-QVESLQTK  703

Query  578  VTETIQWL-DAHQSSEKEEYEAKQKELEGVANPVLQKV  614
            + ET +WL +    ++  EY+ K  +L+   + +L +V
Sbjct  704  LEETEEWLYEDGDKADAAEYKKKMSDLDSDLSAILSRV  741

>SDRG_03266
Length=792

 Score = 218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 205/391 (52%), Gaps = 16/391 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  130  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSASKIAGMNCLRLMNEHTAVALSYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFIDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  357
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L+D    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  358  NGKEPN----KSINPDEAVAYGATVQAAILS  384
            + ++PN     ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNLGLSTTLNADEAVARGCALQCAILS  394

 Score = 39.7 bits (91),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 39/179 (22%), Positives = 73/179 (41%), Gaps = 29/179 (16%)

Query  460  LGKFNLDGIPPMPRG-VPQIDVTFDIDANGILNVSAVEKSTG------------------  500
            +GKF + GIP      VP+I V    D +G++ V++ +                      
Sbjct  490  IGKFTVSGIPAGETDEVPRIRVNIKHDIHGLVEVASSQMMVEIKEEEPKEGEEASEEKKE  549

Query  501  -------KENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSL  553
                   ++ ++ +T     L+ AE+ +   E      +D   +     +N LE + Y L
Sbjct  550  EPKKKRFRKIELKVTPSVNGLTVAEVAKATEEELAMAQQDRIIEETANKRNELETFVYDL  609

Query  554  RNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
            RN L  EK  E +   ++  +++++ +   WL  D    S K  Y+ K   L  + +P+
Sbjct  610  RNHLG-EKYAEFVAAPERDDIENQLNDMEDWLYSDEGFDSIKSIYQTKLDGLRAICSPI  667

>PYAP_21865
Length=481

 Score = 212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/410 (34%), Positives = 203/410 (50%), Gaps = 45/410 (11%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAH  67
            ++VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+    R    A + +   +  
Sbjct  71   HTVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTK---DPR  127

Query  68   NTVFDAKRLIGRKFSDPIVQADIKHWPFKIS-SGAGDKPQITVQFK----GESKTFQPEE  122
            +T+F+AKR IGR F D    A    WP++ +    G+    TV F+    G      P +
Sbjct  128  HTIFNAKRFIGRSFRDVSDDASTT-WPYEFTIKRYGEHDNATVCFELETVGHPNCISPVD  186

Query  123  ISSMVLIKMREVAEAFIGK-------------------EVKNAVITVPAYFNDSQRQATK  163
            + + ++  ++ +A  F+G                    ++  AVI VP  F+  QR AT 
Sbjct  187  VGTRIVQHLKTLAWRFVGHNQMGMIDNLLSGLTHNYCGQINRAVIAVPVDFDSKQRSATV  246

Query  164  DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVK  223
             A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V 
Sbjct  247  AAFNAAGLKVSRVLEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFARSGSISVI  306

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRK-------------HRK-DITENQRALRRLRTA  269
             T GD +LGGED D  +  H  Q  + K             H + D   +  AL   +  
Sbjct  307  DTMGDNNLGGEDLDAAIAHHLIQNLEVKLGAVSSGGSGVDAHEQLDHDGDSEALPCTKAG  366

Query  270  CERAKRTLSSSAQAYIEIDSLFDGIDFNSTI---TRARFEDMCGDYFRKTMEPVEKVLRD  326
              RA   L  S  + +E  +     D N  I   +R   E +C    ++T+ PV ++L  
Sbjct  367  IRRAAEMLKRSLSSSLEASASCLTTDNNRVIMAMSRYELESICEAILKRTLVPVREILEA  426

Query  327  AKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
              ++   +  VVLVGGSTR+P V++ L+  F G+ P   I+PD AVAYGA
Sbjct  427  NSMTIQDIDAVVLVGGSTRLPWVRRELTAMFGGRPPLTDIDPDVAVAYGA  476

>SPRG_08060
Length=793

 Score = 218 bits (556),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 132/391 (34%), Positives = 205/391 (52%), Gaps = 16/391 (4%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +       NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF+   VQ +I  + FK       +  I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  130  KMREVAE-AFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A  A  G      VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSAAKIAGMNCLRLMNEHTAVALSYG  183

Query  189  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K       +    +V+  D+G   + VS+++  +G  +VK+ A D  LGG +FD  L 
Sbjct  184  IYKSLRNLFHESEPEHVMFVDIGHSGYTVSVVAFVQGKLQVKSVAYDRFLGGRNFDMALA  243

Query  242  DHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFNST  299
               +++F  K++KD   + ++  +L  ACE+AK+ LS        + ++ L D ID+N+ 
Sbjct  244  KDVSEKFVAKYKKDPLADAKSRIKLLGACEKAKKNLSPQGVNSTTLAVECLVDEIDYNAK  303

Query  300  ITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDF--F  357
            I    FE +      +   P+ K L DA ++K Q+  V +VGG  R+  V++ L+D    
Sbjct  304  IDLEEFETLIAPLLDRLEGPIVKALADAGITKDQLSCVEIVGGGVRVASVKRKLADILGL  363

Query  358  NGKEPN----KSINPDEAVAYGATVQAAILS  384
            + ++PN     ++N DEAVA G  +Q AILS
Sbjct  364  DKEKPNMGLSTTLNADEAVARGCALQCAILS  394

 Score = 41.2 bits (95),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 41/179 (23%), Positives = 74/179 (41%), Gaps = 29/179 (16%)

Query  460  LGKFNLDGIPPMPRG-VPQIDVTFDIDANGILNVSAVEKSTG------------------  500
            +GKF + GIP      VP+I V    D +G++ V++ +                      
Sbjct  490  IGKFTVSGIPVGETDEVPRIRVNIKHDIHGLVEVASSQMMVEIKEEETKEGEEASEEKKE  549

Query  501  -------KENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSL  553
                   ++ ++ +T     LS AE+ +   E      +D   +     +N LE + Y L
Sbjct  550  EPKKKRFRKIELKVTPSVNGLSAAEVAKATEEELAMAQQDRIIEETANKRNELETFVYDL  609

Query  554  RNSLNDEKLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
            RN L  EK  E +   ++  +++K+ +   WL  D    S K  Y+ K   L  +++P+
Sbjct  610  RNHLG-EKYAEFVAAPERDDIENKLNDMEDWLYSDEGFDSIKSIYQTKLDGLRALSSPI  667

>PHYSO_247517
Length=794

 Score = 218 bits (554),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 182/646 (28%), Positives = 301/646 (47%), Gaps = 87/646 (13%)

Query  45   VAFTDTERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDK  104
            V     +R IG+AA +   M+  NT  D KRLIGRKF  P VQ +I    +K    A   
Sbjct  24   VCVQGKQRFIGEAAISMARMHYKNTATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGD  83

Query  105  PQITVQFKGESKTFQPEEISSMVLIKMREVAEAF-IGKEVKNAVITVPAYFNDSQRQATK  163
              I + +  E  TF  E++ +M+L KM+ +A A   G      V++ P ++ D QR+A  
Sbjct  84   VGIVLNYNDEPVTFSCEQVVAMILNKMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALL  143

Query  164  DAGAIAGLNVLRIINEPTAAAIAYGLDK-------KGGERNVLIFDLGGGTFDVSLLSIE  216
            +A  IAGLN LR+INE TA A+AYG+ K       +   ++V+  DLG  ++ VS+++  
Sbjct  144  NATKIAGLNCLRLINEHTAIALAYGIYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFV  203

Query  217  EGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRT  276
            +G   VK+ A D  LGG DFD  +      +F  K++ +  EN ++  +L +ACE+AK+ 
Sbjct  204  QGRLTVKSAAFDRFLGGRDFDMVIAKDAAAKFAAKYKTNPLENPKSRIKLLSACEKAKKN  263

Query  277  LSSSA--QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQV  334
            LS       ++ I+ L D  D+NS +T   FE++      +   P+E+ L DA + KSQ+
Sbjct  264  LSPYGVTATHLNIECLADDRDYNSQVTLEEFEELIAPLLTRLDGPIERALADAGVEKSQL  323

Query  335  HEVVLVGGSTRIPKVQQLLSDFFNGKEPNK------SINPDEAVAYGATVQAAILS----  384
              V +VGG TR+  V++ L++     +  +      ++N DE+VA G  +  AILS    
Sbjct  324  ANVEIVGGGTRVTSVKRHLAEVLGLDKEQQNYGLSTTLNADESVARGCALNCAILSPMFK  383

Query  385  -------------------GNdsseklqdlllldvtplslglETAGGVMTTLIARNTTVP  425
                               G+ S+         DV   +   E +  V   +++R    P
Sbjct  384  VKEFSVTDRVHLPVRVSWDGSASTATDAADDDEDVNMETPASEDSSLV---ILSRKDEYP  440

Query  426  TKKSQTFSTYADNQPGVLIQVF-EGERSMTRDNNLL--GKFNLDGIPPMPRG--VPQIDV  480
              K  TF     ++P  +  V+ E  ++    + ++  GKF + G+P    G  +P+I V
Sbjct  441  KTKRITFRR---DKPFSIDAVYDESAKAYLPPDYVMDIGKFTVSGMPAQEAGAEIPKIRV  497

Query  481  TFDIDANGILNVSAVE----------------------------------KSTGKENKIT  506
                D NG+ ++++ +                                  K   ++ ++T
Sbjct  498  NVQQDMNGLFSIASSQLMQEIKEEEKPAEAEGEEKKEGEEKKEDKPAEPKKKRFRKIELT  557

Query  507  ITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDEKLKEKI  566
            +    G LS A++     +  K   +D   +     +N LE++ Y +RN + D KL   I
Sbjct  558  VQAQVGGLSAADLTTATEQELKMAQQDRVIEETFNKRNELESFVYEMRNQITD-KLAGFI  616

Query  567  PEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
               +K  ++ K+ ET  WL  D    S K  Y+ K  +L  +++PV
Sbjct  617  TSEEKGNLEAKLMETEDWLYTDEGFDSTKSVYQQKLDDLRKLSSPV  662

>CCA21519
Length=929

 Score = 214 bits (546),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 152/545 (28%), Positives = 261/545 (48%), Gaps = 63/545 (12%)

Query  11   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  Y  V + +  +  EI+ N    R T + VAF   ERL G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGKPFEIVTNVHSKRKTETMVAFDGEERLYGADADTIGVRRPHTG  100

Query  70   VFDAKRLIGRKFSDPIVQADI--KHWPFKISSGAGDKPQITVQFKGE-SKTFQPEEISSM  126
                +R +G       + + I  +++P+ +S+   ++ + ++  K E  K +  EE+ +M
Sbjct  101  YAQIRRFLGSSLDQYGIVSLILEEYYPYSLST---NEKRGSIHIKHEDEKHYHAEEVVAM  157

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V   +R++ + F   +VK+ VITVP Y+  +QRQA  DA  +AGL VL +INE TAAA+ 
Sbjct  158  VFSHVRQITDVFAETDVKDYVITVPEYYTQAQRQAVLDAAELAGLRVLSLINENTAAALQ  217

Query  187  YGLD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTH  230
              +    +    + V+ ++ G  +  V++  +   +             F+V + A + H
Sbjct  218  LCIHTTLEPDTPKRVIFYNQGSTSLQVTIAELFSYVVPVGSSSNKTIIGFKVLSKAWNQH  277

Query  231  LGGEDFDNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEI  287
            LG    D RL +HF +EF  K   +++D+    + + +LR   ++ K  LS++ +  + +
Sbjct  278  LGSSQIDLRLAEHFAREFNEKVLHNKQDVRSLPKVMAKLRAQAKKTKIVLSANEEIPVVM  337

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             SL +  D  +T+TR   E++C D F + + PV + L  A L++  +HEV L+GG  R+P
Sbjct  338  QSLLEDYDLRTTVTRTLLEELCKDLFDQALGPVHEALEKANLTRQDIHEVELIGGGVRVP  397

Query  348  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslgl  407
            KVQ+LL +FFN  E    +N DEA+A GA  +AA LS +     +Q          +   
Sbjct  398  KVQRLLKEFFNVPELGAHLNGDEAMALGAAFRAANLSNSFRVRPIQMTDTASYGIGATLA  457

Query  408  ET------------AGGVMTT---LIARNTTVPTKKSQTFSTYADNQPGVL---IQVFEG  449
            +                + TT   L AR     T     F T+  +Q   L   + VF  
Sbjct  458  DVNAEDGKDSSWTKHAPLFTTAHRLGARKAVSLTHTRDMFCTFRYDQSVALPEGVSVF--  515

Query  450  ERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVEKSTGKE  502
                      +G++++ GI            G P++ +TF +D++GI++++  E S  +E
Sbjct  516  ----------IGRYSISGIEAFYEQHLEKYLGDPKVTLTFLLDSSGIVSIAKAEVSLEEE  565

Query  503  NKITI  507
             +I +
Sbjct  566  YQIEV  570

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 13/132 (10%)

Query  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVR---IEAKNAL  546
            L V  VE+  G++ KI ++      SQ      +A  E  +  D A+  R   ++AKN L
Sbjct  631  LKVELVEERLGEKRKIGMSILPMSASQK-----IASVEMLREMDSADNKRKADLDAKNRL  685

Query  547  ENYAYSLRNSL--NDEKLKE-KIPEADKKVVDDKVTETIQWL-DAHQSSEKEEYEAKQKE  602
            E + YS R++L  +DE +++  +PE    V+  ++    +WL +    +E  EY+AK+ +
Sbjct  686  EAFVYSARDTLESDDEVIRQVTLPEQVTTVL-AQLEAAEEWLYEDGDKAEASEYDAKRSD  744

Query  603  LEGVANPVLQKV  614
            ++   + +L +V
Sbjct  745  MKTKLDEILFRV  756

>PPTG_04054
Length=324

 Score = 201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 160/255 (63%), Gaps = 25/255 (10%)

Query  81   FSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIG  140
            FSD +++ D  ++ F       DK  I              EISSMV+++M E+AEAF+G
Sbjct  2    FSDKVMKKDATYFLFTTKESDDDKVLI--------------EISSMVVLRMSEMAEAFLG  47

Query  141  KEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGG----ER  196
            + +  AV+T PAYFN+ QRQ+TKD  +IAGL++ RI NE + AA+AYGLD   G      
Sbjct  48   QRISQAVVTAPAYFNNQQRQSTKDVVSIAGLDLQRINNETSVAALAYGLDTNAGTDGKAC  107

Query  197  NVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRK-D  255
            NV IF LGGGT DVS+LSI     EVK+T GD+   GED DN +V H   EF+RK R  D
Sbjct  108  NVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---GEDSDNNMVQHLLTEFERKIRNLD  164

Query  256  ITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDFNST-ITRARFEDMCGDYFR  314
             + + RA   + TACE AKR L ++  A +E+ SLF+G++F+ST +TRA+FE +  + F+
Sbjct  165  PSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEFSSTVVTRAKFESLNEELFK  222

Query  315  KTMEPVEKVLRDAKL  329
            +    V KVL DAK+
Sbjct  223  RCEVTVFKVLEDAKM  237

>PYVX_15061
Length=891

 Score = 212 bits (540),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/397 (33%), Positives = 204/397 (51%), Gaps = 24/397 (6%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+DLG  +  V  V      EI+ N    R T + VAF   ERL G  A         + 
Sbjct  27   GVDLGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATIGVRRPQSA  86

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESK-TFQPEEISSM  126
                +R +G    DP V A ++    P+++     D  + ++  K   K  F  EE+ +M
Sbjct  87   YAQVRRFLGATLDDPQVVALLEDERLPYELEQ---DLARGSIALKHSDKQLFHAEELVAM  143

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    R++ +AF    VK+ V+TVP YF+ +QRQA  DA  +AG+ VL +INE TAAA+ 
Sbjct  144  VFSHARQITDAFAEAPVKDWVVTVPVYFSQAQRQALLDAAELAGVRVLSLINENTAAALQ  203

Query  187  YGLDK----KGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  229
              +      +   + +L ++LG  +  VS+  +   +             F++ ++A D 
Sbjct  204  LAVHASVAPEDKPKRILFYNLGSTSLQVSVAELSAQVVPDGFKKNKTVSTFQMLSSAWDD  263

Query  230  HLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  289
             LGG  FD RL DH  +EF  K  +D+    R + ++R   ++ K  LS++ Q  + + S
Sbjct  264  SLGGAKFDLRLADHLAKEFSDKIGEDVRTLARPMAKIRAQAKKTKIVLSANEQIPVVMQS  323

Query  290  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  349
            L+  +DF +++TR   E++C D F + + PV   L  A LS   + E+ LVGG  R+PK+
Sbjct  324  LYKDVDFFTSMTRGDLENLCEDLFPRALAPVAAALEKAGLSVDDIDEIELVGGGVRMPKI  383

Query  350  QQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            QQ L D+F GK+    +N DEA+A GA  +AA LS +
Sbjct  384  QQQLKDYFGGKDLGVHLNGDEAMALGAAFRAANLSNS  420

>PYIR_25979
Length=438

 Score = 203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/400 (32%), Positives = 209/400 (52%), Gaps = 53/400 (13%)

Query  8    YSVGIDLGTTYSCVGVWQNDRVEIIANDQ-------GNRTTPSYVAFTDTERLIGDAAKN  60
            +SVGIDLGT      + ++  V  ++ D+        N   PS+V+ TD+  L+G  A+ 
Sbjct  34   WSVGIDLGTQVCSAALIRDGIVIDVSFDEEQQQDSSPNLLLPSFVSATDSGFLVGADARR  93

Query  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGES-----  115
            +      +TVFD  RL+GRK  D   Q  +  WPFK+  G  DK  I +           
Sbjct  94   RARSGDPSTVFDFVRLVGRKIEDLSSQDILCKWPFKVVPGENDKAMIEISAIDTKDSAST  153

Query  116  ------KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIA  169
                  +TF PEE+ + +++K+++ AEA +  +V++ V+ VP  FN SQR+A ++A  IA
Sbjct  154  STSDVIRTFHPEELVAALIMKIKQKAEALVSAKVESTVVCVPGGFNHSQRRAVRNACVIA  213

Query  170  GLNVLRIINEPTAAAIAYGLDKKGG-------ERNVLIFDLGGGTFDVSLLSIEEGIFEV  222
            GL V +I++  TAA  ++G+ ++          + VL  D+G  + D+SL+S+    FEV
Sbjct  214  GLRVEKILSAATAAVTSFGMKEQNAGTAAGIPTQVVLAVDVGASSTDISLVSVLANKFEV  273

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITEN--------------QRALRRLRT  268
            KA   +  LGG+DF  R+V H  ++  R+      E                +   ++R 
Sbjct  274  KAVDSNLDLGGDDFTERIVTHCRRKKSREEAAAAPEPGDTVKTASSQTHGYSKGASQIRQ  333

Query  269  ACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRKTMEPVE  321
            ACE AK+ LSSS  A +       GIDF +       T+TR  FE +C D ++  +E V 
Sbjct  334  ACELAKKLLSSSENAVV-------GIDFPASDTFGYYTVTRFCFEALCEDLWQSLVEKVH  386

Query  322  KVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKE  361
            +V+ ++ + K  ++ V+L+GGS++IP++Q L  + F  ++
Sbjct  387  RVIHESSVVKEDINAVLLMGGSSQIPRLQTLFKESFPSQQ  426

>HYAP_01538
Length=130

 Score = 191 bits (486),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 89/93 (96%), Positives = 91/93 (98%), Gaps = 0/93 (0%)

Query  1   MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60
           MAQT SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
Sbjct  1   MAQTVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61  QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHW  93
           QVAMNAHNTVFDAKRLIGRKFSD +VQAD+KHW
Sbjct  61  QVAMNAHNTVFDAKRLIGRKFSDAVVQADVKHW  93

>PYIR_24220
Length=908

 Score = 210 bits (534),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 223/397 (56%), Gaps = 25/397 (6%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIG-DAAKNQVAMNAHN  68
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G DAA   VA+    
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAA--TVAVRRPQ  88

Query  69   TVFDA-KRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESKTFQPEEISS  125
            T +   +R +G     P V + ++  ++P+ +   A  +  I+++   + K F  EE+ +
Sbjct  89   TAYSQIRRFLGATPDHPQVVSLLQEEYFPYTLLQNAT-RGTISLEHDNK-KVFHAEELVA  146

Query  126  MVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  185
            MV    R++ +AF    VK+ VITVP++F+ +QRQA  DA  I+G+ VL +INE TAAA+
Sbjct  147  MVFSHARQITDAFAEAPVKDWVITVPSFFSQAQRQAMLDAAEISGVRVLSLINENTAAAL  206

Query  186  AYGLDKKGGE-RNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHL  231
             + +     E R +L +++G  +  VS+   +  +             F+V A A D +L
Sbjct  207  QHAVHSTFTEPRKILFYNMGSTSLQVSITEFKSEVVPDGFKKNKTVSGFQVLANAWDENL  266

Query  232  GGEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  289
            GG  FD +L +H  +EF +K  + +DI    R L ++R   ++ K  LS++ +  + + S
Sbjct  267  GGAKFDLQLAEHLAKEFNKKLGNGEDIRTIPRPLAKIRAQAKKTKIVLSANEEIPVVMQS  326

Query  290  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  349
            L+  +DF +++TR++FE++  D F +++EPV++ L  A LS S + E+ +VGG  R+PK+
Sbjct  327  LYKDMDFFTSMTRSKFEEINADLFARSLEPVKQALAKAGLSASDIDEIEIVGGGVRMPKI  386

Query  350  QQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            Q  L +FF+GK+    +N DEA+A G+  +AA LS +
Sbjct  387  QAQLKEFFSGKDLGVHLNGDEAMALGSAFRAANLSNS  423

>PHYSO_285382
Length=379

 Score = 199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 176/352 (50%), Gaps = 26/352 (7%)

Query  51   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSD----PIVQADIKHWPFKISS---GAGD  103
            E ++G  A+     +  +T+F+AKR IGR F D     +    +  + F +      A D
Sbjct  23   EVIVGRKARAHRTTDPTHTIFNAKRFIGRSFDDVGESEVDSNGVSPYEFTVKPVLDNAHD  82

Query  104  KPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQAT  162
                 + F G+     P +I S V+  +R +A  F+G  ++  AVI VP  FN  QR AT
Sbjct  83   GVCFALGFPGQQDCVTPVQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVDFNARQRDAT  142

Query  163  KDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEV  222
              A  +AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   V
Sbjct  143  VAAFRVAGLEVSRVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNGAISV  202

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEF----------------KRKHRKDITENQRALRRL  266
              T GD HLGGED D  L     +EF                ++    D T+    L  +
Sbjct  203  LDTLGDNHLGGEDVDALLTAWLVREFEAQIGSRITSRGVEGEEKSLDDDATDPPCTLAGV  262

Query  267  RTACERAKRTLSSSAQAYIEIDSLFDGIDFNSTI--TRARFEDMCGDYFRKTMEPVEKVL  324
            R A E  KR L+ +  A         G      +  +RA+FE++CG    +TM PV  VL
Sbjct  263  RRAAELLKRRLTDATTASATCVWSEGGSKARVEVKASRAQFEELCGPLLERTMIPVRDVL  322

Query  325  RDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
                +   ++  VVLVGGS+RIP V+Q L+  F  + P  +I+PD AVAYGA
Sbjct  323  EANNMETEEIDAVVLVGGSSRIPWVRQRLTTMFQDRAPLSTIDPDLAVAYGA  374

>H310_01493
Length=909

 Score = 209 bits (532),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 208/397 (52%), Gaps = 27/397 (7%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESK-TFQPEEISSM  126
                +RL+G   + P+V++ +K  ++P+ ++    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  187  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  229
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  230  HLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  287
             LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             SL   +DF S+  R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSSAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  348  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILS  384
            K+Q +L  +F  ++    +N DEA+A GA +  A LS
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>PPTG_14555
Length=703

 Score = 206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 173/551 (31%), Positives = 273/551 (50%), Gaps = 49/551 (9%)

Query  5    TSGYSVGIDLGTTYSCVGVWQNDRVEIIA-----NDQGNRTTPSYVAFTDT---ERLIGD  56
            T+  S+GID G T     V  +  V  +      N +   + PS+V+   T   E  +G 
Sbjct  39   TAECSIGIDFGRTKCEAAVVSDTGVATLIPLEPQNKENCYSLPSFVSMGVTRTGEWEVGL  98

Query  57   AAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGE-S  115
             A N+       TVFD   L+G+K    +   D+  W F + +G   K  +    KG   
Sbjct  99   QAINRAKAGHPYTVFDLTMLLGQKVK-ALSPQDVDRWAFNLQAGVAGKAVVECPAKGNVP  157

Query  116  KTFQPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  175
                PE++++M+L  ++  AE F  K V  AV+TVPA FN +QRQA  DA  IA LNV R
Sbjct  158  DLLYPEQVAAMLLSTIKNRAEIFTKKRVTGAVVTVPAAFNRTQRQAVWDACRIADLNVSR  217

Query  176  IINEPTAAAIAYGLDKKGG---ERNVLIFDLGGGTFDVSLLSIEE------GI-FEVKAT  225
            ++   TA+A+A  +        E+ +++ D G G  DV+L  + E      GI  EV+AT
Sbjct  218  LVISSTASAVADSIIDGAAAVFEKTIVVVDCGAGGLDVTLARVREADGSSSGIEVEVEAT  277

Query  226  AGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSAQAYI  285
            AG+  LGGE   +RL +HF  E K       T N    RRLR AC   +R LS+S QA I
Sbjct  278  AGNLELGGEALTDRLFEHFHNEVKAGDTSSKT-NPAFSRRLRRACALVQRILSTSQQAAI  336

Query  286  EIDSLFDG--------IDFNSTITRARFEDMCGDYFRKTME-PVEKVLRDAKLSKSQVHE  336
            ++     G          F S+I RA F+++CG      +   VE+VL  AK+ K  +  
Sbjct  337  DLPWRTRGPGAVNGTAAGFTSSIWRADFDNLCGSEVWDNLPITVEQVLTRAKVKKEDLDA  396

Query  337  VVLVGGSTRIPKVQQLLSDFFNGKEPNKSIN-PDEAVAYGATVQAAILSGNdsseklqdl  395
            V++ GG+ ++PK++++L D    +  N+ ++ P+   A GA++ AA  +G+        +
Sbjct  397  VLITGGAMKVPKLREVLGDCL-AEHWNRIMDLPEHTAAIGASMIAAQSTGH--------V  447

Query  396  llldvtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG---ERS  452
            L  + TPLSLG+ ++ G    ++  +T VPT ++Q +  YA  Q  +   + EG    RS
Sbjct  448  LKNEPTPLSLGIRSSSGDTLVVVPASTAVPTHQAQLY--YASCQREINFDILEGLTANRS  505

Query  453  ----MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  508
                  R  + LG+  +DG       V ++++ F +DA G   V   +KS  +  ++ ++
Sbjct  506  PGAAPNRLEHCLGRILVDGRRASTPLVLKLEIAFQLDATGRFTVVVSDKSNDRVTRLLVS  565

Query  509  NDKGRLSQAEI  519
             D+  L +  I
Sbjct  566  GDETCLQEEAI  576

>H310_01496
Length=904

 Score = 208 bits (530),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 207/397 (52%), Gaps = 27/397 (7%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESK-TFQPEEISSM  126
                +RL+G   + P+V++ +K  ++P+ ++    +  + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTH---NDTRGSVALKHDDQFTFHAEELVAM  145

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQ  205

Query  187  YGL----DKKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  229
            + L     + G    VL++++G  +  VSL+     I             FEV   A D 
Sbjct  206  HALAIETPQAGKPTRVLLYNMGSTSLQVSLVEYSSRIVPDGFKKNKTVIDFEVLGKAWDD  265

Query  230  HLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  287
             LGG  FD RL D F  EF  K +K  D+ +  RA+ +LR A  + K  LS++ +  + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDVRQVPRAMAKLRAAARKTKIVLSANEEIPVVV  325

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             SL   +DF S   R  FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRGEFEALCADLFGRALGPVEAVLKKTGLAKTDLDAIEIIGGGVRIP  385

Query  348  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILS  384
            K+Q +L  +F  ++    +N DEA+A GA +  A LS
Sbjct  386  KIQSVLKTYFE-RDLGLHLNGDEAMALGAALHGANLS  421

>HYAP_04460
Length=818

 Score = 206 bits (525),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 130/393 (33%), Positives = 207/393 (53%), Gaps = 18/393 (5%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +++   F     +     I + +  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  130  KMREVAEAFI-GKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A   G      V++ P Y+ D QRQA  +A  IAGLN LR++NE TA A+AYG
Sbjct  124  KMQHIAAAANEGVTPAYCVLSCPGYYTDVQRQALLNASKIAGLNCLRLMNEHTAIALAYG  183

Query  189  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNRLV  241
            + K           ++V+  D+G  ++ V++++  +G   VK+ A D  LGG DFD  + 
Sbjct  184  IYKSARNLFHETEPQHVMFIDVGHASYTVAVVAFVQGRLTVKSVAFDRFLGGRDFDLAIA  243

Query  242  DHFTQEFKRKHR--KDITENQRALRRLRTACERAKRTLSSS--AQAYIEIDSLFDGIDFN  297
                 +F  K++    +  N +A  +L +ACE+AK+ LS    +   + I+ L +  D+N
Sbjct  244  KDAAAKFADKYKVANPLENNPKARMKLLSACEKAKKNLSPYGVSATQLNIECLAEDRDYN  303

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            + +T   FE +      +   PVE+ L DA L  + +  V +VGG TR+  V++ L++  
Sbjct  304  AQVTLEEFEALIAPLLERLNGPVEQALADAGLKATDLTNVEIVGGGTRVTSVKRHLAEVL  363

Query  358  N-GKEP-----NKSINPDEAVAYGATVQAAILS  384
               KE      + ++N DE+VA G  +  AILS
Sbjct  364  GLDKEQQNYGLSSTLNADESVARGCALNCAILS  396

>PPTG_17083
Length=304

 Score = 194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 145/214 (68%), Gaps = 11/214 (5%)

Query  122  EISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  181
            EISSMV+++M+E+AEAF+G+ +  AV+T PAYFN+ QRQ+TKD  +I GL++ RI NE +
Sbjct  23   EISSMVVLRMKEMAEAFLGQRISQAVVTAPAYFNNQQRQSTKDVVSITGLDLQRINNETS  82

Query  182  AAAIAYGLDKKGGE----RNVLIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFD  237
             AA+AYGLD   G      NV IF LGGGT DVS+LSI     EVK+T GD+    ED D
Sbjct  83   VAALAYGLDTNAGTDGKACNVQIFVLGGGTVDVSILSIRVRHLEVKSTGGDS---AEDSD  139

Query  238  NRLVDHFTQEFKRKHRK-DITENQRALRRLRTACERAKRTLSSSAQAYIEIDSLFDGIDF  296
            N +V H   EF+RK R  D + + RA   + TACE AKR L ++  A +E+ SLF+G++F
Sbjct  140  NNMVQHLLTEFERKIRNLDPSGSARA--SVVTACESAKRMLLTTTSASVEVTSLFEGVEF  197

Query  297  NST-ITRARFEDMCGDYFRKTMEPVEKVLRDAKL  329
            +ST +TRA+FE +  + F +    V KVL DAK+
Sbjct  198  SSTVVTRAKFESLNEELFMRCEVTVFKVLEDAKM  231

>PYU1_G003764
Length=910

 Score = 204 bits (520),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/396 (32%), Positives = 214/396 (54%), Gaps = 23/396 (6%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  + + +     EI+ N    R T + VAF   ERL G  A           
Sbjct  31   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVSVRRPQTA  90

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESK-TFQPEEISSM  126
                +R +G     P V + ++  ++P+ +     ++ + T+  + ++K  F  EE+ +M
Sbjct  91   YSQIRRFLGATPDSPEVVSLLQEEYFPYTL---LKNETRGTISLEHDNKQVFHAEELVAM  147

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    R++ +AF    VK+ VITVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+ 
Sbjct  148  VFSHARQITDAFAEAPVKDWVITVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQ  207

Query  187  YGLDKKGGE-RNVLIFDLGGGTFDVSLLS-----IEEGI--------FEVKATAGDTHLG  232
            + +     E R +L +++G  +  VS+       I +G         F++ A A D  LG
Sbjct  208  HAVHSTFTEPRRILFYNMGSTSLQVSIAEFNSEVIPDGFKKNKTVSAFQMIANAWDETLG  267

Query  233  GEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDSL  290
            G  FD +L +H   EF +K    +D+    R L ++R   ++ K  LS++ +  + + SL
Sbjct  268  GAKFDLQLAEHLALEFNKKLGGDEDVRTLPRPLAKIRAQAKKTKIVLSANEEIPVVMQSL  327

Query  291  FDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQ  350
            +  IDF +T+TR++FE++  D F + + PV++VL  A L+ + + E+ ++GG  R+PK+Q
Sbjct  328  YKDIDFFTTMTRSKFEEINADLFARALNPVQQVLNKAGLTVNDIDEIEIIGGGVRMPKIQ  387

Query  351  QLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGN  386
            Q L +FFNGK+    +N DEA+A G+  +AA LS +
Sbjct  388  QRLKEFFNGKDLGVHLNGDEAMALGSAFRAANLSNS  423

 Score = 37.4 bits (85),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 3/85 (4%)

Query  533  DEANKVRIEAKNALENYAYSLRNSLNDEK-LKEKIPEADK-KVVDDKVTETIQWL-DAHQ  589
            D   K  +EAKN LE Y Y+ R++LN +    E++ + ++ + +  K+ ET +WL D  +
Sbjct  664  DNQRKANLEAKNRLETYVYNARDTLNAKADAIEQVTQPEQLEQLQTKLEETEEWLYDDGE  723

Query  590  SSEKEEYEAKQKELEGVANPVLQKV  614
              E  EY  K K+L+   + +L +V
Sbjct  724  KVEAAEYNKKIKDLDKDLSAILFRV  748

 Score = 33.1 bits (74),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 15/49 (31%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query  457  NNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVEKS  498
            N  +GKFN+ GI            G P++ ++F++D+NGI  ++  E +
Sbjct  513  NAHIGKFNITGIKAFAESMKDKNLGEPKVTLSFELDSNGIAKIAKAEAT  561

>H257_00287
Length=893

 Score = 202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/397 (32%), Positives = 205/397 (52%), Gaps = 27/397 (7%)

Query  11   GIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  +  + + +  +  EI+ N    R T + V+F   ERL G  A N       N 
Sbjct  29   GVDFGGEFFKIALVKPGKSFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQNA  88

Query  70   VFDAKRLIGRKFSDPIVQADIK--HWPFKISSGAGDKPQITVQFKGESK-TFQPEEISSM  126
                +RL+G   + P+V++  K  ++P+ ++    ++ + +V  K + + TF  EE+ +M
Sbjct  89   YSQIRRLLGTTVTHPLVESMTKSEYFPYTLTH---NETRGSVGLKHDDEHTFHAEELVAM  145

Query  127  VLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  186
            V    + +   F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ 
Sbjct  146  VFTHAKTITNEFAEGPVRDWVVTVPSYFAEAQRQAVIDAAEIAGIRVLSLIDENTAAALH  205

Query  187  YGLD----KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDT  229
            + L     + G    V+ +++G  +  VS++     I             FEV   + D 
Sbjct  206  HALSIDVPEVGKPTRVMFYNMGSTSLQVSVVEYTSRIVPDGFKKNKTIVDFEVLGKSWDE  265

Query  230  HLGGEDFDNRLVDHFTQEFKRKHRK--DITENQRALRRLRTACERAKRTLSSSAQAYIEI  287
             LGG  FD RL D F  EF  K +K  DI    RA+ +LR A  + K  LS++    + +
Sbjct  266  TLGGSQFDLRLADKFADEFNTKLKKGDDIRLVPRAMAKLRAAARKTKIVLSANEVIPVVV  325

Query  288  DSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIP  347
             SL   +DF S   R+ FE +C D F + + PVE VL+   L+K+ +  + ++GG  RIP
Sbjct  326  PSLHADLDFKSNAKRSEFEALCADLFGRVLGPVESVLQKTGLAKTDLSAIEIIGGGVRIP  385

Query  348  KVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILS  384
            K+Q LL  +F  ++    +N DEA+A GA    A LS
Sbjct  386  KIQSLLKGYFE-RDLGLHLNGDEAMALGAAFHGANLS  421

>SDRG_01828
Length=866

 Score = 201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 149/558 (27%), Positives = 260/558 (47%), Gaps = 61/558 (11%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            T S    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
                       +R +G     P+V +  + +++P+ ++     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHA  134

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEAPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  181  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  223
            TAAA+ + +D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHAVDYEAAEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEF--KRKHRKDITENQRALRRLRTACERAKRTLSSSA  281
            A A D  LGG  FD RL + F  EF  K K+  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLKNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  282  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  341
               + + SL   +D+    +R   E++  D F + +EPV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRTELEEIAADLFARVLEPVKSALDQAGLTVGDLSAVEIIG  374

Query  342  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvt  401
            G  RIPK+Q LL +F   ++  K +N DEA+A GA   AA LS +     +    +    
Sbjct  375  GGVRIPKIQALLQEFVQ-RDLGKRLNGDEAMALGAAFNAANLSTSFRVRHVGMTDISSFP  433

Query  402  plslglETAGGVM-------------TTLIARNTTVPTKKSQTFS-------TYADNQPG  441
                 ++ A                   L      +  KKS +FS       T+  ++P 
Sbjct  434  IGVRLVDLASHAADDDHPEAKHWVKRAALFGERQKLNVKKSVSFSHADDVSCTFRYDKPS  493

Query  442  VLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSA  494
             L Q           ++++ ++N+ GI    +       G P++ ++F++DA+G+ ++  
Sbjct  494  ALPQGV---------SSIISRYNITGIAAFAKKMEDKKLGEPKVTLSFNLDASGLASIVK  544

Query  495  VEKSTGKENKITITNDKG  512
             E +  +E ++     K 
Sbjct  545  AEATLDEEIEVPAPTKKA  562

>PHYCA_558934
Length=489

 Score = 194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 150/488 (31%), Positives = 247/488 (51%), Gaps = 39/488 (8%)

Query  54   IGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKG  113
            +G  A N        TVFD   L+G+K  + +   D+  WPF I +G   K  +    + 
Sbjct  11   VGKRAVNHAKAGHPYTVFDLTMLLGQKM-ESLSPQDMDRWPFTIRAGVAGKALVECPQRL  69

Query  114  ESKTF-QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLN  172
            +S     PE++++M+L  ++  AE F GK V  AV+TV A +N +QRQA +DA +IAGL+
Sbjct  70   QSPALVYPEQVAAMLLSTIKHRAETFTGKTVTRAVVTVSAAYNRTQRQALRDACSIAGLS  129

Query  173  VLRIINEPTAAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIE------EGIFEV  222
            V R++   TA+A+A            ++ +L+ D  G + +V+L S+       E   EV
Sbjct  130  VERLVVSSTASAVANAKSDTDATAVFDKTILVVD-SGASLNVTLASVNSNDNGAEVEVEV  188

Query  223  KATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRAL-RRLRTACERAKRTLSSSA  281
             ATAGD   GGE   +RL +HF QE   +     T +  A  RRLR AC  A+R LSS  
Sbjct  189  TATAGDVEAGGEPLTDRLFEHFLQEINAEDVNSETTSSPAFSRRLRRACTLAQRVLSSFP  248

Query  282  QAYIEIDSL-FDGIDFNSTITRARFEDMCG-DYFRKTMEPVEKVLRDAKLSKSQVHEVVL  339
            Q   ++  L      F STI+R+ F+ +CG + + +  E VE+VL+ A++ K  V  +++
Sbjct  249  QVSFDVPPLQLRRGWFTSTISRSEFDSLCGLELWNRLPETVERVLKLAQVKKEDVDAILV  308

Query  340  VGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllld  399
             GG+ ++PK +++L + F          P    A G    AA+++ N        +L  +
Sbjct  309  TGGAMQVPKFREVLGECFVEHWNRIKDLPKHTAAIG----AALIAKN-----NGYILKNE  359

Query  400  vtplslglETAGGVMTTLIARNTTVPTKKSQTFSTYADNQPGVLIQVFEG---------E  450
             T L+LG+ ++GG +  ++  +T VPT++S+ +  YA  Q  +   + EG          
Sbjct  360  PTSLALGIRSSGGDLLVIVPPSTCVPTRQSRVY--YASVQREIRFDILEGITEPDQEPTC  417

Query  451  RSMTRDNNL---LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITI  507
             S T  N L   LG+  +DG       + ++++TF++   G L V   + S  +  ++ +
Sbjct  418  NSGTAPNKLEHCLGRVTIDGRRASAPLILKLEITFEVGETGSLVVLISDSSNNRVTRMQV  477

Query  508  TNDKGRLS  515
              D+  LS
Sbjct  478  GGDETCLS  485

>PHYSO_339667
Length=160

 Score = 182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 0/152 (0%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTDT  L G+AAK Q   NA NT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
            VF+  +LIGRKFSDP +Q  I++WPFK+  G  D  Q+ VQ+KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  130  KMREVAEAFIGKEVKNAVITVPAYFNDSQRQA  161
            +MR++AE ++ +EV  AV+TVP  FN  QRQA
Sbjct  128  EMRKMAEIYLDQEVTKAVLTVPGSFNYFQRQA  159

>PYIR_18381
Length=747

 Score = 196 bits (499),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 126/393 (32%), Positives = 201/393 (51%), Gaps = 43/393 (11%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    +  NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQPEEISSMVLI  129
              D KRLIGRKF  P VQ +I    +K          I +++  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  130  KMREVAEAFIGK-EVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
            KM+ +A A         AV++VP Y+ D QR+A  +A  IA LN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAYG  183

Query  189  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEGIFEVKATAGDTHLGGEDFDNR  239
            + K    RN+         +  D+G  ++ VS+++  +G  +VK+ A D  LGG DFD  
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDYA  241

Query  240  LVDHFTQEFKRKHRKDITENQRALRRLRTACERAKRTLSSSA--QAYIEIDSLFDGIDFN  297
            L     + F+ K++ D   + ++  +L +ACE++K+ LS       Y+ I+ L D  D+N
Sbjct  242  LAKDAAKNFQDKYKIDPLADAKSRIKLLSACEKSKKNLSPQGVTATYLNIECLADDRDYN  301

Query  298  STITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFF  357
            S +T  +F+++           +E +L+             +VGG TR+  V++ LS+  
Sbjct  302  SQVTLEQFDEL-----------IEPLLQQ------------IVGGGTRVSSVKRRLSEIL  338

Query  358  NGKEP------NKSINPDEAVAYGATVQAAILS  384
               +       + ++N DE+VA G  +Q AI S
Sbjct  339  GLDKDAQNFGLSTTLNADESVARGCALQCAISS  371

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 83/172 (48%), Gaps = 23/172 (13%)

Query  460  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------KSTGKENKI  505
            +GKF + GIP + +G  +P+I V    D NG+ +VS+ +               GKE + 
Sbjct  469  IGKFTVSGIPELEKGAELPKIRVNVQQDVNGLFSVSSSQLMQEIKEEEKPAAEEGKEGEA  528

Query  506  TITND-----KGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENYAYSLRNSLNDE  560
               +      K R  + ++ ++ AE  K   +D   +     +N LE++ Y +RN ++D 
Sbjct  529  KADDKPAEPKKKRFRKVDL-KIHAEELKMAHQDRIIEETFNKRNELESFVYEMRNQVSD-  586

Query  561  KLKEKIPEADKKVVDDKVTETIQWL--DAHQSSEKEEYEAKQKELEGVANPV  610
            KL E I +A+K  ++DK+ E   WL  D    S K  Y+ K  E+    +P+
Sbjct  587  KLAEFITDAEKAAIEDKLNEVEDWLYSDEGFDSTKSVYQNKLDEMRENTSPI  638

>CCI11769
Length=372

 Score = 187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/361 (33%), Positives = 180/361 (50%), Gaps = 38/361 (11%)

Query  51   ERLIGDAAKNQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKI---------SSGA  101
            E L+G  A+     + H+T+++AKR IGR +++ I  A  K + F I         +S +
Sbjct  10   EILVGRQARAYRTKDPHHTIYNAKRFIGRSYNESIQAA--KPYGFSIEPIRNESATTSES  67

Query  102  GDKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFI-GKEVKNAVITVPAYFNDSQRQ  160
               P  ++   G      P +I S+++  +  +A  F+   ++   VI VP  F  +QR+
Sbjct  68   LPGPCFSLNVSGHPSCVSPIDIGSLIIRHLHSMAREFVKHNQLDRVVIAVPVDFKAAQRR  127

Query  161  ATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  220
            AT  A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL +  G  
Sbjct  128  ATVQAYEKAGLKVARVLEEPTAAAIAYGLHQTPNVNFILVFDFGGGTLDVSLLFVRSGSI  187

Query  221  EVKATAGDTHLGGEDFDNRLVDHFTQEFKRKHRKDITENQRALRR---------------  265
             V  T GD +LGGED DN + +H   + +      + E+   +                 
Sbjct  188  SVVDTLGDNNLGGEDLDNLVSNHLISQLEALIGMKLAESSSEVMETDSEKTEDPDQLPCT  247

Query  266  ---LRTACERAKRTLSSSAQAYIEIDSLFDGIDFNS-------TITRARFEDMCGDYFRK  315
               +R A E  KR LS +  A         G    +       +++R  FE +C     +
Sbjct  248  IAGIRRAAEILKRKLSYTHTAIASCIVQEPGGKLIAQDNRVEISMSRDEFETLCESILER  307

Query  316  TMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYG  375
             + PV ++LRD  +  + + EVVLVGGS+RIP +   L + F GK+P  +I+PD AVA+G
Sbjct  308  VLLPVRQILRDNNMDPNSIDEVVLVGGSSRIPWIHTQLEELF-GKQPRITIDPDVAVAFG  366

Query  376  A  376
            A
Sbjct  367  A  367

>SPRG_06288
Length=869

 Score = 195 bits (496),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 148/552 (27%), Positives = 260/552 (47%), Gaps = 63/552 (11%)

Query  4    TTSGYSVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV  62
            T S    G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  63   AMNAHNTVFDAKRLIGRKFSDPIVQA--DIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120
                       +R +G     P+V +  + +++P+ ++     +  + +Q   E  TF  
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLT-RGSVALQHSSE-HTFHA  134

Query  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180
            EE+++MV    +++   F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E 
Sbjct  135  EELAAMVFGHAKQITNDFAEGPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDEN  194

Query  181  TAAAIAYGLDKKGGERN----VLIFDLGGGTFDVSLLSIEEGI-------------FEVK  223
            TAAA+ +G+D +  E N    ++++++G  +  VS++  +  +             F+V 
Sbjct  195  TAAALHHGVDYEAPEPNTPERIMLYNMGSTSLQVSIVEYKTRVVPDGFKKNKTIVEFDVL  254

Query  224  ATAGDTHLGGEDFDNRLVDHFTQEFKRK--HRKDITENQRALRRLRTACERAKRTLSSSA  281
            A A D  LGG  FD RL + F  EF  K  +  D+ +  RA+ +LR A  + K  LS++ 
Sbjct  255  AKAWDETLGGAQFDLRLAEKFANEFNAKLTNGDDVRKIPRAMAKLRAAARKTKIVLSANE  314

Query  282  QAYIEIDSLFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVG  341
               + + SL   +D+    +RA  E++  D F + ++PV+  L  A L+   +  V ++G
Sbjct  315  AIPVIVPSLHADLDYKGHASRAELEEIAADLFARVLDPVKSALDQAGLTVGDLSAVEIIG  374

Query  342  GSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvt  401
            G  RIPK+Q LL  F   ++  K +N DEA+A GA   AA LS +     +    +    
Sbjct  375  GGVRIPKIQALLQAFVQ-RDLGKRLNGDEAMALGAAFNAANLSTSFRVRHVGMTDIASFP  433

Query  402  plslglETAGGVM-------------TTLIARNTTVPTKKSQTFS-------TYADNQPG  441
                 ++ A                   L      +  KKS +FS       T+  ++P 
Sbjct  434  VGVRLVDLASHAADDDHPEAKHWVKRAALFGERQKLNVKKSVSFSHADDVSCTFRYDKPS  493

Query  442  VL-IQVFEGERSMTRDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVS  493
             L + V          ++++ ++N+ GI    +       G P++ ++F++DA+G+ ++ 
Sbjct  494  ALPLGV----------SSIISRYNITGIEAFAKKMEDKKLGEPKVTLSFNLDASGLASIV  543

Query  494  AVEKSTGKENKI  505
              E +  +E ++
Sbjct  544  KAEATLEEEIEV  555

>HYAP_10418
Length=315

 Score = 184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 151/297 (51%), Gaps = 25/297 (8%)

Query  103  DKPQITVQFKGESKTFQPEEISSMVLIKMREVAEAFIGK-EVKNAVITVPAYFNDSQRQA  161
            D     +   G      P EI S ++  +R++A  F+G  ++  AVI VP  F+  QR  
Sbjct  16   DGVCFAINLDGHPDCITPVEIGSKIVRHLRDMAHRFVGHDQITKAVIAVPVDFDAKQRDD  75

Query  162  TKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  221
            T  +   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G   
Sbjct  76   TVASFRAAGLEVSRVLEEPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNGAIT  135

Query  222  VKATAGDTHLGGEDFDNRLVDHFTQEFKRK--------------HRKDITENQRALRRLR  267
            V  T GD HLGGED D  L     ++F+ +              H  D  E    L  +R
Sbjct  136  VLDTLGDNHLGGEDLDALLAAWLVKQFEAQLGSPITSRGTDADGHGNDDKELPCTLTGVR  195

Query  268  TACERAKRTLSSSAQAYIEIDSLFDGIDFNST--------ITRARFEDMCGDYFRKTMEP  319
             A E  KR L+ +  A      ++DG D  +         +TR +FE +CG    +TM P
Sbjct  196  RAAEFLKRQLTDAPTA--SASCVWDGADSQAVAKTRATVDMTRVQFEVLCGSLLERTMIP  253

Query  320  VEKVLRDAKLSKSQVHEVVLVGGSTRIPKVQQLLSDFFNGKEPNKSINPDEAVAYGA  376
            V KVL    +   ++  VVLVGGS+RIP V++ L+  F G+ P   I+PD AVAYGA
Sbjct  254  VRKVLEANNMESEEIDAVVLVGGSSRIPWVRERLTVMFQGRAPLSDIDPDLAVAYGA  310

>CCI45987
Length=939

 Score = 195 bits (496),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 243/531 (46%), Gaps = 53/531 (10%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNAHNT  69
            G+D G  Y  V + +     EI+ N    R T + VAF   ER+ G  A        H  
Sbjct  41   GLDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGEERIYGADADTIGVRRPHTG  100

Query  70   VFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGE-SKTFQPEEISSMVL  128
                +R +G     P V + +    F  +    +K + T+  + E  + +  EE+ +MV 
Sbjct  101  YAQIRRFLGSSLDHPGVLSLVTQEYFPYTLKLNEK-RGTIHLEHEIEQLYHAEEVVAMVF  159

Query  129  IKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  188
              +R++ + F   +VK+ VITVP Y+  +QRQA  DA  I+GL VL +INE TAAA+   
Sbjct  160  SHVRQITDVFAESDVKDYVITVPDYYTQAQRQAVLDAAEISGLRVLSLINENTAAALQLC  219

Query  189  LD---KKGGERNVLIFDLGGGTFDVSLLSIEEGI-------------FEVKATAGDTHLG  232
            +    +    + V+ ++LG  +  VS+      +             F V + A D HLG
Sbjct  220  IHTSMEPNERKRVMFYNLGSTSLQVSIAEFYSYVVPVGSSSNKTVIGFSVLSKAWDEHLG  279

Query  233  GEDFDNRLVDHFTQEFKRK---HRKDITENQRALRRLRTACERAKRTLSSSAQAYIEIDS  289
                D RL ++  + F  +   +++D+    + + +LR   ++ K  LS++ +  + + S
Sbjct  280  SSKIDLRLAEYLARVFNEQVLHNKQDVRTLPKVMAKLRAQAKKTKIVLSANEEIPVVMQS  339

Query  290  LFDGIDFNSTITRARFEDMCGDYFRKTMEPVEKVLRDAKLSKSQVHEVVLVGGSTRIPKV  349
            L D  D  + +TR   E++  D   + + PVE+ LR A L++  + +V L+GG  R+PKV
Sbjct  340  LLDDYDLRTVVTRTLLEEISKDLLDQVLGPVEEALRKANLTRGDIQDVELIGGGVRMPKV  399

Query  350  QQLLSDFFNGKEPNKSINPDEAVAYGATVQAAILSGNdsseklqdlllldvtplslglET  409
            Q LL +FFN +E    +N DEA+A GA  +AA LS +     +    +      +   + 
Sbjct  400  QSLLKEFFNVQELGAHLNGDEAMALGAAFRAANLSNSFRVRPIHMTDISTYAIGARLADI  459

Query  410  ------------AGGVMTT---LIARNTTVPTKKSQTFSTYADNQPGVLIQVFEGERSMT  454
                           + TT   L AR     T       T+  N+P  L +         
Sbjct  460  HLEDEKESTWAKHAPLFTTAHRLGARKAVSLTHARDMTCTFHYNEPSSLPKGV-------  512

Query  455  RDNNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVEKS  498
              +  +GKF++ GI            G P++ +TF +D++GI+++   E +
Sbjct  513  --STHIGKFSITGIKDFYTQHLEKNLGEPKVSLTFSLDSSGIVSIIKAEAT  561

 Score = 36.6 bits (83),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 8/129 (6%)

Query  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549
            L+V  VE+  G+ N I          +++  +++ E E   + D   K  ++AKN LE +
Sbjct  646  LSVKLVEERLGENNAIMSILPMSSSDKSDSIKLLREME---AADNKRKANLDAKNRLEAF  702

Query  550  AYSLRNSL---NDEKLKEKIPEADKKVVDDKVTETIQWL-DAHQSSEKEEYEAKQKELEG  605
             YS R+SL    D   +  +PE    ++  K+    +WL +    +E  EY+AK  E+E 
Sbjct  703  VYSARDSLESDQDAISQVTLPEQVNAIL-IKLEAAEEWLYEDGDKAEASEYQAKLSEIET  761

Query  606  VANPVLQKV  614
              + +L +V
Sbjct  762  ELDAILFRV  770

Lambda      K        H        a         alpha
   0.314    0.132    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 51382793868

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40