Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_47825391691696402e-85
PITG_0001191601694794e-61
PPTG_1667292861994583e-56
PHYCA_50470692531984398e-54
PHYKE_57209221873332e-38
PHALS_1083592641923251e-36
HYAP_015139248932936e-32
PYVX_158639181652068e-20
PYU1_G00322593697227661547e-12
PYIW_234919369721235701.9
PYAP_1727210297518299682.9
PHALS_108371110861654.1
PYVX_1539778583931667.4
PHYCA_1044361018166657.6
SDRG_171107861201844668.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_478253

Length=170
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_478253                                                          251        2e-85
PITG_00011                                                            189        4e-61
PPTG_16672                                                            181        3e-56
PHYCA_504706                                                          173        8e-54
PHYKE_5720                                                            132        2e-38
PHALS_10835                                                           129        1e-36
HYAP_01513                                                            117        6e-32
PYVX_15863                                                            84.0       8e-20
PYU1_G003225                                                          63.9       7e-12
PYIW_23491                                                            31.6       1.9  
PYAP_17272                                                            30.8       2.9  
PHALS_10837                                                           29.6       4.1  
PYVX_15397                                                            30.0       7.4  
PHYCA_104436                                                          29.6       7.6  
SDRG_17110                                                            30.0       8.0  

>PHYSO_478253
Length=169

 Score = 251 bits (640),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 169/169 (100%), Positives = 169/169 (100%), Gaps = 0/169 (0%)

Query  1    MRAIGGLFKRKSIDADDPMAPSDSEAsqrpstsrwsrwsqshrqsLpeapmevtavavpe  60
            MRAIGGLFKRKSIDADDPMAPSDSEASQRPSTSRWSRWSQSHRQSLPEAPMEVTAVAVPE
Sbjct  1    MRAIGGLFKRKSIDADDPMAPSDSEASQRPSTSRWSRWSQSHRQSLPEAPMEVTAVAVPE  60

Query  61   aapIQENEPPAPSSPVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQP  120
            AAPIQENEPPAPSSPVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQP
Sbjct  61   AAPIQENEPPAPSSPVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQP  120

Query  121  ELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF  169
            ELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF
Sbjct  121  ELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF  169

>PITG_00011
Length=160

 Score = 189 bits (479),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 131/169 (78%), Gaps = 9/169 (5%)

Query  1    MRAIGGLFKRKSIDADDPMAPSDSEAsqrpstsrwsrwsqshrqsLpeapmevtavavpe  60
            MRAIGGLFKRK  DADD  APSDSEASQR ++             LPEAP++V AVA PE
Sbjct  1    MRAIGGLFKRKCSDADDATAPSDSEASQRRTSRWSRWSHSHRGS-LPEAPLDVAAVAAPE  59

Query  61   aapIQENEPPAPSSPVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQP  120
             APIQEN+        KQSPTDPS LLLA  DS DE  AEP RVSFLFFGGSD DSTFQP
Sbjct  60   TAPIQENDS------TKQSPTDPSDLLLA--DSSDESGAEPQRVSFLFFGGSDTDSTFQP  111

Query  121  ELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF  169
            ELRPSELDDLH+N+IRPSLQ KMPLFFSPPLVENMRRSSILPDPKEYEF
Sbjct  112  ELRPSELDDLHQNDIRPSLQAKMPLFFSPPLVENMRRSSILPDPKEYEF  160

>PPTG_16672
Length=286

 Score = 181 bits (458),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 138/199 (69%), Gaps = 33/199 (17%)

Query  1    MRAIGGLFKRKSIDADDPMAPSDSEAsqrpstsrwsrwsqshrqsLpeapmevtavavpe  60
            MRAIGGLFKRK+ D DD M PSDSEASQR ++              PEAP+EV AVA PE
Sbjct  91   MRAIGGLFKRKASDVDDAMEPSDSEASQRRTSRWSRWSHSHRGS-FPEAPLEVAAVAAPE  149

Query  61   aapIQENE----------PPAP---------------SSPV-----KQSPTDPSALLLAG  90
             APIQENE          PPA                +SP+     KQSPTDPS LL+A 
Sbjct  150  TAPIQENESAASSPHPDEPPAKKVKKATVEHPTTEKKASPLSFNKTKQSPTDPSELLMA-  208

Query  91   VDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPP  150
             DS DE  AEP RVSFLFFGGSDVDSTFQPELRPSELDDLHEN+IRPSLQ KMPLFFSPP
Sbjct  209  -DSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKMPLFFSPP  267

Query  151  LVENMRRSSILPDPKEYEF  169
            LVE+MRRSSILPDPKEYEF
Sbjct  268  LVEHMRRSSILPDPKEYEF  286

>PHYCA_504706
Length=253

 Score = 173 bits (439),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 133/198 (67%), Gaps = 32/198 (16%)

Query  1    MRAIGGLFKRKSIDADDPMAPSDSEAsqrpstsrwsrwsqshrqsLpeapmevtavavpe  60
            MRAIGGLFKRKS DADD  APSDSEASQR ++        +    +PEAP+EV AVA PE
Sbjct  59   MRAIGGLFKRKSSDADDATAPSDSEASQRRTSRWSRWSHSNRGS-MPEAPLEVAAVAEPE  117

Query  61   aapIQENEPPA-----------------------------PSSPVKQSPTDPSALLLAGV  91
             APIQENE  A                             PS   KQSPTDPSAL+ +G 
Sbjct  118  TAPIQENESVASSPHMEEPPAKKVKKVKAEKPKKEAKIKPPSFNTKQSPTDPSALVASG-  176

Query  92   DSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPPL  151
             S D    EP R+SFLFFGGSD DSTFQPELRPSE D+LHEN+IRPSLQ KMPLFFSPP+
Sbjct  177  -SSDGSVVEPQRISFLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKMPLFFSPPM  235

Query  152  VENMRRSSILPDPKEYEF  169
            VENMRRSSILPDPKEYEF
Sbjct  236  VENMRRSSILPDPKEYEF  253

>PHYKE_5720
Length=221

 Score = 132 bits (333),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)

Query  83   PSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVK  142
            P  LL A  +S DE  AEPAR+SFLFFGGSD +STF P+LRPS+LDDLHEN++RPSLQ K
Sbjct  135  PELLLAAESESGDEYGAEPARLSFLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAK  194

Query  143  MPLFFSPPLVENMRRSSILPDPKEYEF  169
            MP FFSPP+VE+MRRSSILPDP+EYEF
Sbjct  195  MPQFFSPPVVEHMRRSSILPDPREYEF  221

 Score = 38.9 bits (89),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)

Query  1   MRAIGGLFKRKSIDADDPMAPSDSEA  26
           +RAIGGLFKR+S DA+   APSDSE+
Sbjct  22  IRAIGGLFKRRSSDANGLSAPSDSES  47

>PHALS_10835
Length=264

 Score = 129 bits (325),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 114/192 (59%), Gaps = 26/192 (14%)

Query  1    MRAIGGLFKRKSIDADDPMAPSDSEAsqrpstsrwsrwsqshrqsLpeapmevtavavpe  60
            MRAIGG F+R   DAD    P DSE+SQR ++       QS  ++ P   +    +    
Sbjct  76   MRAIGGFFRRNCSDADSDTRPHDSESSQRRTSRWSHSHRQSMPEA-PSTVVVQEILETTR  134

Query  61   aapIQENEPPAPS-----------------------SPVKQSPTDPSALLLAGVDSDDEM  97
            +    ENEP   S                       SP +QSPT+ S +L A +   DE+
Sbjct  135  SQNAAENEPLTKSPHTEEPPVKKVKKDKPKKAKNTPSPTEQSPTETSEMLSATLV--DEL  192

Query  98   PAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRR  157
              E  RVSFLFFGGSDVD TFQPELRPSELDDLHEN+IRPSLQ KMPLF  PPL +N+RR
Sbjct  193  GVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMPLFLPPPLPKNVRR  252

Query  158  SSILPDPKEYEF  169
            SSILPDP+EYEF
Sbjct  253  SSILPDPEEYEF  264

>HYAP_01513
Length=248

 Score = 117 bits (293),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 68/93 (73%), Gaps = 0/93 (0%)

Query  77   KQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIR  136
            K SPTD S LL A   S +E   +P RVSFL FGGS+VDSTF+PEL PSE DD+H +EIR
Sbjct  156  KPSPTDSSELLRAESSSGNESNVDPLRVSFLIFGGSEVDSTFEPELHPSEYDDVHGSEIR  215

Query  137  PSLQVKMPLFFSPPLVENMRRSSILPDPKEYEF  169
            P LQ KMPLFFS PL E +RRSS   DPKEYE 
Sbjct  216  PVLQNKMPLFFSLPLAERLRRSSAKSDPKEYEL  248

>PYVX_15863
Length=181

 Score = 84.0 bits (206),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 1/65 (2%)

Query  106  FLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSIL-PDP  164
            FLF+GGSDVD  F+P+LRPS LD +  + IRP ++  MP+FFS P  EN+RRSSIL  DP
Sbjct  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176

Query  165  KEYEF  169
            +EYEF
Sbjct  177  REYEF  181

>PYU1_G003225
Length=227

 Score = 63.9 bits (154),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 2/66 (3%)

Query  106  FLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPPLV-ENM-RRSSILPD  163
            FLF+ GS  D++F+PE   S + ++  N IRPSL ++MP+FFSPP    N  RRSSIL D
Sbjct  126  FLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSILTD  185

Query  164  PKEYEF  169
            P+EYE 
Sbjct  186  PREYEL  191

>PYIW_23491
Length=212

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  103  RVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRP  137
            R  F F+ GS  D++F+PE   S + ++  N IRP
Sbjct  141  RYQFHFYSGSAEDNSFKPERVHSTVAEIDYNTIRP  175

>PYAP_17272
Length=182

 Score = 30.8 bits (68),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 17/99 (17%)

Query  75   PVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGSDVDSTFQPE----------LRP  124
            P  +  TD S  L AG   D ++  EP R  F  FG S +  T +P           LRP
Sbjct  36   PRHRHDTDRSGNLPAGTVIDSKV-VEPRRFDFYLFGHSGILGTSRPAHYTALLNENGLRP  94

Query  125  SELDDLHENEIR------PSLQVKMPLFFSPPLVENMRR  157
             EL+ L  +          S+ V  P++++  L E  R 
Sbjct  95   IELEQLCFDLCHMFGRSTRSVSVVAPVYYAKILAERARH  133

>PHALS_10837
Length=108

 Score = 29.6 bits (65),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 30/61 (49%), Gaps = 1/61 (2%)

Query  91   VDSDDEMPAEPARVSFLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPP  150
            V   ++M +   R  F+FF GSD  +    +   S  + + E   +P +  +MP+F  PP
Sbjct  35   VCQSNDMSSSTERQQFVFFCGSDASAVPSGDY-ASFHNSILEATAQPVIDHRMPVFIMPP  93

Query  151  L  151
            L
Sbjct  94   L  94

>PYVX_15397
Length=839

 Score = 30.0 bits (66),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  133  NEIRPSLQVKMPLFFSPPLVENMRRSSILPD  163
            +EIR  ++V+ PL+F P  + N   SS LPD
Sbjct  157  SEIRQEMKVQQPLYFQPSPMRNKSSSSDLPD  187

>PHYCA_104436
Length=181

 Score = 29.6 bits (65),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 26/66 (39%)

Query  103  RVSFLFFGGSDVDSTFQPELRPSELDDLHENEIR-------------------PSLQVKM  143
            +V FLF+GGSD  +       P+ +  LH+N  R                   P +  +M
Sbjct  85   QVQFLFYGGSDPPT-------PNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEM  137

Query  144  PLFFSP  149
            P FFSP
Sbjct  138  PCFFSP  143

>SDRG_17110
Length=2018

 Score = 30.0 bits (66),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 4/44 (9%)

Query  69   PPAPSSPVKQSPTDPSALLLAGVDSDDEMPAEPARVSFLFFGGS  112
            PP PSSP K    DPSA L    D++ ++ A+ AR+S +    S
Sbjct  533  PPRPSSPAK----DPSAELRKLYDANTQLQADVARLSAVVAASS  572

Lambda      K        H        a         alpha
   0.317    0.137    0.399    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6387092082

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40