Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_4715231475634834816710.0
PHYRA_811001475634934915060.0
PITG_184561475635135114730.0
PPTG_171271475635135114720.0
PHYCA_5561621475635135114630.0
PHALS_064781475634534813620.0
PHYKE_83931475632635112291e-169
PYU1_G001735147563423529002e-119
PYAP_17762147563483578898e-118
PYIR_13451147563593648664e-114
PYVX_18171147562943347813e-102
PYIW_19971147563483627751e-100
PYAR_13570147563223276992e-89
CCA18899147563433286464e-81
CCI45123147563013064982e-59
SPRG_06336147563353354777e-56
SDRG_01781147563353344541e-52
H257_06294147563583534021e-44
H310_09223147563333363904e-43
CCI451271609872022082522e-24
PYAR_23286161286071231431e-08
HYAP_086451612815141161342e-07
PYU1_G0063471612810951151323e-07
PHYRA_849161612815411071323e-07
PHYSO_3617471612815231161315e-07
PYIW_17381161289521331297e-07
PPTG_188981612815591071262e-06
PITG_205621612815591071252e-06
PYIR_215891612815681321218e-06
PHYKE_19901612814991071209e-06
PHYKE_247914459171531149e-06
SPRG_060581612812581301191e-05
PYU1_G00106314459783681182e-05
SDRG_127631251091317361172e-05
PYVX_204381612813461111172e-05
PYAP_1729014459835361162e-05
PYIW_1317214459939351162e-05
PYIR_1530914459937351162e-05
H257_067221612814821181163e-05
H257_067211251091238401153e-05
CCI44752161281526441154e-05
PYIR_17453951126191131154e-05
H310_0023012510912481221145e-05
PYVX_1357414459950351135e-05
CCI4122514459981351136e-05
PYAR_1991414459788351136e-05
SPRG_060591251091312361136e-05
PHALS_0653314459930561111e-04
CCA18875161281514441111e-04
PYAP_169971612810181191101e-04
H310_002311612814951221101e-04
PHYRA_7783414459936341101e-04
PYIW_21108951125931301101e-04
PPTG_1340114459927351101e-04
PITG_1806714459924351101e-04
PHYCA_503112152926214341061e-04
CCA1648714459975351092e-04
CCI42457152926906351082e-04
CCA17102152926884351082e-04
SDRG_12762161281392401064e-04
CCI10489158709777511055e-04
PHYRA_825431526711991471030.001
PPTG_193711526711951861030.001
SDRG_0556781959801551020.001
SPRG_0602181959831131000.002
PYU1_G00884815267765133990.003
PHYSO_544598152671163148980.004
PITG_11303931829334960.004
CCA21715241778251970.005
CCA2186015507878251970.005
PYIR_18382152671154133970.005
PHALS_0669914313884133970.005
PITG_19213152671201163970.006
H257_0336112342869960960.006
PHALS_035401690479960.006
PYVX_18338241774645960.007
PHYSO_344112241781337960.007
PHYCA_506137241781037960.007
PYIW_18480241775537960.007
PHYRA_79281241780937960.007
PITG_02762241781037960.007
PPTG_05519241781037960.007
PHYSO_3436291445997730960.007
HYAP_08026241779837960.007
PHYSO_55616414313765135950.008
PYAP_22646241781537950.009
PYAP_18636152671009180950.010
H310_063781445983735950.010
PHYKE_5678241780937940.010
PITG_1789314313747118940.011
PHALS_04098152671183161940.011
H257_135671445983635940.012
H310_077012417811171940.012
PYIW_1698715267821114940.012
SDRG_088001445988135940.013
CCI3936728852046121940.015
SPRG_1702213189210739860.016
SDRG_00080124544298109910.017
PYU1_G004386241783742930.017
PPTG_0455314313904118920.018
PYAR_15463152671091110920.019
PHALS_03645241783042920.019
SPRG_054491445972335920.019
PHYRA_7353514313875135920.020
PYIR_13120241781437920.020
CCA18023152671138126920.021
H257_0309315267975110920.021
H257_0982314313654110910.023
PITG_0210618501015143920.024
PYAR_19883241783337910.024
CCI46235152671155114920.024
SPRG_16312131322261108890.026
PPTG_14630185339856900.027
PYVX_13312152671016110910.028
PYU1_G0092499511258057910.031
SDRG_0560811092121127850.031
H310_0484315267968110900.034
PYIW_20891185329156880.036
H257_051751643067873900.037
PYAP_1673481951314113900.037
SPRG_091281431362030900.038
SDRG_05150241778739900.040
SDRG_0140715267815176890.042
SDRG_048711643068755890.042
CCI40991241780152890.043
SPRG_082171643068755890.044
SPRG_08346241779739890.044
PYIW_1987356695185123860.047
H310_1362714313678110890.047
PITG_02109185352256880.050
H310_046671643068073890.051
PYVX_2334914313924114890.053
PHYKE_666215267765163880.057
H310_070709639680117880.058
PHYCA_504801185339856870.058
PHYRA_73534696861210131880.058
HYAP_061012885984113880.060
SPRG_0250211092121125820.064
PYAP_161619866188939870.078
H257_02642640397551870.083
H310_140199204683106860.096
HYAP_0445715267120357870.097
SDRG_142861431367030860.097
SPRG_0089015267883167860.11
H310_0091295112182124860.11
PYIW_1961312330131471860.11
PYVX_14593185096450860.12
PYU1_G012870185335256850.12
HYAP_0640312330103766860.13
PYIR_144941681952850.13
H310_06666863288734850.13
PYAR_2606510677931460840.13
SPRG_0293995112161181850.14
HYAP_0930413479114432850.14
PYAR_157921109212142800.14
H257_06469219447630770.15
SPRG_143129639661119850.15
PYIW_2190185060913114850.15
PYIR_2147316430667148850.16
CCA268906147153062850.16
PYU1_G0007249278718936820.16
H257_07514241781037850.16
PYVX_2343212330151060840.18
PYU1_G0032291681084840.19
H257_039319639695118840.21
PHYRA_944092885127035840.21
PHYSO_2484812885128335840.21
PITG_033182885134335840.21
PPTG_160442885137835840.22
CCA1551328851341114840.22
PHYKE_491118534632730.23
CCI43793134791117125830.23
SPRG_119001660547830.24
PPTG_1462618501055116830.24
PHYKE_7856288534632820.24
PHYSO_34998318501320122830.24
SDRG_062881664157830.25
SPRG_0275212342883157830.26
SDRG_1448712342896459830.26
PYAP_136951853348135820.27
H310_0666713886889635830.28
H257_01308863289734830.28
PHYRA_830719511230058830.30
PPTG_1171495112444147830.31
PHALS_06336185251156820.31
PPTG_1898913479121332820.31
PYAR_14615863251734820.32
PYVX_199821643070055820.32
SDRG_0215412656882256820.33
PHYRA_7343218501313124820.34
HYAP_137571151726231800.36
PHYKE_4910185237547810.36
H310_144737490613136810.37
PHALS_0793013479120032820.38
PHALS_06568185338856810.39
PYAR_166741643065155810.40
PYIR_131682885135335810.40
PHYRA_8194413479114932810.41
PYAP_234788506089730810.44
PYAP_237441109212342760.44
SPRG_14955749063564810.45
SDRG_08236863286433810.46
PYIW_2194428851317108810.47
SPRG_01860863267433800.49
PYU1_G0095089576532832800.49
PYU1_G01081856695169112770.49
PITG_175941408869455800.50
PYU1_G0128591850118365810.50
PYIR_2337215835141536810.50
PHYSO_478611185352256800.52
PYIR_1511813479122232800.52
PYAR_134918195108030800.53
PHALS_055872885136136800.55
PYIW_1891113479119632800.56
CCI434561109212652750.56
PYIW_1757181951330113800.56
PHYRA_72718379732124790.64
PYIW_150141643070255790.65
H310_048421395771081146800.67
PYVX_145276030126956800.68
SPRG_00889122518994110790.69
PYVX_1308413479126771790.69
CCA27255157810112537790.70
SDRG_14070749063054790.72
PYAR_192918506071158790.76
PHALS_063341850106436790.77
PYAR_1342937969475790.77
PYAR_186909511245569790.78
PYU1_G0122741583587336790.79
PHALS_080978195106932790.80
PHYCA_5054411643069455790.82
SPRG_0883412656882556790.83
HYAP_1368818501036112790.85
SPRG_00364122272255111770.89
PHYSO_3047841643069455780.90
SDRG_08383123078132159790.90
CCI109286147153070790.91
PPTG_161741643069355780.91
PHYRA_845671643069655780.91
SDRG_01408122518916110780.91
PYAP_1956011517337134770.92
SPRG_04912124544261106770.94
PYIR_1678061471352196780.94
PITG_210261643069455780.95
PYIR_2458885060909110780.96
CCA190339511188334780.97
H310_01921185334166770.97
SPRG_1587113098310186720.99
PPTG_166591691670781.0
PHALS_027391643064855781.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_471523

Length=349
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_471523                                                          648        0.0   
PHYRA_81100                                                           584        0.0   
PITG_18456                                                            572        0.0   
PPTG_17127                                                            571        0.0   
PHYCA_556162                                                          568        0.0   
PHALS_06478                                                           529        0.0   
PHYKE_8393                                                            478        1e-169
PYU1_G001735                                                          351        2e-119
PYAP_17762                                                            347        8e-118
PYIR_13451                                                            338        4e-114
PYVX_18171                                                            305        3e-102
PYIW_19971                                                            303        1e-100
PYAR_13570                                                            273        2e-89 
CCA18899                                                              253        4e-81 
CCI45123                                                              196        2e-59 
SPRG_06336                                                            188        7e-56 
SDRG_01781                                                            179        1e-52 
H257_06294                                                            159        1e-44 
H310_09223                                                            154        4e-43 
CCI45127                                                              101        2e-24 
PYAR_23286                                                            59.7       1e-08 
HYAP_08645                                                            56.2       2e-07 
PYU1_G006347                                                          55.5       3e-07 
PHYRA_84916                                                           55.5       3e-07 
PHYSO_361747                                                          55.1       5e-07 
PYIW_17381                                                            54.3       7e-07 
PPTG_18898                                                            53.1       2e-06 
PITG_20562                                                            52.8       2e-06 
PYIR_21589                                                            51.2       8e-06 
PHYKE_1990                                                            50.8       9e-06 
PHYKE_2479                                                            48.5       9e-06 
SPRG_06058                                                            50.4       1e-05 
PYU1_G001063                                                          50.1       2e-05 
SDRG_12763                                                            49.7       2e-05 
PYVX_20438                                                            49.7       2e-05 
PYAP_17290                                                            49.3       2e-05 
PYIW_13172                                                            49.3       2e-05 
PYIR_15309                                                            49.3       2e-05 
H257_06722                                                            49.3       3e-05 
H257_06721                                                            48.9       3e-05 
CCI44752                                                              48.9       4e-05 
PYIR_17453                                                            48.9       4e-05 
H310_00230                                                            48.5       5e-05 
PYVX_13574                                                            48.1       5e-05 
CCI41225                                                              48.1       6e-05 
PYAR_19914                                                            48.1       6e-05 
SPRG_06059                                                            48.1       6e-05 
PHALS_06533                                                           47.4       1e-04 
CCA18875                                                              47.4       1e-04 
PYAP_16997                                                            47.0       1e-04 
H310_00231                                                            47.0       1e-04 
PHYRA_77834                                                           47.0       1e-04 
PYIW_21108                                                            47.0       1e-04 
PPTG_13401                                                            47.0       1e-04 
PITG_18067                                                            47.0       1e-04 
PHYCA_503112                                                          45.4       1e-04 
CCA16487                                                              46.6       2e-04 
CCI42457                                                              46.2       2e-04 
CCA17102                                                              46.2       2e-04 
SDRG_12762                                                            45.4       4e-04 
CCI10489                                                              45.1       5e-04 
PHYRA_82543                                                           44.3       0.001 
PPTG_19371                                                            44.3       0.001 
SDRG_05567                                                            43.9       0.001 
SPRG_06021                                                            43.1       0.002 
PYU1_G008848                                                          42.7       0.003 
PHYSO_544598                                                          42.4       0.004 
PITG_11303                                                            41.6       0.004 
CCA21715                                                              42.0       0.005 
CCA21860                                                              42.0       0.005 
PYIR_18382                                                            42.0       0.005 
PHALS_06699                                                           42.0       0.005 
PITG_19213                                                            42.0       0.006 
H257_03361                                                            41.6       0.006 
PHALS_03540                                                           41.6       0.006 
PYVX_18338                                                            41.6       0.007 
PHYSO_344112                                                          41.6       0.007 
PHYCA_506137                                                          41.6       0.007 
PYIW_18480                                                            41.6       0.007 
PHYRA_79281                                                           41.6       0.007 
PITG_02762                                                            41.6       0.007 
PPTG_05519                                                            41.6       0.007 
PHYSO_343629                                                          41.6       0.007 
HYAP_08026                                                            41.6       0.007 
PHYSO_556164                                                          41.2       0.008 
PYAP_22646                                                            41.2       0.009 
PYAP_18636                                                            41.2       0.010 
H310_06378                                                            41.2       0.010 
PHYKE_5678                                                            40.8       0.010 
PITG_17893                                                            40.8       0.011 
PHALS_04098                                                           40.8       0.011 
H257_13567                                                            40.8       0.012 
H310_07701                                                            40.8       0.012 
PYIW_16987                                                            40.8       0.012 
SDRG_08800                                                            40.8       0.013 
CCI39367                                                              40.8       0.015 
SPRG_17022                                                            37.7       0.016 
SDRG_00080                                                            39.7       0.017 
PYU1_G004386                                                          40.4       0.017 
PPTG_04553                                                            40.0       0.018 
PYAR_15463                                                            40.0       0.019 
PHALS_03645                                                           40.0       0.019 
SPRG_05449                                                            40.0       0.019 
PHYRA_73535                                                           40.0       0.020 
PYIR_13120                                                            40.0       0.020 
CCA18023                                                              40.0       0.021 
H257_03093                                                            40.0       0.021 
H257_09823                                                            39.7       0.023 
PITG_02106                                                            40.0       0.024 
PYAR_19883                                                            39.7       0.024 
CCI46235                                                              40.0       0.024 
SPRG_16312                                                            38.9       0.026 
PPTG_14630                                                            39.3       0.027 
PYVX_13312                                                            39.7       0.028 
PYU1_G009249                                                          39.7       0.031 
SDRG_05608                                                            37.4       0.031 
H310_04843                                                            39.3       0.034 
PYIW_20891                                                            38.5       0.036 
H257_05175                                                            39.3       0.037 
PYAP_16734                                                            39.3       0.037 
SPRG_09128                                                            39.3       0.038 
SDRG_05150                                                            39.3       0.040 
SDRG_01407                                                            38.9       0.042 
SDRG_04871                                                            38.9       0.042 
CCI40991                                                              38.9       0.043 
SPRG_08217                                                            38.9       0.044 
SPRG_08346                                                            38.9       0.044 
PYIW_19873                                                            37.7       0.047 
H310_13627                                                            38.9       0.047 
PITG_02109                                                            38.5       0.050 
H310_04667                                                            38.9       0.051 
PYVX_23349                                                            38.9       0.053 
PHYKE_6662                                                            38.5       0.057 
H310_07070                                                            38.5       0.058 
PHYCA_504801                                                          38.1       0.058 
PHYRA_73534                                                           38.5       0.058 
HYAP_06101                                                            38.5       0.060 
SPRG_02502                                                            36.2       0.064 
PYAP_16161                                                            38.1       0.078 
H257_02642                                                            38.1       0.083 
H310_14019                                                            37.7       0.096 
HYAP_04457                                                            38.1       0.097 
SDRG_14286                                                            37.7       0.097 
SPRG_00890                                                            37.7       0.11  
H310_00912                                                            37.7       0.11  
PYIW_19613                                                            37.7       0.11  
PYVX_14593                                                            37.7       0.12  
PYU1_G012870                                                          37.4       0.12  
HYAP_06403                                                            37.7       0.13  
PYIR_14494                                                            37.4       0.13  
H310_06666                                                            37.4       0.13  
PYAR_26065                                                            37.0       0.13  
SPRG_02939                                                            37.4       0.14  
HYAP_09304                                                            37.4       0.14  
PYAR_15792                                                            35.4       0.14  
H257_06469                                                            34.3       0.15  
SPRG_14312                                                            37.4       0.15  
PYIW_21901                                                            37.4       0.15  
PYIR_21473                                                            37.4       0.16  
CCA26890                                                              37.4       0.16  
PYU1_G000724                                                          36.2       0.16  
H257_07514                                                            37.4       0.16  
PYVX_23432                                                            37.0       0.18  
PYU1_G003229                                                          37.0       0.19  
H257_03931                                                            37.0       0.21  
PHYRA_94409                                                           37.0       0.21  
PHYSO_248481                                                          37.0       0.21  
PITG_03318                                                            37.0       0.21  
PPTG_16044                                                            37.0       0.22  
CCA15513                                                              37.0       0.22  
PHYKE_4911                                                            32.7       0.23  
CCI43793                                                              36.6       0.23  
SPRG_11900                                                            36.6       0.24  
PPTG_14626                                                            36.6       0.24  
PHYKE_7856                                                            36.2       0.24  
PHYSO_349983                                                          36.6       0.24  
SDRG_06288                                                            36.6       0.25  
SPRG_02752                                                            36.6       0.26  
SDRG_14487                                                            36.6       0.26  
PYAP_13695                                                            36.2       0.27  
H310_06667                                                            36.6       0.28  
H257_01308                                                            36.6       0.28  
PHYRA_83071                                                           36.6       0.30  
PPTG_11714                                                            36.6       0.31  
PHALS_06336                                                           36.2       0.31  
PPTG_18989                                                            36.2       0.31  
PYAR_14615                                                            36.2       0.32  
PYVX_19982                                                            36.2       0.32  
SDRG_02154                                                            36.2       0.33  
PHYRA_73432                                                           36.2       0.34  
HYAP_13757                                                            35.4       0.36  
PHYKE_4910                                                            35.8       0.36  
H310_14473                                                            35.8       0.37  
PHALS_07930                                                           36.2       0.38  
PHALS_06568                                                           35.8       0.39  
PYAR_16674                                                            35.8       0.40  
PYIR_13168                                                            35.8       0.40  
PHYRA_81944                                                           35.8       0.41  
PYAP_23478                                                            35.8       0.44  
PYAP_23744                                                            33.9       0.44  
SPRG_14955                                                            35.8       0.45  
SDRG_08236                                                            35.8       0.46  
PYIW_21944                                                            35.8       0.47  
SPRG_01860                                                            35.4       0.49  
PYU1_G009508                                                          35.4       0.49  
PYU1_G010818                                                          34.3       0.49  
PITG_17594                                                            35.4       0.50  
PYU1_G012859                                                          35.8       0.50  
PYIR_23372                                                            35.8       0.50  
PHYSO_478611                                                          35.4       0.52  
PYIR_15118                                                            35.4       0.52  
PYAR_13491                                                            35.4       0.53  
PHALS_05587                                                           35.4       0.55  
PYIW_18911                                                            35.4       0.56  
CCI43456                                                              33.5       0.56  
PYIW_17571                                                            35.4       0.56  
PHYRA_72718                                                           35.0       0.64  
PYIW_15014                                                            35.0       0.65  
H310_04842                                                            35.4       0.67  
PYVX_14527                                                            35.4       0.68  
SPRG_00889                                                            35.0       0.69  
PYVX_13084                                                            35.0       0.69  
CCA27255                                                              35.0       0.70  
SDRG_14070                                                            35.0       0.72  
PYAR_19291                                                            35.0       0.76  
PHALS_06334                                                           35.0       0.77  
PYAR_13429                                                            35.0       0.77  
PYAR_18690                                                            35.0       0.78  
PYU1_G012274                                                          35.0       0.79  
PHALS_08097                                                           35.0       0.80  
PHYCA_505441                                                          35.0       0.82  
SPRG_08834                                                            35.0       0.83  
HYAP_13688                                                            35.0       0.85  
SPRG_00364                                                            34.3       0.89  
PHYSO_304784                                                          34.7       0.90  
SDRG_08383                                                            35.0       0.90  
CCI10928                                                              35.0       0.91  
PPTG_16174                                                            34.7       0.91  
PHYRA_84567                                                           34.7       0.91  
SDRG_01408                                                            34.7       0.91  
PYAP_19560                                                            34.3       0.92  
SPRG_04912                                                            34.3       0.94  
PYIR_16780                                                            34.7       0.94  
PITG_21026                                                            34.7       0.95  
PYIR_24588                                                            34.7       0.96  
CCA19033                                                              34.7       0.97  
H310_01921                                                            34.3       0.97  
SPRG_15871                                                            32.3       0.99  
PPTG_16659                                                            34.7       1.0   
PHALS_02739                                                           34.7       1.0   
PHYKE_1044                                                            34.7       1.0   
CCA25510                                                              34.7       1.0   
SDRG_02135                                                            34.3       1.1   
PHYSO_506918                                                          34.7       1.1   
PHYRA_73430                                                           34.3       1.1   
CCA19118                                                              32.7       1.1   
PHALS_12503                                                           34.3       1.1   
PYAP_22685                                                            34.7       1.2   
CCI47145                                                              34.3       1.2   
PHYSO_489872                                                          34.7       1.2   
SPRG_02010                                                            34.3       1.2   
PHYSO_484541                                                          34.3       1.2   
SDRG_03531                                                            33.9       1.3   
PYU1_G007423                                                          34.3       1.3   
H310_09363                                                            34.3       1.3   
PHYRA_78815                                                           34.3       1.3   
PITG_13665                                                            32.3       1.3   
PITG_11578                                                            34.3       1.3   
PHALS_07062                                                           32.3       1.3   
PHYKE_7347                                                            32.3       1.3   
PYIR_13555                                                            33.9       1.4   
PHYSO_289146                                                          32.3       1.4   
PITG_10462                                                            34.3       1.4   
CCA24531                                                              33.9       1.4   
H257_10847                                                            34.3       1.4   
PHYCA_510506                                                          32.3       1.4   
PHYSO_558498                                                          34.3       1.4   
PHALS_09729                                                           34.3       1.5   
PPTG_19631                                                            32.3       1.5   
SDRG_17208                                                            34.3       1.5   
PYU1_G008119                                                          32.3       1.5   
PPTG_08785                                                            34.3       1.5   
PYU1_G009243                                                          33.9       1.5   
PHYCA_564296                                                          33.9       1.6   
PHYSO_529931                                                          34.3       1.6   
PYIR_15407                                                            32.3       1.6   
PHYRA_85100                                                           32.3       1.6   
PHYRA_85097                                                           32.3       1.6   
PHYRA_82040                                                           33.9       1.6   
PYIW_26522                                                            32.3       1.6   
HYAP_02360                                                            32.3       1.6   
PYAR_23366                                                            33.9       1.6   
PYVX_15906                                                            32.3       1.6   
PYAP_22195                                                            33.9       1.7   
H257_01309                                                            33.9       1.7   
PHYSO_319942                                                          33.1       1.8   
H257_08182                                                            33.9       1.8   
PYAR_16228                                                            33.9       1.8   
H257_00729                                                            32.0       1.9   
PYIW_18491                                                            33.9       1.9   
H257_13346                                                            33.5       2.0   
PITG_20103                                                            33.9       2.1   
HYAP_13267                                                            33.5       2.1   
PPTG_10755                                                            33.5       2.1   
PYU1_G006732                                                          33.5       2.1   
PYVX_16714                                                            33.5       2.1   
SDRG_14771                                                            33.5       2.2   
PHYRA_76931                                                           33.5       2.2   
H310_05692                                                            33.5       2.2   
PPTG_09983                                                            33.5       2.2   
PYAR_25500                                                            33.5       2.2   
CCI45857                                                              33.5       2.3   
PITG_00416                                                            33.5       2.3   
H310_01094                                                            32.0       2.3   
H257_09270                                                            33.5       2.3   
PITG_09930                                                            33.5       2.3   
PITG_16799                                                            33.5       2.3   
PYIW_14463                                                            32.7       2.3   
H310_02133                                                            33.5       2.4   
PYAP_24144                                                            33.5       2.4   
H257_03363                                                            33.1       2.4   
PPTG_19153                                                            33.5       2.5   
PHYRA_83768                                                           33.5       2.5   
PHYRA_77033                                                           33.5       2.5   
PYIR_16539                                                            33.5       2.6   
H310_08803                                                            33.5       2.6   
HYAP_02230                                                            33.5       2.6   
CCA23572                                                              33.5       2.6   
CCA24252                                                              33.1       2.7   
H257_09028                                                            33.1       2.7   
PPTG_04299                                                            33.5       2.7   
PHALS_01010                                                           33.1       2.8   
SDRG_12776                                                            33.1       2.8   
PYVX_17890                                                            32.7       2.8   
SDRG_07086                                                            33.1       2.9   
PITG_07134                                                            33.1       3.0   
PYIR_18236                                                            33.1       3.0   
PYAP_18434                                                            33.1       3.1   
PYU1_G002632                                                          33.1       3.2   
PYAR_24323                                                            33.1       3.3   
PHYCA_556081                                                          33.1       3.3   
PYAP_13647                                                            32.3       3.3   
SDRG_14486                                                            32.7       3.4   
H310_01510                                                            33.1       3.4   
H310_13911                                                            32.7       3.4   
SPRG_02753                                                            32.7       3.4   
H257_11786                                                            32.7       3.5   
PPTG_13492                                                            32.7       3.6   
HYAP_07348                                                            32.7       3.7   
H257_03095                                                            32.7       3.8   
H257_09269                                                            32.7       4.0   
SPRG_11536                                                            32.7       4.1   
H257_03521                                                            32.7       4.2   
PYVX_14287                                                            32.7       4.2   
PYVX_16095                                                            32.7       4.3   
SDRG_07085                                                            32.7       4.3   
H310_05457                                                            32.0       4.5   
PHALS_03335                                                           32.3       4.5   
PYU1_G000461                                                          32.0       4.5   
H310_05691                                                            32.7       4.6   
HYAP_08248                                                            32.3       4.7   
PHALS_09273                                                           32.3       4.8   
CCI45895                                                              32.3       5.0   
H257_16349                                                            32.0       5.0   
PHYKE_5588                                                            32.3       5.2   
H257_05679                                                            32.0       5.5   
PHYCA_539981                                                          32.3       5.5   
SPRG_09211                                                            32.3       5.5   
PYVX_22589                                                            32.3       5.6   
PYIW_17818                                                            32.3       5.6   
PYU1_G011261                                                          32.3       5.7   
SDRG_00756                                                            32.3       6.0   
PHYRA_84786                                                           32.0       6.1   
PITG_03652                                                            32.0       6.4   
PHYRA_77134                                                           32.0       6.5   
PHYCA_504712                                                          31.2       6.6   
PYIR_23012                                                            32.0       6.7   
SDRG_15262                                                            32.0       6.7   
SPRG_11537                                                            32.0       6.8   
H257_00263                                                            32.0       6.9   
CCA19097                                                              32.0       7.0   
PYIW_23724                                                            32.0       7.1   
PYAP_16658                                                            31.6       7.1   
PHYSO_478442                                                          32.0       7.2   
H310_12448                                                            32.0       7.3   
PYU1_G000226                                                          31.6       7.4   
SPRG_01654                                                            32.0       7.4   
H310_00209                                                            32.0       7.5   
HYAP_11295                                                            31.6       7.8   
SPRG_03722                                                            32.0       7.9   
PPTG_07800                                                            30.8       7.9   
PITG_00020                                                            32.0       7.9   
SDRG_03175                                                            32.0       8.0   
PYAR_16120                                                            32.0       8.1   
SPRG_06273                                                            31.6       8.2   
PHYSO_485120                                                          30.0       8.3   
PYAP_17850                                                            32.0       8.3   
PHYKE_2581                                                            31.6       8.6   
H257_06698                                                            31.6       8.6   
SDRG_01838                                                            31.6       9.1   
H310_02933                                                            31.6       9.2   
HYAP_08916                                                            31.2       9.2   
SPRG_09805                                                            31.6       9.3   
SDRG_15907                                                            31.6       9.5   
PYAP_16966                                                            30.4       9.6   
PPTG_06823                                                            31.6       9.8   
PHALS_06636                                                           31.6       9.9   

>PHYSO_471523
Length=348

 Score = 648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/348 (100%), Positives = 348/348 (100%), Gaps = 0/348 (0%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFsddsrpkasaskasspqrsqqsgrpprlppAMDSINDAGVSDLERLAQALGELEV  300
            TLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELEV
Sbjct  241  TLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELEV  300

Query  301  QAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            QAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF
Sbjct  301  QAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PHYRA_81100
Length=349

 Score = 584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/349 (85%), Positives = 318/349 (91%), Gaps = 1/349 (0%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILRVPE+GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVL+GSNL +SYYESRAAC
Sbjct  1    MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HPP  EPSAPKGSFYLSSIEPHEYVVGVMGAA KPFGFKM+GHAP+KGYVELDVFVET  
Sbjct  61   HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVS N+KNLFGF +SLSPQP M+PQKQMQTLT++
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  180

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +DELLS ALRDIEAAK VGREACNEIV QGEKLDAIEQDL AIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFsddsr-pkasaskasspqrsqqsgrpprlppAMDSINDAGVSDLERLAQALGELE  299
            TLHLFSDDSR    ++   S  +  Q  G P RLPPAM++INDAGVSDLERLAQALGELE
Sbjct  241  TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE  300

Query  300  VQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            VQAE+LNGEAGR TQQIER+EHQLSNVTARVEKQTKQASA L +GP+LF
Sbjct  301  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PITG_18456
Length=351

 Score = 572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/351 (83%), Positives = 312/351 (89%), Gaps = 3/351 (1%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILRVPE GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNL VSYYESRAAC
Sbjct  1    MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HPP G+PSAPKG FYLSSIEPHEYVVGVMGAA+KPFGFKMVGHAP+KGYVELDVFV+TL 
Sbjct  61   HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVARNAL AKRQLTRQAIDQSVSP +KNLFGF++SLSPQP MSPQKQ+QTL+KS
Sbjct  121  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  180

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +DELLS ALR++EAAK VGREACNEIV QGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFsddsrpkasaskasspqrsqqsgrpprlpp---AMDSINDAGVSDLERLAQALGE  297
            TLHLFSDDSRPK++ S   S  +               A++  +DAGVSDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  300

Query  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            LEVQAELLNGEAGR +QQIERIEH L+NVT RVEKQTKQASA L +GPRLF
Sbjct  301  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PPTG_17127
Length=351

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/351 (82%), Positives = 308/351 (88%), Gaps = 3/351 (1%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILRVPE G TASGDKARPTSCEGYVTKRGHFRKSWRVRFLV+DGSNL VSYYESRAAC
Sbjct  1    MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAA+KPFGFKMVGHAP+KGYVELDVFV+TL 
Sbjct  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVARNALS KRQLTRQAIDQSVSPN+K LFGF+++LSPQP MSPQKQMQTL KS
Sbjct  121  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  180

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +DELLS+ALR++EAAK VGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFsddsrpkasaskasspqrsqqsgrpprlpp---AMDSINDAGVSDLERLAQALGE  297
            TLHLFSDDSRPK++     S  +               A D+ +DAG SDLERLAQALGE
Sbjct  241  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  300

Query  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            LEVQAE+LNGEA   +QQIERIEH L+NVT RVEKQTKQASA L +GPRLF
Sbjct  301  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYCA_556162
Length=351

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/351 (82%), Positives = 311/351 (89%), Gaps = 3/351 (1%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILRVPEVGA  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNL V+YYESRAAC
Sbjct  1    MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HP TGE S PKGSFYLSSIEPHEYVVGVMGAA KPFGFKMVGHAP+KGYVELDVFVET+ 
Sbjct  61   HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVARNALSAKRQLTRQAIDQSVSPN+KNLFGF++SLSPQP +SPQKQMQTLTK+
Sbjct  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  180

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            +D+LLSDALRDIEAAKQ+GREACNEIV QGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP
Sbjct  181  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240

Query  241  TLHLFsddsrpkasaskassp---qrsqqsgrpprlppAMDSINDAGVSDLERLAQALGE  297
            TLH+FS+DSRPK+++S  ++     +      P RL  A +S  D G SDLERLAQALGE
Sbjct  241  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  300

Query  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            LE+QAELLN EAG  TQQI+ IEH LS VT RVEKQTKQASA L +GPRLF
Sbjct  301  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PHALS_06478
Length=345

 Score = 529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/348 (77%), Positives = 290/348 (83%), Gaps = 3/348 (1%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGSNL V+YYESRAAC
Sbjct  1    MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HPP GE + PKGSFYLS+IEPHEYV+GVMGAA++PFGFKMVGHAPRKG+VELDVFVET  
Sbjct  61   HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVA NAL AKRQLTRQAIDQSVSPN+K LFGF++  S QP MSPQKQMQTL  S
Sbjct  121  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            ++ LL +ALR+IEAAK VGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  181  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240

Query  241  TLHLFsddsrpkasaskasspqrsqqsgrpprlppAMDSINDAGVSDLERLAQALGELEV  300
            TLH F   S                 S  P RL PA++   DAGVSDL+RLAQALGELEV
Sbjct  241  TLHFF---SDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEV  297

Query  301  QAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            QAELLN E+G  +QQIERIEH LS+VT RVEKQTKQA A L +GPRLF
Sbjct  298  QAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PHYKE_8393
Length=326

 Score = 478 bits (1229),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 250/351 (71%), Positives = 276/351 (79%), Gaps = 28/351 (8%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            MNILRVPEVGATASGDKARPTSCEGYVTKRGHF                          C
Sbjct  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHF-------------------------PC  35

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
            HPP GE  A KGSFYLS+I PHEYVVGVMGAA+KPFGFKMVGHAPRKGYVELDVFVETL+
Sbjct  36   HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  95

Query  121  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  180
            DRNKWLEVARNAL AKRQ+ RQAIDQSVSP +K +FGF +SLSPQP + PQKQ+Q LT +
Sbjct  96   DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  155

Query  181  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  240
            ++ELL++ALR++EAAK VGREACNEIV QGEKLD++E DL AIDRDLDFGDKLLRRLK+P
Sbjct  156  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  215

Query  241  TLHLFsddsrpkasaskasspqrsqqsgrpprlpp---AMDSINDAGVSDLERLAQALGE  297
            TLHLFSDD+RPK+ A+   S  +               +M S NDA  SDLERLA ALGE
Sbjct  216  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  275

Query  298  LEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            LE+QAELLNGEAGR TQQI RIE QLSNVTARVEKQTKQASA L +GPRLF
Sbjct  276  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>PYU1_G001735
Length=342

 Score = 351 bits (900),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 245/352 (70%), Gaps = 21/352 (6%)

Query  1    MNILRVPEVGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++L VSY+ESR A
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  60   CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETL  119
             H P    + PKGSFY+SS+E HEY +GVMG  EKPFGFK+VGHAP KGY+ELD+FVE+L
Sbjct  61   AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  120  NDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTK  179
             D NKWLEV +NAL A ++LTR+ +  S     K++FGF  S+SPQ       Q++ L  
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVKKLAA  167

Query  180  SRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239
            +++ELL +ALR+IE AK +GREA NEIV+QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  168  TKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227

Query  240  PTLHLFsddsrpkasaskasspqrsqqsgrpprlppAMDS-----INDAG--VSDLERLA  292
            P LH+FS+D+R K  A  A++   S  +          +      I   G  ++DLE LA
Sbjct  228  PVLHVFSNDNRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  293  QALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSG  344
             AL ELE QA L+N EA R T+QI RIE +L++V  RV+ QTK+A+A + +G
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339

>PYAP_17762
Length=348

 Score = 347 bits (889),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 247/357 (69%), Gaps = 28/357 (8%)

Query  1    MNILRVPEVGATA----------SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLN  50
            MNILR+P +GAT+               +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L 
Sbjct  1    MNILRLP-LGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  59

Query  51   VSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYV  110
            VSYY+S+          + PKGSFYLSS+E HEY VGV+GA EKPFGFKMVGHAPRKGYV
Sbjct  60   VSYYDSKEVARTAG---AVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  116

Query  111  ELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSP  170
            ELD+FVETL D NKWLEV +NAL A ++LTR    ++++P  K+LFGF+      P  SP
Sbjct  117  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSP  168

Query  171  QKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFG  230
            Q+QM+ +T +++++L  A+ +IE+AK +GR AC EI  QGE+LD I Q+L+ ++ DLD+ 
Sbjct  169  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYA  228

Query  231  DKLLRRLKSPTLHLFsddsrpkasaskasspqrsqqsgrpprlppAM------DSINDAG  284
            DKLLR +K+P LH+FS D+R +A  +  + P              A       D++  A 
Sbjct  229  DKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAP  288

Query  285  VSDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAAL  341
            +SD+ERLA  LGELE QA LLN EA +GT Q+ER+  QL++V  RV+ QT++A+A++
Sbjct  289  LSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345

>PYIR_13451
Length=359

 Score = 338 bits (866),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 188/364 (52%), Positives = 238/364 (65%), Gaps = 28/364 (8%)

Query  1    MNILRVPEVGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NL V+YY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  55   ESRAACHPPTGEPS----APKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYV  110
            ESR A    +         PKGSFY+SS+E HEY VGVMG  EKPFGFK+VGHAP+KGY+
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  111  ELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSP  170
            ELD+FVE+L D NKW+EV +NAL A ++ +R    Q  S   K +FGF+ S SPQ     
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT-KTMFGFSASASPQL----  175

Query  171  QKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFG  230
              Q++ L  ++++LL DALR+IE AK +GREA NEIV QGEKLD +E DL  ++ DLD  
Sbjct  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233

Query  231  DKLLRRLKSPTLHLFsddsrpkasaskasspqrsqqsgrpprlppAMDSI----------  280
            DKLLR +K P LHLFS D R K S     +   + ++                       
Sbjct  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQR  293

Query  281  NDAGVSDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAA  340
            NDA +SDLE+LA ALGELE QA L+N EA + T+QI R+E +L+ V  RV+ QTK+A+A 
Sbjct  294  NDA-LSDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANAT  352

Query  341  LDSG  344
            + +G
Sbjct  353  MKAG  356

>PYVX_18171
Length=294

 Score = 305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 213/334 (64%), Gaps = 53/334 (16%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            RPTSCEGYVTKRGHFRKSWRVR+LVLDG++L V+Y+ES+ A        +A KG FYLSS
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  65

Query  79   IEPHEYVVGVMGAA---EKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSA  135
            I+ H YV G MGA    EKPFGFKMVGHAP+KGY ELD+FVETL D  KWLEVA NAL +
Sbjct  66   IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125

Query  136  KRQLTRQAI-DQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEA  194
               ++R+A  D   S   K+LFGF+ +       SPQ+Q++ ++ S+DELL DALR++E 
Sbjct  126  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  179

Query  195  AKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsddsrpkas  254
            AK +GREAC E+V QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL          
Sbjct  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLL---------  230

Query  255  askasspqrsqqsgrpprlppAMDSINDAGVSDLERLAQALGELEVQAELLNGEAGRGTQ  314
                     ++   RPP     + +  D G + LE+L+                    TQ
Sbjct  231  ---------ARDLRRPPSPTKTLSNAGD-GRAALEQLS--------------------TQ  260

Query  315  QIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348
            QI RIE +L+ V  RV++QTKQA++ +  G  +F
Sbjct  261  QIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYIW_19971
Length=348

 Score = 303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/362 (49%), Positives = 232/362 (64%), Gaps = 35/362 (10%)

Query  1    MNILRVPEVGATAS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            MNILRVP++    S    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++L  +    
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  57   RAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFV  116
             +         + PKGSF++SS+E HEY VGVMG  EKPFGFK+VGHAP+KGY+ELD+FV
Sbjct  61   ASP--------ATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112

Query  117  ETLNDRNKWLEVARNALSAKRQLTRQ--AIDQSVSPNRKNLFGFNISLSPQPNMSPQKQM  174
            ETL D NKW+EV +NAL A ++ TR   A D S +   KN+FGF+ ++SPQ       Q+
Sbjct  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTT---KNMFGFSATVSPQL------QV  163

Query  175  QTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLL  234
            + L  +++ELL DALR+IE AK +GREA ++I  QG KL+ IE DL  ++ DLD G KLL
Sbjct  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223

Query  235  RRLKSPTLHLFsddsrpkasaskasspqrsqqsgrpprlppAMDSINDAG----------  284
              +K P LHLFS+D+R K +A  + S    +             S   A           
Sbjct  224  NHMKRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDT  283

Query  285  --VSDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALD  342
              +SDLERL  ALGELE QA  +N EA + T+QI R+E +L+ V  RV+ QTK+A+A + 
Sbjct  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMK  343

Query  343  SG  344
            +G
Sbjct  344  AG  345

>PYAR_13570
Length=322

 Score = 273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 222/327 (68%), Gaps = 34/327 (10%)

Query  36   SWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKP  95
            SWRVR+LVL+G++L VSY++S+     P    ++PKGSFYLSS+E HEYVVGV+GA +KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPG---ASPKGSFYLSSVEKHEYVVGVLGAQKKP  64

Query  96   FGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNL  155
            FGFKMVGHAPRKGYVELD+FVE+  D  KWLEV ++AL+A ++LTR  +  + S   K+L
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAST--KSL  122

Query  156  FGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQG-----  210
            FGF+      P  SPQKQ+Q L+ S++ELL  A+ +IE+AK +GREAC EIV QG     
Sbjct  123  FGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRG  176

Query  211  ----------EKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsddsrpkasaskass  260
                      EKLD IE +L  +D DLD+GDKLL  LKSP L+LFS D+R K SAS A S
Sbjct  177  RLTSGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHS  236

Query  261  pqrsqqsgrpprlppAMDSIN------DAGVSDLERLAQALGELEVQAELLNGEAGRGTQ  314
            P +S+QS          D++          +SD+ERLA  LGELE QA LLN EA RGT 
Sbjct  237  PVKSKQSALSSAARA--DALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTT  294

Query  315  QIERIEHQLSNVTARVEKQTKQASAAL  341
            Q+ER+   L+++  RV+ QTK+A +A+
Sbjct  295  QVERVGDALAHINERVQNQTKKADSAV  321

>CCA18899
Length=343

 Score = 253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/328 (42%), Positives = 195/328 (59%), Gaps = 19/328 (6%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            PTSCEGYVTKRGHFRKSWRVR+LV+ G N+ VSYYES+ +      + + PKGSF L S 
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDS---SKSKNATPKGSFILQSA  71

Query  80   EPHEYVVGVM---GAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAK  136
            E HEY +  M      EKPFGFKMVGHAP++GY+ELDVFV++ +D ++WL+V  N L A 
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  137  RQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAK  196
            + + R+A    +    K++ GF+         + ++Q+Q L   + + + +AL+ IE AK
Sbjct  132  KCMAREAFMAEMDTT-KSVLGFSY-----IGTTSKQQIQVLKSKKCDYIHEALQQIEMAK  185

Query  197  QVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsddsrpkasas  256
              G  AC+EIV+QGE+L  +EQ+LS I  DL+  +KL++ ++ P  + FS       +  
Sbjct  186  SAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATI  245

Query  257  kasspqrsqqsgrpprlppAMDSIND-------AGVSDLERLAQALGELEVQAELLNGEA  309
              SS                 D   D          +D+E+LA AL +LEVQA+L+N EA
Sbjct  246  SKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEA  305

Query  310  GRGTQQIERIEHQLSNVTARVEKQTKQA  337
             +  +QI RIE QLS +  R++ QT Q 
Sbjct  306  VKSNEQIARIEGQLSGINDRIQAQTSQV  333

>CCI45123
Length=301

 Score = 196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 175/306 (57%), Gaps = 26/306 (8%)

Query  49   LNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVM---GAAEKPFGFKMVGHAP  105
            + VSYYES+ +        + PKGSF L ++E HEY +  M      E+PFGFKMVGHAP
Sbjct  1    MQVSYYESKDSY---KNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAP  57

Query  106  RKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQ  165
            ++GYVELDVFV++L++ ++WL+V  N L A +++ R+A    +    K + GF+ +    
Sbjct  58   KQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTT-KGVLGFSFA----  112

Query  166  PNMSPQKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDR  225
               + ++Q++ L   + + + +AL+ IE AK  G  AC+EIV QGE+L  +EQ+LS I+ 
Sbjct  113  -GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIES  171

Query  226  DLDFGDKLLRRLKSPTLHLFsddsrpkasaskasspqrsqqsgrpprlppAMDSINDAGV  285
            DL+  +KL++ ++ P  + FS     +  A   ++        +   L       ND  +
Sbjct  172  DLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRK---NDGKI  228

Query  286  -----------SDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQT  334
                       +DLE+LA AL ELEVQA+L+N EA +   QI RIE QLS +  R++ QT
Sbjct  229  EHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQT  288

Query  335  KQASAA  340
             Q  A+
Sbjct  289  TQVVAS  294

>SPRG_06336
Length=335

 Score = 188 bits (477),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 119/335 (36%), Positives = 178/335 (53%), Gaps = 29/335 (9%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            + TSCEGYVTKRGH  KSWR R++VLDG  L VSYY+S+        +    KGSF L+ 
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAE  65

Query  79   IEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQ  138
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL   + 
Sbjct  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KN  121

Query  139  LTRQA-IDQSVSP--NRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAA  195
            +T QA +DQ  S     +   GF   L+  P      Q++ + K+++ELL  A+  +E A
Sbjct  122  VTPQASVDQRASALLGHRAPSGF---LTSAP-----VQLRNVNKTKEELLRKAIVTLEHA  173

Query  196  KQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsd--------  247
            + VG    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS         
Sbjct  174  RTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGT  233

Query  248  ---dsrpkasaskasspqrsqqsgrpprlppAMDSINDAGVSDLERLAQALGELEVQAEL  304
                S+   S    +                A  +  DAG  +L++L++ L  LEV A  
Sbjct  234  GSPKSKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANT  293

Query  305  LNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASA  339
            ++ E  R T+QI+RI+ ++     R+ +Q+ +  A
Sbjct  294  ISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328

>SDRG_01781
Length=335

 Score = 179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/334 (35%), Positives = 171/334 (51%), Gaps = 27/334 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSS  78
            + TSCEGYVTKRGH  KSWR R++VLDG  L VSY++S+        +    KGSF L+ 
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAE  65

Query  79   IEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQ  138
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL  K  
Sbjct  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GKNV  122

Query  139  LTRQAIDQSVSP--NRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAK  196
              + + DQ  +     +   GF   L+  P      Q++ + K+++ELL  A+  +E A+
Sbjct  123  APQASADQRATALLGHRAASGF---LTSAP-----VQLRNVNKTKEELLRKAIVTLEHAR  174

Query  197  QVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsddsrpkasas  256
             VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS     K  A 
Sbjct  175  TVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAG  234

Query  257  kasspqrs-----------qqsgrpprlppAMDSINDAGVSDLERLAQALGELEVQAELL  305
               S                                DAG  +L++L++ L  LEV A  +
Sbjct  235  SPKSKSARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTI  294

Query  306  NGEAGRGTQQIERIEHQLSNVTARVEKQTKQASA  339
            + E  R T+QI+RI+ ++     RV +Q+ +  A
Sbjct  295  STEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328

>H257_06294
Length=358

 Score = 159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/353 (33%), Positives = 179/353 (51%), Gaps = 34/353 (10%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL  76
            K   TSCEGYVTKRGH  KSW+ R++VL+G  L VSYY+S+   +   G    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSK-EIYTSKGH---PKGSFVL  62

Query  77   SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL---  133
            S  E  +  +   GA+ KPFGFK +GH P +GY E  V+VE+  D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKN  120

Query  134  SAKRQLTRQAIDQSVSP-----------NRKNLFGFNI---SLSPQPNMSPQKQMQTLTK  179
            S+ ++   Q I++   P            R+++          S     S + QM+ + K
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  180  SRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239
            +  ELL  A+ D + A ++G    NE+V Q + L+  E  +  + R +D  + L R LK 
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  240  PTL----HLFsddsrpkasaskasspqrsqqsgrpprlppA-------MDSINDAGVSDL  288
            P L    HLF+     K     + + +   ++ R  R+            +        L
Sbjct  241  PILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQL  300

Query  289  ERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAAL  341
            ++L++ L +L   A+ ++    R T+Q++RI+ ++++V  RV+K+ K   A L
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVL  353

>H310_09223
Length=333

 Score = 154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 105/336 (31%), Positives = 165/336 (49%), Gaps = 25/336 (7%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL  76
            K   TSCEGYVTKRGH  K+W+ R++VL G  L V+YY+S+   +   G    PKGSF L
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKE-IYKSNG---PPKGSFVL  62

Query  77   SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAK  136
            S  E  +  +   G + KPFGFK +GH P +GY E  VFVET  D+ KWL VA NAL   
Sbjct  63   SECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKT  120

Query  137  RQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAK  196
              +   +++       K   G  ISL        + Q++ + K+  ELL  A+ D + A 
Sbjct  121  TYIPSPSMESHGGAGHKESAGLMISL--------EAQIKNVKKTSHELLQQAINDAKEAD  172

Query  197  QVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsddsrpkasas  256
            ++G    +E+  Q E L+  E  + A+ + +D  + L + +K P L+ F+     K S  
Sbjct  173  RIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKR  232

Query  257  kasspqrsqqsgrpprlppAMDSINDAGV-----------SDLERLAQALGELEVQAELL  305
                    ++ G        +       +             L+ L++ L +L   A+ +
Sbjct  233  GKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTI  292

Query  306  NGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAAL  341
            +    R T+Q++RI+ ++++V  RV K+ K   + L
Sbjct  293  SDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESVL  328

>CCI45127
Length=202

 Score = 101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 22/208 (11%)

Query  153  KNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEK  212
            K + GF+ +       + ++Q++ L   + + + +AL+ IE AK  G  AC+EIV QGE+
Sbjct  5    KGVLGFSFA-----GTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQ  59

Query  213  LDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFsddsrpkasaskasspqrsqqsgrppr  272
            L  +EQ+LS I+ DL+  +KL++ ++ P  + FS     +  A   ++        +   
Sbjct  60   LGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI  119

Query  273  lppAMDSINDAGV-----------SDLERLAQALGELEVQAELLNGEAGRGTQQIERIEH  321
            L       ND  +           +DLE+LA AL ELEVQA+L+N EA +   QI RIE 
Sbjct  120  LHMRK---NDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEG  176

Query  322  QLSNVTARVEKQTKQASAALDSGPR-LF  348
            QLS +  R++ QT Q  A+  SG + LF
Sbjct  177  QLSGINDRIQSQTTQVVAS--SGKKNLF  202

>PYAR_23286
Length=607

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 57/123 (46%), Gaps = 20/123 (16%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ VL GS  +VSYY      + P G+P A   
Sbjct  379  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGS--SVSYYTDYDTANSPKGKPLA---  433

Query  73   SFYLSSIEPHEYVV-GVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARN  131
                      E V+  V     +PFGF  +       Y    V+ +   +R KW+   R 
Sbjct  434  ----------EVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWMNALRK  479

Query  132  ALS  134
              S
Sbjct  480  LTS  482

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 21/27 (78%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEG++TKRGH   +W++R+ VL G+ L
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVL  220

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            +CEGY+T+RGH   S R  + VL+G++L
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSL  315

>HYAP_08645
Length=1514

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 55/116 (47%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL +SYY      +   G P A          
Sbjct  305  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLA----------  352

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSA  135
                 V  V     +PFGF  + +     Y    V+ +   +RNKW+  A N L+A
Sbjct  353  --EVLVEDVQSWDGEPFGFMFMTNEQVPYY----VYADNDRERNKWMN-ALNKLNA  401

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            CEGY+TKRGH   +W+ R+  L G+ L   YY
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  142

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL+G++L
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  234

>PYU1_G006347
Length=1095

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 56/115 (49%), Gaps = 22/115 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL +SYY      +   G+P        L+ +
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKP--------LAEV  441

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS  134
                 V  V     +PFGF  +        V   V+ +   +RNKW+    NALS
Sbjct  442  A----VEDVQKWDGEPFGFMFMTSE----QVPYYVYADNDRERNKWM----NALS  484

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEG++TKRGH   +W+ R+ VL G  L
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVL  226

 Score = 39.3 bits (90),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+T+RGH   S R+ + VL+G++L
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASL  321

>PHYRA_84916
Length=1541

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 50/107 (47%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   +SYY      +   G+P A          
Sbjct  402  PVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNTKGKPLA----------  449

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL  126
                 V  V     +PFGF  + +      V   V+ +   +RNKW+
Sbjct  450  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERNKWM  490

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   YY S
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  241

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL+G++L
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  331

>PHYSO_361747
Length=1523

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 54/116 (47%), Gaps = 19/116 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   +SYY      +   G+P A          
Sbjct  411  PVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLA----------  458

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSA  135
                 V  V     +PFGF  +        V   V+ +   +RNKW+  A N L+A
Sbjct  459  --EVLVEDVQKWDGEPFGFMFMTTE----QVPYYVYADNDRERNKWMN-ALNKLNA  507

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   YY S
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  250

 Score = 40.4 bits (93),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL+G++L
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  340

>PYIW_17381
Length=952

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 64/133 (48%), Gaps = 25/133 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL ++Y+      +   G+P        L+ +
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKP--------LAEV  452

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQL  139
                 V  V     +PFGF  +        V   V+ +   +RNKW+    NAL   R+L
Sbjct  453  T----VEDVQKWDGEPFGFMFMTSE----QVPYYVYADNDRERNKWM----NAL---RKL  497

Query  140  TRQAIDQSVSPNR  152
            T  A + +V   R
Sbjct  498  TTVAEEPTVEKKR  510

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEG++TKRGH   +W+ R+ VL G+ L
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVL  237

 Score = 37.7 bits (86),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 21/27 (78%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEGY+T+RGH   S R+ + VL+G++L
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSL  332

>PPTG_18898
Length=1559

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   +SYY      +   G+P A          
Sbjct  405  PVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNAKGKPLA----------  452

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL  126
                 V  V     +PFGF  + +      V   V+ +   +R KW+
Sbjct  453  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERTKWM  493

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   YY S
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  244

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL+G++L
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  334

>PITG_20562
Length=1559

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G+   +SYY      +   G+P A          
Sbjct  406  PVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNAKGKPLA----------  453

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL  126
                 V  V     +PFGF  + +      V   V+ +   +R KW+
Sbjct  454  --EVLVEDVQKWDGEPFGFMFMTNE----QVPYYVYADNDRERTKWM  494

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

 Score = 40.4 bits (93),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL+G++L
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSL  335

>PYIR_21589
Length=1568

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 58/132 (44%), Gaps = 20/132 (15%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      +   G   A          
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRALA----------  450

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQL  139
                 V  V     +PFGF  +        V   V+ +   +RNKW+   R   +   + 
Sbjct  451  --EVTVEDVQKWDGEPFGFMFMTSE----QVPYYVYADNDRERNKWMNALRKLTTVAEEP  504

Query  140  TRQAIDQSVSPN  151
            T  ++++   PN
Sbjct  505  T--SLEKKRCPN  514

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEG++TKRGH   +W+ R+ VL G+ L
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVL  237

 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+T+RGH   S R+ + VL+G++L
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSL  332

>PHYKE_1990
Length=1499

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 48/107 (45%), Gaps = 18/107 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L GS   +SYY      +   G+  A          
Sbjct  403  PVACAGYLTKQGHKRKSWKKRYFILRGS--TISYYSDYDMANNSKGKALA----------  450

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL  126
                 V  V     +PFGF  +       Y    V+ +   +RNKW+
Sbjct  451  --EVLVEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWM  491

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   YY S
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  242

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL+G++L
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASL  332

>PHYKE_2479
Length=171

 Score = 48.5 bits (114),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 7/53 (13%)

Query  5    RVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            R P   +T+S  K      EGYVTKRGH  ++W++RF  L+G NL VSYYE++
Sbjct  62   RPPHSNSTSSRSK-----WEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>SPRG_06058
Length=1258

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 19/130 (15%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL  76
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  SYY    A +   G+         L
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  192

Query  77   SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAK  136
            S +   +  VG        F F  + + P        VF +   D+ KW+   + A+ A 
Sbjct  193  SDVSLKD--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGAD  244

Query  137  RQLTRQAIDQ  146
              L  + ID+
Sbjct  245  -TLAIETIDE  253

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 2/42 (5%)

Query  18  ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
           ARP  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  42  ARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  81

>PYU1_G001063
Length=783

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 34/68 (50%), Gaps = 20/68 (29%)

Query  9    VGATASGDKARPTS------------------CEGYVTKRGHFRKSWRVRFLVLDGSNLN  50
            VG T S D   P S                   EGYVTKRGH  ++W+ RF  L+G+NL 
Sbjct  114  VGGTNSPDTGTPLSGGHEGDQAVESLDLPIVEWEGYVTKRGHLVRNWKNRFFTLEGTNL-  172

Query  51   VSYYESRA  58
             SYYES+ 
Sbjct  173  -SYYESKV  179

>SDRG_12763
Length=1317

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 2/36 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            +P SC GY+TK+GH RKSW+ R+ VL G+ L  SYY
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY  253

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 56/150 (37%), Gaps = 29/150 (19%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            C GY+TKRGH   +W+ RF VL    + + YY   +             G  +L  + P 
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADDSMV--------KKLGQVHLVKVAPW  60

Query  83   EYVVGVMGAA---------EKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL-------  126
            EY     G +         E  FGF M     R  Y    V+     +R +WL       
Sbjct  61   EYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLY  116

Query  127  EVARNALSAKRQLTRQAIDQSVSPNRKNLF  156
             V  NA   +  LT++    S   +R   +
Sbjct  117  VVTSNATDCEGYLTKRTPGFSFLSSRPKYY  146

>PYVX_20438
Length=1346

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 52/111 (47%), Gaps = 18/111 (16%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P +C GY+TK+GH RKSW+ R+ +L G+  ++SY+      +   G+         L+ +
Sbjct  316  PVACAGYLTKQGHKRKSWKKRYFILRGT--SISYFADFEMANSAKGKA--------LAEV  365

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVAR  130
                 V  V     +PFGF  +       Y    V+ +   +RNKW+   R
Sbjct  366  T----VEDVQRWDGEPFGFMFMTSEQVPYY----VYADNDRERNKWMNALR  408

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   Y+ S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

 Score = 38.5 bits (88),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            SCEGY+TKRGH   S R+ + VL G+ L
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTML  245

>PYAP_17290
Length=835

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
             EGYVTKRGH  ++W++RF  L+G+NL  SYYE++ 
Sbjct  152  WEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  185

>PYIW_13172
Length=939

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  SYYES+ 
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  182

>PYIR_15309
Length=937

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  SYYES+ 
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

>H257_06722
Length=1482

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 54/118 (46%), Gaps = 18/118 (15%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKG  72
            A+    +P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +   G+P     
Sbjct  342  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKP-----  394

Query  73   SFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVAR  130
               L  +   E    V     +P GF  + +     Y    VF +   D+ KWL   R
Sbjct  395  ---LGEVTVRE----VSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALR  441

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
            CEGY+TKRGH   S+R+R+ VL GS   + YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGS--TIKYYADETA  285

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 3/44 (7%)

Query  13   ASGDKARPTS--CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            AS D + P+     GY+TKRGH   +W+ RF VL      +SYY
Sbjct  143  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  185

>H257_06721
Length=1238

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            G   +P +C GY+TK+GH RKSW+ R+ VL GS L  SYY
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  261

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 11/63 (17%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPK-GSFYLSSIEP  81
           C GY+TKRGH   +W++R+ VL   + ++SYYE          E  A K G  +L+ + P
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYED---------ESMAKKLGQVHLAKVAP  63

Query  82  HEY  84
            EY
Sbjct  64  WEY  66

>CCI44752
Length=1526

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
            T + +   P +C GY+TK+GH RKSW+ R+ +L G N+ +SYY+
Sbjct  407  TTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQ  448

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 45/101 (45%), Gaps = 21/101 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR-----------AACHPPTGEPSAPKG  72
            EGY+TKRGH   +W+ RF VL G+ L   YY S            A   P +GE  A   
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSEEKTKRYGSVVVAKVAPWSGE--AHGF  278

Query  73   SFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELD  113
             FY +   P  Y V     AEK    +    A R+ YVE D
Sbjct  279  MFYTTKQIP--YYVYAASEAEKTKWLR----ALREFYVEPD  313

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            +CEGY+T+RGH   S RV + VL G+ L
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYL  343

>PYIR_17453
Length=2619

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 7/113 (6%)

Query  23    CEGYVTKRGHFR-KSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
             CEGYV  R HF   +WR RF VL+ + L +  Y   +A      E  A +    ++  + 
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL--YPDTSAALSEGREQKALEKHDLIAVKKW  2217

Query  82    HEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS  134
             H      +G     FGF++   A   GY+E  V +E  +++ KWL    NA+S
Sbjct  2218  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIE--DEQTKWLAAITNAVS  2266

 Score = 32.3 bits (72),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 7/52 (13%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSA-PKGSF  74
             EGY+ KRGH   S R R+ VL  + L   Y+    A H  +  P+  P GSF
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVLVKNTLE--YF----ATHEDSRNPAIRPHGSF  1267

>H310_00230
Length=1248

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 53/122 (43%), Gaps = 21/122 (17%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSF  74
            G   +P +C GY+TK+GH RKSW+ R+ VL G+ L  SYY         T   SA K   
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY---------TDYESANKQCL  266

Query  75   YLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS  134
                IE  +   G M       GF          Y    V+ +T  +R KWL   +  L 
Sbjct  267  AEVGIEDVQVWDGEM------HGFMFTTTEQVMYY----VYADTERERQKWLVALKALLD  316

Query  135  AK  136
            A+
Sbjct  317  AQ  318

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 9/62 (15%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
           C GY+TKRGH   +W++RF VL   + N+SYYE  +         S   G  +L+ + P 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESM--------SKKLGQVHLAKVAPW  62

Query  83  EY  84
           EY
Sbjct  63  EY  64

>PYVX_13574
Length=950

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL VSYYES+ 
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESKV  191

>CCI41225
Length=981

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W++RF  L+G+ L  SYYES+ 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKV  172

>PYAR_19914
Length=788

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W+ RF  L+G+NL  SYYE++ 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKV  178

>SPRG_06059
Length=1312

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 2/36 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            +P SC GY+TK+GH RKSW+ R+ VL G  L  +YY
Sbjct  222  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY  255

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 59/151 (39%), Gaps = 31/151 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPK-GSFYLSSIEP  81
            C GY+TKRGH   +W+ RF VL    + + YY           E  A K G  +L  + P
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYAD---------ESMAKKLGQVHLVKVAP  61

Query  82   HEYVVGVM---------GAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL------  126
             EYV             G+ E  FGF M     R  Y    V+     +R KWL      
Sbjct  62   WEYVSATTANSILKSTRGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQKWLLALQDL  117

Query  127  -EVARNALSAKRQLTRQAIDQSVSPNRKNLF  156
              V  NA   +  LT++    S   +R   +
Sbjct  118  YVVTSNATDCEGYLTKRTPGFSFLSSRPKYY  148

>PHALS_06533
Length=930

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 8/56 (14%)

Query  9    VGATASGDKARPT------SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            +  T  GD+A  +        EGYVTKRGH  ++W++RF  L+G NL VSYYE++ 
Sbjct  90   MSVTMGGDQAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  143

>CCA18875
Length=1514

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 31/44 (70%), Gaps = 2/44 (5%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
            T + +   P +C GY+TK+GH RKSW+ R+ +L G N+ +SYY+
Sbjct  407  TLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQ  448

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 44/101 (44%), Gaps = 21/101 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR-----------AACHPPTGEPSAPKG  72
            EGY+TKRGH   +W+ RF VL G+ L   YY S            A   P +GE  A   
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSEEKTKRYGSVVVAKVAPWSGE--AHGF  278

Query  73   SFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELD  113
             FY +   P  Y V      EK    +    A R+ YVE D
Sbjct  279  MFYTTKQIP--YYVYAASETEKAKWLR----ALREFYVEPD  313

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            +CEGY+T+RGH   S RV + VL G+ L
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCL  343

>PYAP_16997
Length=1018

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 20/119 (17%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKG  72
            A+ +   P +C GY+TK+GH RKSW+ R+ VL G+  +++Y+      +   G+  A   
Sbjct  392  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGN--SITYFTDFDTANSNKGKALA---  446

Query  73   SFYLSSIEPHEYVV-GVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVAR  130
                      E +V  V     +PFGF  +        V   V+ +   +R KW+   R
Sbjct  447  ----------EVIVEDVQRWDGEPFGFMFM----TSEQVPYYVYADNERERGKWMNALR  491

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            +CEG++TKRGH   +W++R+ VL G+ L
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVL  233

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            +CEG++T+RGH   S R  + VL+G++L
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSL  328

>H310_00231
Length=1495

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 53/122 (43%), Gaps = 18/122 (15%)

Query  9    VGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPS  68
            +G        +P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +      S
Sbjct  338  LGKVTVDKPVQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASN---MRHS  392

Query  69   APKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEV  128
             P G   +  +   +          +P GF  V +      V   VF +   D+ KWL  
Sbjct  393  RPLGEVTVREVSTWD---------GEPGGFMFVTN----DNVPYYVFADNERDQAKWLTA  439

Query  129  AR  130
             R
Sbjct  440  LR  441

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 22/27 (81%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEGY+TKRGH   S+R+R+ VL G+++
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASM  277

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            GY+TKRGH   +W+ RF VL      +SYY
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY  185

>PHYRA_77834
Length=936

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            EGYVTKRGH  ++W++RF  L+G NL VSYYE++
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  150

>PYIW_21108
Length=2593

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 8/130 (6%)

Query  6     VPEVGATASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLNVSYYESRAACHPPT  64
             + +   ++ G  A+    EGYV  R HF  + WR RF VL+G+ L +  Y   +A     
Sbjct  2139  ISQSAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL--YTDSSAAMDED  2196

Query  65    GEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNK  124
              E +A +    ++  + H      +G+  + FGF++   A   GY+E  V  E  +++ K
Sbjct  2197  RERTALEKHDLIAVEKWHPTYSANLGSGSR-FGFRVENEA--GGYLECTVTTE--DEQTK  2251

Query  125   WLEVARNALS  134
             WL V  +A+S
Sbjct  2252  WLAVVSDAVS  2261

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 32/67 (48%), Gaps = 6/67 (9%)

Query  9     VGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPS  68
              G +  G   R    EGY+ KRGH   S R R+ VL   N ++ Y+    A H  +  P+
Sbjct  1219  TGDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVL-LKNASLEYF----ATHEDSRNPA  1273

Query  69    A-PKGSF  74
               P GSF
Sbjct  1274  IRPHGSF  1280

>PPTG_13401
Length=927

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL VSYYE++ 
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PITG_18067
Length=924

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W++RF  L+G NL VSYYE++ 
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENKV  141

>PHYCA_503112
Length=214

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            EGYVTKRGH  ++W+ RF  L+G NL VSYYE++
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>CCA16487
Length=975

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYVTKRGH  ++W++RF  L+G+ L  SYYE++ 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKV  170

>CCI42457
Length=906

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYV KRGH  ++W++RF  L+G+   VSYYES+ 
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKG  162

>CCA17102
Length=884

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            EGYV KRGH  ++W++RF  L+G+ L  SYYES+ 
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKG  142

>SDRG_12762
Length=1392

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
            P  CEGY+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  292

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query  17   KARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            K  P +C G++TK+GH RKSW+ R+ VL G+ L  SY+
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYF  389

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            GY+TKRGH   +W+ RF  L  S   +SYY
Sbjct  164  GYLTKRGHVITNWKTRFFALR-SQGRLSYY  192

>CCI10489
Length=777

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  7    PEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            PEV  T   +    T  EGY+ KRGH  +SWR RF VL G+ L  SYY S+
Sbjct  92   PEVNHTF--EDMFKTDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PHYRA_82543
Length=1199

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 64/147 (44%), Gaps = 26/147 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  +YY S+             +G   +S + P  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  114

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTR--  141
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+    + T+  
Sbjct  115  Y--------GKAHGFLL----ETQGHKHFHLCCATELEKDMWVEMMQAAIEEGVRHTQSS  162

Query  142  ------QAIDQSVSPNRKNLFGFNISL  162
                  +A+    SP + +L GF ++ 
Sbjct  163  MSMEGMEALQMQSSPTQVDLRGFYLAF  189

>PPTG_19371
Length=1195

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 75/186 (40%), Gaps = 33/186 (18%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            M+ L V    A+           EGYV K+G +   W  R+L+LDG+ L  +YY S+   
Sbjct  48   MDDLLVDSSTASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  105

Query  61   HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  120
                      +G   +S + P  Y         K  GF +      +G+    +   T  
Sbjct  106  RSARNL----RGRMIISKVRPENY--------GKAHGFLI----ETQGHKHFHLCCTTEL  149

Query  121  DRNKWLEVARNALS-----AKRQLT---RQAIDQSVSPNRKNLFGFN-------ISLSPQ  165
            +++ W+E+ + A+      A  +L+    +A+    SP + +L GF        IS S  
Sbjct  150  EKDMWVEMMQAAIEEGVRHAHSRLSMEGMEALQMQTSPTQVDLRGFYFAFRQLLISHSSS  209

Query  166  PNMSPQ  171
            P   P+
Sbjct  210  PQFFPK  215

>SDRG_05567
Length=980

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/155 (26%), Positives = 65/155 (42%), Gaps = 28/155 (18%)

Query  13   ASGDKARPTS-------CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
            AS   A+PT+         GY++KRG +RK+W+ R+ +L   + ++ Y +S         
Sbjct  118  ASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQ  177

Query  66   EPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKW  125
             P  P      +SI          G  + PF F++  H PR+    L +   T+ +  KW
Sbjct  178  VPITPNTRVIDNSI----------GCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRKW  222

Query  126  LEVARNA--LSAKRQLTRQAIDQSV----SPNRKN  154
            +   R    L   R++    + QS     SP   N
Sbjct  223  IRSIRETVELVRSREIGENYVTQSCVVRPSPTDTN  257

>SPRG_06021
Length=983

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 50/113 (44%), Gaps = 15/113 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            GY++KRG +RK+W+ R+ +L   + ++ Y +S          P  P      +SI     
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPITPNTRVIDNSI-----  193

Query  85   VVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKR  137
                 G  + PF F++  H PR+    L +   T+ +  KW+   R  +   R
Sbjct  194  -----GCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVR  236

>PYU1_G008848
Length=765

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 60/133 (45%), Gaps = 28/133 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY----ESRAACHPPTGEPSAPKGSFYLSSI  79
            EGYV K+G +   W  R+LVLDG+ L  +YY    E+R+A +         +G   +S +
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  183

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL--SAKR  137
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+    K 
Sbjct  184  RPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKH  231

Query  138  QLTRQAIDQSVSP  150
             +   ++D  V P
Sbjct  232  SVNGNSMDSDVVP  244

>PHYSO_544598
Length=1163

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/148 (24%), Positives = 64/148 (43%), Gaps = 27/148 (18%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  +YY S+             +G   +S + P  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIISKVRPEN  72

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL------SAKR  137
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+       A  
Sbjct  73   Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  120

Query  138  QLT---RQAIDQSVSPNRKNLFGFNISL  162
            +++    +A+    SP + +L GF  + 
Sbjct  121  RVSMEGMEALQMQASPTQVDLRGFYFAF  148

>PITG_11303
Length=293

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            CEGY+TKRGH   +W+ R+  L G+ L   YY S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSS  245

>CCA21715
Length=782

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  7    PEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            PEV  T   ++   T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  94   PEVSHTF--EELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  7    PEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            PEV  T   ++   T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  94   PEVSHTF--EELFETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>PYIR_18382
Length=1154

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 28/133 (21%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY----ESRAACHPPTGEPSAPKGSFYLSSI  79
            EGYV K+G +   W  R+LVLDG+ L  +YY    E+R+A +         +G   +S +
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  178

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS--AKR  137
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+    K 
Sbjct  179  RPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKH  226

Query  138  QLTRQAIDQSVSP  150
             L   ++D    P
Sbjct  227  SLNGSSVDPETLP  239

>PHALS_06699
Length=884

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 54/133 (41%), Gaps = 14/133 (11%)

Query  12   TASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPK  71
            T++ D A   S  G++ KRGH  K+W+ R+ VL  S L    Y S A C    GE     
Sbjct  325  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEV----  377

Query  72   GSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARN  131
               +      H   V V G  +  F  + VG         L +  E L+DR  W+    +
Sbjct  378  -LLFHPQTCVHYVDVHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIED  430

Query  132  ALSAKRQLTRQAI  144
            AL  +     Q +
Sbjct  431  ALLCRDSYQNQQV  443

>PITG_19213
Length=1201

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 69/163 (42%), Gaps = 33/163 (20%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  +YY S+             +G   ++ + P  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIINKVRPEN  124

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS-----AKRQ  138
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+      A  +
Sbjct  125  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  172

Query  139  LT---RQAIDQSVSPNRKNLFGFN-------ISLSPQPNMSPQ  171
            L+    +A+    SP + +L GF        IS S  P   P+
Sbjct  173  LSMEGMEALQLQTSPTQVDLRGFYFAFRQLLISHSSSPQFFPK  215

>H257_03361
Length=699

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (62%), Gaps = 7/60 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
           +G++ K+G    SW+ R+LVL G   N+SY++ +   +P   E    KGSF L+ ++P++
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQ--NISYFD-KEVSNPRAKE----KGSFVLAGVQPNK  63

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 25/38 (66%), Gaps = 3/38 (8%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            RPT   G++ K+G   +SW+ R+ VL G   N++Y+++
Sbjct  207  RPTYT-GWLDKQGEIVQSWKQRYFVLRGR--NIAYFDT  241

>PHALS_03540
Length=904

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (51%), Gaps = 8/79 (10%)

Query  4   LRVPEVGATASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACH  61
           L+       A+G  AR + C+  G+  K+G   KSW+ RF VL G  L   Y+E R+   
Sbjct  23  LKATSRNVIAAGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERS---  77

Query  62  PPTGEPSAPKGSFYLSSIE  80
            P+G+    KG   +S +E
Sbjct  78  -PSGKGIDEKGRLRISGVE  95

 Score = 35.0 bits (79),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 54/132 (41%), Gaps = 25/132 (19%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P  C G++ K G   K+W+ R+  L G+ L   Y++S               G+   S  
Sbjct  783  PVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS-------------DNGALLRSFT  827

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQL  139
              H     V+    K    ++     RK    L V  ET  D ++WL+    A++A++Q 
Sbjct  828  VCH-----VVTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKQ-  877

Query  140  TRQAIDQSVSPN  151
             +Q  D S   N
Sbjct  878  KKQNTDSSQWTN  889

>PYVX_18338
Length=746

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
             S + A  T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  71   GSIEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>PHYSO_344112
Length=813

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYCA_506137
Length=810

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PYIW_18480
Length=755

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
           T  EGYV K+GH  +SWR R+ +L G+    SYY S+
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>PHYRA_79281
Length=809

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>PITG_02762
Length=810

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PPTG_05519
Length=810

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYSO_343629
Length=977

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 24/30 (80%), Gaps = 0/30 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSY  53
            EGYVTKRGH  ++W++RF  L+G+ ++ ++
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>HYAP_08026
Length=798

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>PHYSO_556164
Length=765

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 55/135 (41%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L    Y + ++C    GE        +
Sbjct  214  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCSKLKGEV-----LLF  265

Query  76   LSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSA  135
                  H   V V G  +  F  + VG      Y  L +    L DR  W+    +AL  
Sbjct  266  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDALLC  319

Query  136  KRQLTRQAIDQSVSP  150
            +     Q + +   P
Sbjct  320  RDSYHPQGMTEGPEP  334

>PYAP_22646
Length=815

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>PYAP_18636
Length=1009

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 75/180 (42%), Gaps = 39/180 (22%)

Query  13   ASGDKARPTSC------EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGE  66
            ASG    PT        EGYV K+G +   W  R+LVLDG+ L  +YY ++      +G 
Sbjct  86   ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR--SGR  141

Query  67   PSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWL  126
                +G   +S + P  Y     G A   F  + +GH          +   T  +++ W+
Sbjct  142  --NLRGRMIISKVRPENY-----GKAHG-FLLETMGHK------HFHLCCSTELEKDMWV  187

Query  127  EVARNAL--SAKRQLTRQAIDQS------VSPNRKNL----FGFN---ISLSPQPNMSPQ  171
            E+ + A+    K +L R  I  +       SP + +L    F F    IS S  P   P+
Sbjct  188  EMMQAAIDEGVKHKLERSLISSADVANAQPSPTQVDLRSFYFAFRELLISHSSSPQFFPK  247

>H310_06378
Length=837

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            EG+V K+GH  ++W+VR+  L+G+ L  SYYE++
Sbjct  58  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>PHYKE_5678
Length=809

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ VL G  +  SYY S+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSK  134

>PITG_17893
Length=747

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 50/118 (42%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L    Y + ++C    GE        +
Sbjct  212  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGE-----VLLF  263

Query  76   LSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
                  H   V V G  +  F  + VG      Y  L +    L DR  W+    +AL
Sbjct  264  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  315

>PHALS_04098
Length=1183

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 38/161 (24%), Positives = 70/161 (43%), Gaps = 31/161 (19%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  +YY S+             +G   +  + P  
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNM----RGRMTVYKVRPEN  128

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL--SAKRQLTR  141
            Y         K  GF +      + + +  +   T  +++ W+E+   A+   A+++ +R
Sbjct  129  Y--------GKAHGFLL----ETQSHKQFHLCCATELEKDMWVEMMHAAVEEGARQRNSR  176

Query  142  QAID----QSVSPNRKNLFGFN-------ISLSPQPNMSPQ  171
             +++      +SP + +L GF        IS S  P   P+
Sbjct  177  LSVEGMEILQISPTQVDLRGFYFAFRQLLISHSSSPQFFPK  217

>H257_13567
Length=836

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            EG+V K+GH  ++W+VR+  L+G+ L  SYYE++
Sbjct  60  WEGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>H310_07701
Length=811

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 39/171 (23%), Positives = 68/171 (40%), Gaps = 34/171 (20%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES-------------RAACHPPTGEP  67
            T  EGYV K+GH  ++WR R+ +L G+    +YY S             R        +P
Sbjct  50   TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHAMSDFEKFKGRVTVTGAKKDP  107

Query  68   SAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVEL---------DVFVET  118
            S   G F +++     + +      E     +M+  A +  Y ++         D+ +E 
Sbjct  108  SRSNG-FVVTTTIDKVFCMYTKTPIETELWIRMIEKAVQIAYFQMSLAASAQLPDIILEG  166

Query  119  LNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMS  169
             N          ++ +  R L     + S+S N+     FN  ++P PN+S
Sbjct  167  GN---------LSSSTDSRHLNSSFANLSLSSNQHLSLSFNGHMNPTPNLS  208

>PYIW_16987
Length=821

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 26/114 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY----ESRAACHPPTGEPSAPKGSFYLSSI  79
            EGYV K+G +   W  R+LVLDG+ L  +YY    E+R+A +         +G   +S +
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARN--------LRGRMIISKV  169

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  170  RPENY--------GKAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAI  211

>SDRG_08800
Length=881

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            EG+V+K+GH  ++W++R+  L+ SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>CCI39367
Length=2046

 Score = 40.8 bits (94),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 31/121 (26%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++ K+GH  KSWRVRF VL  DG+   ++YY  R       G+    KG      I+ +
Sbjct  86   GWLRKQGHLWKSWRVRFFVLYTDGT---LAYYRKR-------GDVKM-KG-----YIKLN  129

Query  83   EYVVGVM----GAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQ  138
            E ++G+         + + F++     RKG+  L    +T  +   W+ V R+     RQ
Sbjct  130  EGIIGIQYIDAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSVLRST----RQ  180

Query  139  L  139
            L
Sbjct  181  L  181

>SPRG_17022
Length=107

 Score = 37.7 bits (86),  Expect = 0.016, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>SDRG_00080
Length=298

 Score = 39.7 bits (91),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 24/109 (22%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P +  GYV K+G F K+W+ R++VL    L   YY S  A        + P+G F     
Sbjct  70   PPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERAT-------TKPRGFF-----  115

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYV------ELDVFVETLNDR  122
                 V G+  A + P G    G   R+         E D + +TL++R
Sbjct  116  ----RVTGIAYAPDLPHGLIADGTGTRRLKFTLADNDECDAWYDTLSER  160

>PYU1_G004386
Length=837

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            D    T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>PPTG_04553
Length=904

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 50/118 (42%), Gaps = 14/118 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L    Y + ++C    GE        +
Sbjct  355  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGE-----VLLF  406

Query  76   LSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
                  H   V V G  +  F  + VG      Y  L +    L DR  W+    +AL
Sbjct  407  HPQTRVHYVDVHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  458

>PYAR_15463
Length=1091

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  +YY S+      +G     +G   +S + P  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEAR--SGR--NLRGRMIISKVRPEN  131

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  132  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVEMMQAAI  169

>PHALS_03645
Length=830

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            D    T  EGY+ K+GH  +SWR R+ VL G+    SYY S+
Sbjct  96   DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  135

>SPRG_05449
Length=723

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 28/35 (80%), Gaps = 2/35 (6%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            EG+V+K+GH  ++W++R+  L+ SNL +SYYES+
Sbjct  65  WEGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  97

>PHYRA_73535
Length=875

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 52/135 (39%), Gaps = 14/135 (10%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D A   S  G++ KRGH RK+W+ R+ VL+ S L    Y +  +C    GE        +
Sbjct  333  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEV-----LLF  384

Query  76   LSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSA  135
                  H   V V G  +  F  ++    P      L +    L DR  W+    +AL  
Sbjct  385  HPQTRVHYVDVHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDALLC  438

Query  136  KRQLTRQAIDQSVSP  150
            +     Q +     P
Sbjct  439  RDSYHPQGMTSGPGP  453

>PYIR_13120
Length=814

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  +SWR R+ +L G+    SYY S+
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>CCA18023
Length=1138

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 52/126 (41%), Gaps = 18/126 (14%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG+ L  +YY ++             +G   +  + P  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  178

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQA  143
            Y         K  GF +      KG+    +   T  +++ W+E+ + A+      +  A
Sbjct  179  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNA  226

Query  144  IDQSVS  149
                VS
Sbjct  227  SHSFVS  232

>H257_03093
Length=975

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG++L  +YY S+      T      +G   ++ + P  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNL----RGRMIITKVLPEN  157

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
            Y     G A   F  + +GH          +   T  +++ W+E+ + A+
Sbjct  158  Y-----GKAHG-FLIETMGHK------HFHLCCTTELEKDMWVEMMQAAI  195

>H257_09823
Length=654

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 47/110 (43%), Gaps = 8/110 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RK+W+ RF VLDGS L   Y+        P  +    KG   L   +   +
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLLFHKDTTVH  322

Query  85   VVGV-MGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
             V + +   +  F  +  G     G   L +   +L++R  W+     A+
Sbjct  323  YVDIHLTGRDYTFAVETSG-----GDYSLVLQAASLDEREDWIFAIEEAI  367

>PITG_02106
Length=1015

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 64/143 (45%), Gaps = 33/143 (23%)

Query  7    PEVGATAS-----GDK--ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
            PE  A +S     GD+  A    C G++ K G   KSW+ R+  L GS L  SYY+S   
Sbjct  653  PEYDAISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS---  707

Query  60   CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETL  119
                  E  +   S  + SIEPH  V           G  +  H+ RK  ++ D    + 
Sbjct  708  ------EKGSLLRSVSVVSIEPHPTV---------SLGLVVSTHSGRKLIMQAD----SN  748

Query  120  NDRNKWLEVARNALSA--KRQLT  140
             + ++WL   + A++   +R+LT
Sbjct  749  EEFDRWLSAIQGAVAGENERKLT  771

>PYAR_19883
Length=833

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            T  EGY+ K+GH  ++WR R+ +L G+    SYY S+
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  134

>CCI46235
Length=1155

 Score = 40.0 bits (92),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (45%), Gaps = 26/114 (23%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY----ESRAACHPPTGEPSAPKGSFYLSSI  79
            EGYV K+G +   W  R+LVLDG+ L  +YY    E+R+A           +G   +  +
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSA--------RNLRGKMMIVKV  169

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
             P  Y         K  GF +      KG+    +   T  +++ W+E+ + A+
Sbjct  170  RPENY--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAI  211

>SPRG_16312
Length=261

 Score = 38.9 bits (89),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 47/108 (44%), Gaps = 22/108 (20%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P    GYV K+G F K+W+ RF+VL    L   YY S  A        + P+G F ++S+
Sbjct  38   PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAM-------AKPRGFFRVTSV  88

Query  80   E-----PHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDR  122
                  PH  +    G   +   F +          E D + +TL++R
Sbjct  89   AYAPDLPHGLIAD--GTGTRRLRFTLADSD------ECDAWYDTLSER  128

>PPTG_14630
Length=398

 Score = 39.3 bits (90),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+VL G  L  +YY++      PT +   PKGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLV--PTVK---PKGSFQVITVE  60

>PYVX_13312
Length=1016

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+L+LDG+ L  +YY S+      +G     +G   LS + P  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEAR--SGRNL--RGRMQLSRVRPEN  129

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+
Sbjct  130  Y--------GKAHGFLIE----TRGHKSFHLCCTTELEKDMWVEMMQAAI  167

>PYU1_G009249
Length=2580

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (53%), Gaps = 5/57 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPS-APKGSFYLSSI  79
             EGY+ KRGH   S R R+ VL      + YY    A H  +  PS AP GSF + ++
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYY----ATHEDSRNPSVAPHGSFRVDTV  1231

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 58/124 (47%), Gaps = 14/124 (11%)

Query  25    GYVTKRGHFRKS-WRVRFLVLDGSNLNVSYYESRAACHPPTG--EPSAPKGSFYLSSIEP  81
             GYV  R HF  + WR RF+VL G++  + Y +S AA           A +    ++  + 
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKKALEKHNLVAIAKW  2159

Query  82    HEYVVGVMGAAEKP---FGFKMVGHAPRKGYVELDVFVETLNDRNKWLEV---ARNALSA  135
             H   V   G+A      +GF++   A   GY+E    V T  ++ +W++    A  ALSA
Sbjct  2160  HPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTISDAVTALSA  2215

Query  136   KRQL  139
               QL
Sbjct  2216  SSQL  2219

>SDRG_05608
Length=121

 Score = 37.4 bits (85),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 50/127 (39%), Gaps = 33/127 (26%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG-------  65
            A  D A+P   EG +TKR  + K WR R+ VL G+ L    Y  RA    P G       
Sbjct  3    AVADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  57

Query  66   ----------------EPSAPKGSFYL--SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRK  107
                            E + P+ ++Y+   S E  +  +G +G A   F     G     
Sbjct  58   LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---D  114

Query  108  GYVELDV  114
            GY E DV
Sbjct  115  GYDEEDV  121

>H310_04843
Length=968

 Score = 39.3 bits (90),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 18/110 (16%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG++L  +YY S+      TG+    +G   ++ + P  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEAR--TGK--NLRGRMIITRVLPEN  156

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
            Y     G A   F  + +GH          +   T  +++ W+E+ + A+
Sbjct  157  Y-----GKAHG-FLIETMGHK------HFHLCCTTELEKDMWVEMMQAAI  194

>PYIW_20891
Length=291

 Score = 38.5 bits (88),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RFLVL G  L  +YY++ A+  P T E    KGSF + ++E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGKQL--TYYDT-ASLTPKTKE----KGSFQVITVE  57

>H257_05175
Length=678

 Score = 39.3 bits (90),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 16/73 (22%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
           EG++TKR  H    W  R+ +L+GSNL   YY+ R       G+P+ P+G++ L+    +
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83  EYVVG-VMGAAEK  94
           E VVG V  + EK
Sbjct  48  ECVVGKVFNSEEK  60

>PYAP_16734
Length=1314

 Score = 39.3 bits (90),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 52/113 (46%), Gaps = 16/113 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G +TK+G +R++W+ RF +L   + ++ YY+S         E     G+  +SS      
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSE--------EKLELLGAIAVSS---DTL  229

Query  85   VVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKR  137
            V+        P+ F++     R G   L +  ET  ++ +W++  +  + A R
Sbjct  230  VLDKSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMDACQELVDAVR  277

>SPRG_09128
Length=620

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            G++ K GH RKSW+ RF VLDGS L   YY
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  295

>SDRG_05150
Length=787

 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>SDRG_01407
Length=815

 Score = 38.9 bits (89),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 71/176 (40%), Gaps = 37/176 (21%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSF  74
            G  A     EGYV K+G +   W  R+LVLDG++L  +YY ++      +G     +G  
Sbjct  76   GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR--SGR--NLRGRM  129

Query  75   YLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA--  132
             ++ + P  Y         K  GF +      KG+    +   T  +++ W+E+ + A  
Sbjct  130  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAID  177

Query  133  --LSAKRQLTRQ--------AIDQSVSPNRKNLFGFN-------ISLSPQPNMSPQ  171
              +S    LT Q         +    SP + +L  F        IS S  P   P+
Sbjct  178  EGISHPPHLTTQQSSGTFEATVSFQASPTQVDLRSFYSAFRKLLISHSSSPQFFPK  233

>SDRG_04871
Length=687

 Score = 38.9 bits (89),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+NL   YY+ R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLT  46

>CCI40991
Length=801

 Score = 38.9 bits (89),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 4/52 (8%)

Query  7    PEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGS--NLNVSYYES  56
            PEV  T   +    T  EGY+ K+GH  +SWR R+ VL G+  + NV++ +S
Sbjct  94   PEVSHTF--EDLFETDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQS  143

>SPRG_08217
Length=687

 Score = 38.9 bits (89),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+NL   YY+ R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNIIWTERYFILDGNNLR--YYKKR-------GDP-APRGAYVLT  46

>SPRG_08346
Length=797

 Score = 38.9 bits (89),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
           T  EGY+ K+GH  ++WR R+ VL G+    +YY S+ A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYIW_19873
Length=185

 Score = 37.7 bits (86),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (48%), Gaps = 9/123 (7%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACH--PPTGEPSAPKGSFYLSSIEP  81
            EG++ K+GH  ++ + R+ VL    L  SY+ ++       P   PS+ KG   L+  + 
Sbjct  56   EGFLVKKGHVLRTQKERYFVLRAHTL--SYFRAKWGEKKGKPAMLPSSLKGVLELAPSD-  112

Query  82   HEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTR  141
               +V     +++ F  + +  A  K Y +LD+ V    +R +W++  R A      L +
Sbjct  113  ---IVTPAPHSDQWFRIQKLPDAGGKSY-KLDLKVANAEERQEWIDAIRGACRNTLLLKQ  168

Query  142  QAI  144
            QA+
Sbjct  169  QAM  171

>H310_13627
Length=678

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (42%), Gaps = 8/110 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K+GH  K+W+ RF VLDGS L   Y+        P       KG   L   +   +
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLKGEVLLFHKDTTVH  327

Query  85   VVGV-MGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
             V + +   +  F     G     G   L +   +L++R  W+    +A+
Sbjct  328  YVDIHLSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAI  372

>PITG_02109
Length=522

 Score = 38.5 bits (88),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+VL G  L  +YY++ +  +P       PKGSF + ++E
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDT-SKLNPTV----KPKGSFQVITVE  186

>H310_04667
Length=680

 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 16/73 (22%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
           EG++TKR  H    W  R+ +L+GSNL   YY+ R       G+P+ P+G++ L+    +
Sbjct  2   EGWLTKRRDHMNIIWTERYFILEGSNLR--YYKKR-------GDPT-PRGTYVLT----N  47

Query  83  EYVVG-VMGAAEK  94
           E +VG V  + EK
Sbjct  48  ECIVGKVFNSEEK  60

>PYVX_23349
Length=924

 Score = 38.9 bits (89),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 49/114 (43%), Gaps = 18/114 (16%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL--SSI  79
            S  G++ K GH RK+W+ R+ VL+ S L     ESR+            KG   L   + 
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL----------KGEVLLFHPAT  493

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
              H   + + G  +  F  + VG      Y  L +  E L+DR  W+    +AL
Sbjct  494  RVHYVDIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>PHYKE_6662
Length=765

 Score = 38.5 bits (88),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 37/163 (23%), Positives = 66/163 (40%), Gaps = 33/163 (20%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+L+LDG+ L  +YY S+             +G   +  + P  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL----RGRMIIVKVRPEN  125

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS-----AKRQ  138
            Y         K  GF +      +G+    +   T  +++ W+E+ + A+          
Sbjct  126  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGPNS  173

Query  139  LTRQAIDQ---SVSPNRKNLFGFN-------ISLSPQPNMSPQ  171
            ++ + +D      SP + +L GF        IS S  P   P+
Sbjct  174  MSLEGMDALALQASPTQVDLRGFYFAFRQLLISHSSSPQFFPK  216

>H310_07070
Length=680

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 14/117 (12%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S       T E + P+G   
Sbjct  114  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGT-----TSEETYPRGVIS  166

Query  76   LSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
            LS ++ H   V      +K F F+ + H     Y  L +  +   D  +W+   ++A
Sbjct  167  LSGVDVHPLDVSKF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>PHYCA_504801
Length=398

 Score = 38.1 bits (87),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   K+W+ RF+VL G  L  +YY++ A  +P T      KGSF + ++E
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDT-AKVNPTT----KAKGSFQVITVE  60

>PHYRA_73534
Length=1210

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 52/131 (40%), Gaps = 18/131 (14%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
            S  G++ KRGH RK+W+ R+ VL+ S L    Y +  +C    GE        +      
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGE-----VLLFHPQTRV  390

Query  82   HEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVET--LNDRNKWLEVARNALSAKRQL  139
            H   V V G  +  F  + VG        E  + ++   L DR  W+    +AL  +   
Sbjct  391  HYVDVHVAGGRDASFAIQ-VG-------PEYTLLLQAAQLRDRENWMYCIEDALLCRDSY  442

Query  140  TRQAIDQSVSP  150
              Q +     P
Sbjct  443  HPQGMTSGPGP  453

>HYAP_06101
Length=984

 Score = 38.5 bits (88),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (47%), Gaps = 27/113 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G++TK+GH  KSW+ RF VL  DG+    +YY+++             KG   L     +
Sbjct  143  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNKGR--------KKIKGCMQL-----N  186

Query  83   EYVVGV----MGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARN  131
            + VV V    +  AEK + F++      KG+ +L  +  +  +   W+   R+
Sbjct  187  DGVVSVQHVDIRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALRS  234

>SPRG_02502
Length=121

 Score = 36.2 bits (82),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 49/125 (39%), Gaps = 33/125 (26%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG---------  65
             D A+P   EG +TKR  + K WR R+ VL G+ L    Y  RA    P G         
Sbjct  5    ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGVIDLSECLT  59

Query  66   --------------EPSAPKGSFYL--SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGY  109
                          E + P+ ++Y+   S E  +  +G +G A   F     G     GY
Sbjct  60   VKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---DGY  116

Query  110  VELDV  114
             E DV
Sbjct  117  DEEDV  121

>PYAP_16161
Length=889

 Score = 38.1 bits (87),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHP  62
           EGY+ K+G   K W+ R+ V DG  L  SYY SR    P
Sbjct  30  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  66

>H257_02642
Length=975

 Score = 38.1 bits (87),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (51%), Gaps = 5/51 (10%)

Query  20  PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAP  70
           P   EGY+ KRG +   W    +VLDG  L VSYY+       P  +P AP
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLDG---PPAKPHAP  72

>H310_14019
Length=683

 Score = 37.7 bits (86),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 24/106 (23%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEP  81
            S EG++ KRG   K+W+ R+  L+G  L   Y E         G  + PKG         
Sbjct  171  SFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG---------  210

Query  82   HEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLE  127
            +  VVGV    E P+    +   P +    LDV  E+ +++  W++
Sbjct  211  YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQ  252

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  8    EVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59
            + G  +S D A  T+CEG++ K+G   K+W+ R+  L G  L+    +S  A
Sbjct  331  DYGIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  380

>HYAP_04457
Length=1203

 Score = 38.1 bits (87),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 2/57 (4%)

Query  1   MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
           M+ + +    A+ S         EGYV K+G +   W  R+L+LDG  L  +YY S+
Sbjct  39  MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  93

>SDRG_14286
Length=670

 Score = 37.7 bits (86),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            G++ K GH RK+W+ RF VLDGS L   YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>SPRG_00890
Length=883

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 69/167 (41%), Gaps = 37/167 (22%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EGYV K+G +   W  R+LVLDG++L  +YY ++      +G     +G   ++ + P  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR--SGR--NLRGRMIITRVLPEN  84

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA----LSAKRQL  139
            Y         K  GF +      KG+    +   T  +++ W+E+ + A    +S    L
Sbjct  85   Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAIDEGISHPPHL  132

Query  140  TRQ--------AIDQSVSPNRKNLFGFN-------ISLSPQPNMSPQ  171
            T Q         +    SP + +L  F        IS S  P   P+
Sbjct  133  TTQQSSGTFEATVSFQASPTQVDLRSFYSAFRKLLISHSSSPQFFPK  179

>H310_00912
Length=2182

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 63/124 (51%), Gaps = 18/124 (15%)

Query  17    KARPTS---CEGYV-TKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKG  72
             +++P+S    EG+V  +R HF  +W+  + VL G  L  + Y++R       G+P++ + 
Sbjct  1787  QSQPSSEIFLEGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKRE  1844

Query  73    SFYLSSIEPHEYVVGV-MGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARN  131
               ++      ++  GV  G A+  F  + +      G+VE   +V+   D+ +W++  + 
Sbjct  1845  VVFVG-----DWYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQT  1893

Query  132   ALSA  135
             A+S+
Sbjct  1894  AVSS  1897

>PYIW_19613
Length=1314

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 7/71 (10%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVEL  112
            ++E    CH    E  AP GS  LS+  P E     + AA   FG+K V  AP K  VE 
Sbjct  608  FFEHLGICHTVMPE-KAPDGSLRLSASSPDE---QALVAAAACFGYKFVARAPGKAMVE-  662

Query  113  DVFVETLNDRN  123
              +   L D++
Sbjct  663  --YFSCLGDQD  671

>PYVX_14593
Length=964

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query  7    PEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            P+  AT S D  +   C G++ K+G    SW+ R+  L GS L   YY+S
Sbjct  592  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

>PYU1_G012870
Length=352

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   ++W+ RF+VL G  L  +YY++ A+  P T E    KGSF + + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGKQL--TYYDT-ASISPKTKE----KGSFQVITAE  55

 Score = 32.7 bits (73),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (51%), Gaps = 9/65 (14%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D A      G++ K G   K+W+ R+  L G+ L  SYY+S       TG  SA KG  +
Sbjct  145  DDAGSIHHSGWLKKEGSRIKNWKKRYFTLHGNTL--SYYDS-----ADTG--SAAKGYGH  195

Query  76   LSSIE  80
            + S+E
Sbjct  196  VKSVE  200

>HYAP_06403
Length=1037

 Score = 37.7 bits (86),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (47%), Gaps = 4/66 (6%)

Query  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVE  111
            +++E  A CH    E  AP  S  LS+  P E     + AA   FG+K V  AP K  VE
Sbjct  101  AFFEHLAVCHTVMPE-KAPDNSLRLSASSPDEQA---LVAAAACFGYKFVARAPGKAMVE  156

Query  112  LDVFVE  117
                +E
Sbjct  157  YFCCIE  162

>PYIR_14494
Length=819

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (62%), Gaps = 4/52 (8%)

Query  6    VPEVG-ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            VP VG    S D++ P  C G++ K G   K+W++R+  L+G+ L  SY++S
Sbjct  699  VPYVGMGCVSLDESFP-GCSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query  2   NILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACH  61
           N++ V  V   +  D A      G+ +K+G   KSW+ R+ VL G  L   Y+  R+   
Sbjct  15  NVIAVSRVTKNSYCDHA------GWASKQGSIIKSWKRRYFVLKGREL--IYFAERS---  63

Query  62  PPTGEPSAPKGSFYLSSIE  80
            P+G+    KG   + ++E
Sbjct  64  -PSGKGIDEKGRLKIVAVE  81

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 23/45 (51%), Gaps = 4/45 (9%)

Query  5    RVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            + P +G T     A    CEG++ KRG    +W+ RF  L+G  L
Sbjct  251  KTPFLGETF----AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQL  291

 Score = 32.0 bits (71),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (55%), Gaps = 11/55 (20%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            G++ K+G   KSW+ RF V++  +  ++YYE             APKG+ +++ +
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYEQLN---------EAPKGNGFINQV  465

>H310_06666
Length=887

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  SYY S+
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>PYAR_26065
Length=314

 Score = 37.0 bits (84),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  52   SYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVE  111
            S++E  + CH    E  AP GS  LS+  P E     + AA   FG+K    AP K +VE
Sbjct  91   SFFEHLSVCHTVMPE-RAPDGSVRLSASSPDEQA---LVAAAACFGYKFSARAPGKAFVE  146

>SPRG_02939
Length=2161

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 82/181 (45%), Gaps = 26/181 (14%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI--  79
            + EGY+ K+GHF  + + +++VL G++L   +Y S  A    T   +A  G   ++S+  
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLRGNHLF--FYASYDAYMAKT---TADVGCSQVASVGD  518

Query  80   -EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLE-----VARNAL  133
             + H  ++        PF  + V HA      ++     T ++++KW+      +A++A+
Sbjct  519  WDGHTLLLTY----PHPFRIETVAHA------QVLCSAPTASEKDKWMRGLRAAIAKHAI  568

Query  134  SAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIE  193
             AK   T  + D  + P  + L     S   + N +    + TL K  D   S  L  ++
Sbjct  569  GAK---TSTSSDVVLDPAVQALQTLLSSYYNEHNPTKHDDIPTLLKLFDGRESQLLSHLD  625

Query  194  A  194
            A
Sbjct  626  A  626

>HYAP_09304
Length=1144

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G F KSWR RF +L      +SYY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>PYAR_15792
Length=121

 Score = 35.4 bits (80),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
           EG +TKR  + K WR RF VL G+ L    Y  RAA  P  G
Sbjct  16  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  53

>H257_06469
Length=76

 Score = 34.3 bits (77),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSY  53
           EGYV K+GH  KSW+ R+  LD S   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>SPRG_14312
Length=661

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 18/119 (15%)

Query  16   DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFY  75
            D   P S  G + K+ +  K+W+ RF+VL G +L   YY S AA      E S PKG   
Sbjct  104  DFYAPLSRSGVLVKQANHLKNWKKRFMVLRGQSL--FYYVSGAA-----SEDSYPKGLIS  156

Query  76   LSSIEPHEYVVGVMGAA--EKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
            L  +E     V ++  A  +K F F++        Y  L +  +   D  +W+   ++A
Sbjct  157  LVGVE-----VQLVDVARFKKQFCFEL----SHPYYRPLYLMAKNEADLTQWMSCIKSA  206

>PYIW_21901
Length=913

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 48/114 (42%), Gaps = 18/114 (16%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL--SSI  79
            S  G++ K GH RK+W+ R+ VLD S L     ES A            KG   L   + 
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL----------KGEVLLFHPAT  472

Query  80   EPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
              H   + + G  +  F    VG    K Y  L +  E L+DR  W+    +AL
Sbjct  473  RVHYVDIHLSGGKDGTFAIH-VG----KDYALL-LQAEQLSDRENWMYCIEDAL  520

>PYIR_21473
Length=667

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 65/148 (44%), Gaps = 29/148 (20%)

Query  24   EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            EG++TKR  H    W  R+ VLDG+ +   YY  R       G+P AP+G++ L+     
Sbjct  2    EGWLTKRRDHMNLIWLERYFVLDGNQMR--YYRKR-------GDP-APRGTYVLTD---G  48

Query  83   EYVVGVMGAAEKP--------FGFKMVGHAPRKGYVE---LDVFVETLNDRNKWLEVARN  131
              V  V  + EK         F       A  K Y +   LD+  +T  +  +W +   N
Sbjct  49   CLVSNVFNSEEKHRHHGPVWMFRITFAVEAGEKSYKKDRFLDLGAKTEENAREWKKAIEN  108

Query  132  ALSAKRQLT----RQAIDQSVSPNRKNL  155
            A+ + R+L     +   D ++ P + ++
Sbjct  109  AVRSLRELVLHQRKMKTDAAIYPTQYSV  136

>CCA26890
Length=1530

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL---SSIEP  81
            GY+ KRG   KS+R R++ L+G+ L  SYY+ + +        + P+GS  L   +S++P
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTSLQP  354

Query  82   HE  83
             E
Sbjct  355  LE  356

>PYU1_G000724
Length=189

 Score = 36.2 bits (82),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESRA  58
            G++TK+GH  KSW+ RF VL  DG+    +YY+++ 
Sbjct  111  GWLTKQGHMWKSWKTRFFVLFADGT---FAYYKNKG  143

>H257_07514
Length=810

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  21  TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
           T  EGYV K+GH  ++WR R+ +L G+    +YY S+
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PYVX_23432
Length=1510

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 4/60 (7%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVEL  112
            ++E  A CH    E +A  GS  LS+  P E     + AA   FGFK V  AP K  VE 
Sbjct  578  FFEHLAVCHTVMPERAA-DGSLRLSASSPDE---QALVAAAACFGFKFVARAPGKAMVEF  633

>PYU1_G003229
Length=810

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 42/84 (50%), Gaps = 9/84 (11%)

Query  13  ASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAP  70
           A G  A+ T C+  G+ +K+G   KSW+ R+ VL G  L   Y+  R+    P+G+    
Sbjct  17  AVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERS----PSGKGINE  70

Query  71  KGSFYLSSIE-PHEYVVGVMGAAE  93
           KG   +  +E   E+  G++   E
Sbjct  71  KGRLKIVGVEFTPEFTNGLLIKGE  94

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  11   ATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
            AT +      T   G++ K+GH  KSW+ RF V++GS   ++Y+E
Sbjct  388  ATVTSGSDSGTRKTGWLNKQGHRMKSWKRRFFVVEGS--TITYFE  430

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 59/129 (46%), Gaps = 25/129 (19%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKG  72
            AS D + P  C G++ K G   K+W++R+  L G+ L  +Y++S              KG
Sbjct  693  ASLDDSLP-GCSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS-------------DKG  736

Query  73   SFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
               L +++    V  V+    K F  ++     RK    L +  +T  + ++WL     A
Sbjct  737  PL-LKALK----VCYVLPMRTKKFCLEVTMETGRK----LLIAADTQAEHDRWLAALHQA  787

Query  133  LSAKRQLTR  141
            +SA+++  R
Sbjct  788  VSAEKEKDR  796

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 0/27 (0%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            CEG++ KRG    +W+ RF  L+G  L
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQL  286

 Score = 32.0 bits (71),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVS  52
            +G++ K+G   K+W+ R+ VLDG  L+ S
Sbjct  520  KGWLMKKGKNFKTWKRRYFVLDGKKLSYS  548

>H257_03931
Length=695

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (45%), Gaps = 14/118 (12%)

Query  15   GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSF  74
             D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S       + E + P+G  
Sbjct  103  SDFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGT-----SSEETFPRGVI  155

Query  75   YLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
             LS ++ H          +K F F+ + H     Y  L +  +   D  +WL   ++A
Sbjct  156  SLSGVDVHPLDTAKF---KKQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSSIKSA  206

>PHYRA_94409
Length=1270

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESR  57
            G++TK+GH  KSW+ RF VL  DG+    +YY+++
Sbjct  113  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  144

>PHYSO_248481
Length=1283

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESR  57
            G++TK+GH  KSW+ RF VL  DG+    +YY+++
Sbjct  92   GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  123

>PITG_03318
Length=1343

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESR  57
            G++TK+GH  KSW+ RF VL  DG+    +YY+++
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  170

>PPTG_16044
Length=1378

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESR  57
            G++TK+GH  KSW+ RF VL  DG+    +YY+++
Sbjct  139  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNK  170

>CCA15513
Length=1341

 Score = 37.0 bits (84),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (46%), Gaps = 27/114 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            G+++K+GH  K WR RF VL  DG+   ++YY  R             KG      I+ +
Sbjct  86   GWLSKQGHLWKGWRSRFFVLYADGT---LAYYRRRGNV--------KMKG-----YIKLN  129

Query  83   EYVVGV----MGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
            E ++G+    +    + + F++     RKG+  L    +T  +   W+   R+A
Sbjct  130  EGIIGIQYIDVWKTSRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVNHLRSA  178

>PHYKE_4911
Length=46

 Score = 32.7 bits (73),  Expect = 0.23, Method: Composition-based stats.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
           G+V K+G   K+W+ RF+VL G  L  +YY++
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDT  38

>CCI43793
Length=1117

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 54/125 (43%), Gaps = 20/125 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            GY+ K+G F KSWR RF +L      ++YY S+       GE S    S  L +  P   
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKEHL-TKLGEISVDDQSVLLKT--PRNG  231

Query  85   VVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLND-RNKWLEVARNALSAKRQLTRQA  143
            +         P  F  V HA R     L +F E   D  N W++  R +   + ++ R A
Sbjct  232  I---------PHCFT-VKHAART----LIMFTEDGEDIMNTWMD--RISRCIRLRIDRNA  275

Query  144  IDQSV  148
            I  ++
Sbjct  276  ITNTI  280

>SPRG_11900
Length=605

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 3/47 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
            +P  C GY+ K+G   K+WR R+  +DG +  +SY ++  A  PP G
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDADGA--PPKG  277

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 7/56 (13%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            G+V K+G   KSW+ RFLV+ G   +V+YY+   + H P       KGS  L  +
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQGR--HVTYYDR--SVHEPNPR---EKGSLVLVDV  54

>PPTG_14626
Length=1055

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 48/116 (41%), Gaps = 32/116 (28%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS----S  78
            C G++ K G   KSW+ R+  L GS L  SYY+S              KGS   S    +
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSE-------------KGSLLRSVSVIN  758

Query  79   IEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS  134
            +EPH  V           G  +     RK    L V  E+  + NKWL   + A++
Sbjct  759  VEPHPSV---------SLGLTVSTVGGRK----LIVQAESNGEFNKWLNAIQEAVA  801

>PHYKE_7856
Length=346

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 20/32 (63%), Gaps = 2/32 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYY  54
           G++TK+GH  KSW+ RF VL  DG+      +
Sbjct  63  GWLTKQGHMWKSWKTRFFVLFSDGTQFEAELW  94

>PHYSO_349983
Length=1320

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (43%), Gaps = 24/122 (20%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            C G++ K G   KSW+ R+  L GS L  SYY++              KGS  L S++  
Sbjct  728  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKT-------------DKGSL-LRSVK--  769

Query  83   EYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQ  142
              VV +       FG  +     RK  ++ D    +  D   WL   R A++A  +  + 
Sbjct  770  --VVNIAANPSVAFGLTVSTAGGRKLVIQAD----SKEDFEMWLGAVREAVAAGEKERKS  823

Query  143  AI  144
            ++
Sbjct  824  SV  825

>SDRG_06288
Length=641

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query  23  CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             G+V K+G   KSW+ RFLV+ G   +VSYY+   + H P  +P   KGS  L  +
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGR--HVSYYDR--SVHEP--DPR-EKGSLVLGDV  54

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
            +P  C G + K+G   K+WR R+  +DG +  +SY  S A   PP G
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPPKG  301

>SPRG_02752
Length=831

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 35/57 (61%), Gaps = 7/57 (12%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           EG++ K+G    +W+ R++VL G   +++YY+ +   +P   E    KG+F L+++E
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVTNPRAKE----KGTFTLAAVE  56

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
            G++ K G   KSW+ RF VL G++L  +YY+
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>SDRG_14487
Length=964

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 36/59 (61%), Gaps = 7/59 (12%)

Query  22  SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           + EG++ K+G    +W+ R++VL G   +++YY+ +   +P   E    KG+F L+++E
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVSNPRAKE----KGTFTLAAVE  56

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
            G++ K G   KSW+ RF VL G++L  +YY+
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>PYAP_13695
Length=348

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 21/135 (16%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K+G   K+W+ RF+VL G  L  +YY++     P   E    KGSF + ++E    
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGKQL--TYYDTE-RISPRVKE----KGSFQVITVEL---  61

Query  85   VVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQLTRQAI  144
                  +++   G  + G   R     L ++ ++ ++ N W     +A +        A+
Sbjct  62   ------SSDIQNGLIVHGRGGRV----LKLYTDSTDNTNGWYHAIMDATNNTGGGGGSAV  111

Query  145  DQSVSPNRKNLFGFN  159
            D+ +S     L G N
Sbjct  112  DR-LSDRYSTLSGGN  125

>H310_06667
Length=896

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
           EGY+ K+G   K W+ R+ V DG +L  SY+ ++A
Sbjct  37  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKA  69

>H257_01308
Length=897

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
           EGY+ K+G   K W+ R+ V DG +L  SYY ++
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>PHYRA_83071
Length=2300

 Score = 36.6 bits (83),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 5/58 (9%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLN--VSYYESRAACHPPTGEPSAPKGSFYLSSI  79
             EGY+ KRGH   S R R+ VL G+ L+  V++ +S+   +P  G  +AP G F ++ +
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSK---NPGGGATTAPLGKFRVAVV  1186

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  12    TASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLNVSYYESRAA  59
             +++G  +     EG +  R H   S WR RF+VL+GS L++ Y E+R A
Sbjct  2046  SSAGTVSNVARTEGQLQVRHHNLGSIWRARFVVLEGSKLSI-YSENREA  2093

>PPTG_11714
Length=2444

 Score = 36.6 bits (83),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 60/147 (41%), Gaps = 29/147 (20%)

Query  13    ASGDKARPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLNVSYYESRAACH-PPTGEPSAP  70
             A  D    T  +GY+  R H   S WR RF+VL+GS L V + E+   C     G+P  P
Sbjct  2013  AGNDNTDTTQTKGYLRVRHHNLGSIWRERFVVLEGSTLTV-FSEN---CQLDEEGKPRFP  2068

Query  71    KGSFYLSSIEPHEYV-----------VGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETL  119
                    ++E HE V           +G  G+  K  GF+    A     V L+    T 
Sbjct  2069  D-----LAVEKHELVGVEKWHPVFTSLGRSGSGLKGTGFR----AETSSGVYLEFIATTA  2119

Query  120   NDRNKW---LEVARNALSAKRQLTRQA  143
              D  KW   +  A    SA   ++R A
Sbjct  2120  EDAFKWKSAITAATTKESATATVSRDA  2146

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (53%), Gaps = 1/51 (2%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSF  74
             EGY+ KRGH   S R R+ VL G+ L   Y     + +P  G  + P G+F
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNELTY-YVTHDDSKNPGGGATTNPLGNF  1192

>PHALS_06336
Length=511

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 8/56 (14%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            ++I+++ E+G      +  P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  118  LSIIQIREMG------REDPATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  165

>PPTG_18989
Length=1213

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>PYAR_14615
Length=517

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
           EG++ K+G   KSW+ R+ V DG  L  SYY SR
Sbjct  38  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  69

>PYVX_19982
Length=700

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ VLDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGNQLR--YYRKR-------GDP-APRGTYVLT  46

>SDRG_02154
Length=822

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G++ K+G   K+W+ RF+VL   +L+  Y+E+      PT +   PKGSF + +IE
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---PKGSFQVLAIE  176

>PHYRA_73432
Length=1313

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (44%), Gaps = 24/124 (19%)

Query  13   ASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKG  72
            +S  ++    C G++ K G   KSW+ R+  L GS L  SYY+S              KG
Sbjct  703  SSTTQSESKGCVGWLKKEGGNVKSWKRRYFTLYGSKL--SYYKSE-------------KG  747

Query  73   SFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
            S  L S+     VV +        G  ++    RK  ++ D    +  + NKWL   + A
Sbjct  748  SL-LRSVS----VVDITAHPSVSLGLTVLTVGGRKLIIQAD----SNEEFNKWLGAIQEA  798

Query  133  LSAK  136
            ++A+
Sbjct  799  VAAE  802

>HYAP_13757
Length=262

 Score = 35.4 bits (80),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%), Gaps = 2/31 (6%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
           G++ KRGH  K+W+ RF +L+G+ L  +YY+
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  43

>PHYKE_4910
Length=375

 Score = 35.8 bits (81),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (9%)

Query  12   TASGDKAR--PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            T SG   R  P +  G+V K G   +SW+ RFLV  G+ L  +YY++
Sbjct  115  TVSGAMGRTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  159

>H310_14473
Length=613

 Score = 35.8 bits (81),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 54/136 (40%), Gaps = 16/136 (12%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR----AACHPPTGEPSAPKGSFYLSSIE  80
            G + KRGH RK+W  RF VL    L   YY       A C   + +P   +G   L+ I 
Sbjct  27   GILLKRGHLRKNWLTRFFVLTSGALR--YYRKPPGGGAKCTTWSVDPRYLRGELPLADII  84

Query  81   PHEYVVGVMGAAEKPFGFKMVGHAPR-------KGYVELDVFVETLNDRNKWLEVARNAL  133
              E        A  P  ++      R       +  V   +   T ++R +W+ V R   
Sbjct  85   HVECDDSTPQPAYHPRTYRFTITVLRHRILFLVRRPVRFHLQATTEDERERWVRVLRE--  142

Query  134  SAKRQLTRQAIDQSVS  149
              ++QL++  + +  S
Sbjct  143  -PRKQLSKVTLPRHTS  157

>PHALS_07930
Length=1200

 Score = 36.2 bits (82),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>PHALS_06568
Length=388

 Score = 35.8 bits (81),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 31/56 (55%), Gaps = 7/56 (13%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
           G+V K+G   KSW+ R++VL G  L  +YY++         +   PKGS  + ++E
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGRQL--TYYDT-----AKVDQKVKPKGSCQVITVE  60

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  14   SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            S D +   +  G++ K G   KSWR RF VL G++L  SY+ S
Sbjct  142  SEDGSEQVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNS  182

>PYAR_16674
Length=651

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ VLDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGNQLR--YYRKR-------GDP-APRGTYVLT  46

>PYIR_13168
Length=1353

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 25/35 (71%), Gaps = 5/35 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESR  57
            G++TK+GH  K+W+ RF VL  DG+    +YY+++
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADGT---FAYYKNK  147

>PHYRA_81944
Length=1149

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G F KSWR RF +L      + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>PYAP_23478
Length=897

 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54
            G++ K GH RK+W++R+ VLD S L   YY
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR--YY  407

>PYAP_23744
Length=123

 Score = 33.9 bits (76),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
           EG +TKR  + K WR R+ VL G+ L    Y  RAA  P  G
Sbjct  16  EGELTKRSVWLKEWRRRYFVLKGNKL----YFCRAANEPAHG  53

>SPRG_14955
Length=635

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query  2   NILRVPEVGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            +L   E  A+  G K +      G + KRGH RK+W  RF VL  ++L   Y + R+  
Sbjct  4   KVLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLRY-YKKPRSPN  62

Query  61  HPPT  64
           H  T
Sbjct  63  HSST  66

>SDRG_08236
Length=864

 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
           EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  53

>PYIW_21944
Length=1317

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 15/108 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++TK+GH  K+W+ RF VL  S+   +YY++              +GS  L     ++ 
Sbjct  105  GWLTKQGHMWKTWKTRFFVL-YSDGTFAYYKNEG--------KKRMQGSLTL-----NDG  150

Query  85   VVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA  132
            +V +     +  G   V     KG+ +L  +  + N+   W+   R+A
Sbjct  151  IVSIKHVDIRKVGKSYVIQV-EKGFYKLLCYCCSQNEAELWVSALRSA  197

>SPRG_01860
Length=674

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  24  EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
           EGY+ K+G   K W+ R+ V DG +L  SYY S
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  53

>PYU1_G009508
Length=328

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G + K+WR R+ +L      +SYY+S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>PYU1_G010818
Length=169

 Score = 34.3 bits (77),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 55/112 (49%), Gaps = 9/112 (8%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG--EPSAPKGSFYLSSIEP  81
            EG++TK+GH  ++ + R+ VL    L  SY+  + +        +PS  KG   L++ + 
Sbjct  62   EGFLTKKGHVLRTQKERYFVLRQHTL--SYFRVKQSEKKAKSVIQPSTLKGVLELTASD-  118

Query  82   HEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
               +V     +++ F  + +  A  K Y +LD+   +  +R +W++  R  +
Sbjct  119  ---IVTPAPHSDQWFRIQKLPDAEGKIY-KLDLKASSQTERQEWIDALRATI  166

>PITG_17594
Length=694

 Score = 35.4 bits (80),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ LS
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGNQLR--YYRKR-------GDP-APRGTYILS  46

>PYU1_G012859
Length=1183

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 20/65 (31%), Positives = 35/65 (54%), Gaps = 7/65 (11%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  60
            M++++ P    + S    +P    G++ K+GH  +SW+ R+ VL G +L   Y+E+    
Sbjct  476  MDLVKAP---PSLSPSIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN--ID  528

Query  61   HPPTG  65
             PP G
Sbjct  529  KPPRG  533

 Score = 35.4 bits (80),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (5%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
            +G++ K G   K+W+ RF+VL G+ L  SYY       PP G
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADETPSSPPLG  236

 Score = 33.5 bits (75),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 27/124 (22%), Positives = 53/124 (43%), Gaps = 24/124 (19%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
            A  ++C G++ K+G   K+W+ R+  L G+ L     E+ +              SF +S
Sbjct  806  ADQSNCHGWLNKQGGTIKTWKRRYFSLHGTTLRYFKRETGSMLR-----------SFTIS  854

Query  78   SIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKR  137
             +E    V           G +++  + RK    L +  E+  D  +WL   + ++SA+ 
Sbjct  855  HVEKQPQVA---------LGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAES  901

Query  138  QLTR  141
             + +
Sbjct  902  SVPK  905

 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  18   ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
            A   +CEG++ K+GH  K W+ R+  L+   L
Sbjct  354  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDML  385

>PYIR_23372
Length=1415

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            S EGY+ K+    +SW+  + VL+G  +  +YYESR
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  355

>PHYSO_478611
Length=522

 Score = 35.4 bits (80),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G+V K+G   K+W+ RF+VL G  L  +YY++ A   P        KGSF + ++E
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDT-AKVDPTVKA----KGSFQVITVE  189

>PYIR_15118
Length=1222

 Score = 35.4 bits (80),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G F K+WR R+ +L      +SYY+S
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>PYAR_13491
Length=1080

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  27  VTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
           +TK+G +R++W+ RF +L     ++SYY+S
Sbjct  2   LTKQGSWRRNWKTRFFILRSDYPSLSYYKS  31

>PHALS_05587
Length=1361

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 5/36 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVL--DGSNLNVSYYESRA  58
            G++ K+GH  KSW+ RF VL  DG+   V YY++++
Sbjct  139  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYKNKS  171

>PYIW_18911
Length=1196

 Score = 35.4 bits (80),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            GY+ K+G F K+WR R+ +L      +SYY+S
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>CCI43456
Length=126

 Score = 33.5 bits (75),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 4/52 (8%)

Query  14  SGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
           S D+ +  + EG +TKR  + K WR R+ +L G+ L    Y S++    P G
Sbjct  11  SIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKSKNDAPHG  58

>PYIW_17571
Length=1330

 Score = 35.4 bits (80),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 48/113 (42%), Gaps = 16/113 (14%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G +TK G +R++W+ RF +L     ++ YY S          P           I+P   
Sbjct  175  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSEDKLELLGEIP-----------IQPDTM  223

Query  85   VVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKR  137
            V+    A   P+ F++     R     L +  E+ +++ +W++  +  + A R
Sbjct  224  VLDRSAAGHAPYRFQV-----RSDAKTLLLEAESRDNQRRWIDSCQELVDAVR  271

>PHYRA_72718
Length=732

 Score = 35.0 bits (79),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 48/124 (39%), Gaps = 21/124 (17%)

Query  18   ARPTSCEGYVTKRG-HFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYL  76
             R     G + KRG  +RK W++RF+ LDG  L  +YYE   A    T   +  K     
Sbjct  87   VRAPVVSGSLEKRGFRWRKKWKLRFVELDGRQL--AYYEDTGAFCATTASCNGTK-----  139

Query  77   SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAK  136
             S +P   V+    A  +    K V   P               D   W+  AR+A + +
Sbjct  140  RSCKPKRKVMLTADATLEDVDDKTVSVTPAL-------------DEKPWMLRARDAATKQ  186

Query  137  RQLT  140
            R L 
Sbjct  187  RWLV  190

>PYIW_15014
Length=702

 Score = 35.0 bits (79),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ VLDG+ +   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFVLDGNQMR--YYRKR-------GDP-APRGTYVLT  46

>H310_04842
Length=1081

 Score = 35.4 bits (80),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 62/146 (42%), Gaps = 27/146 (18%)

Query  9    VGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY----ESRAACHPPT  64
            + ATA G  +     EG V K+G +   W  R+LVLDG+ L   YY    ++R   H   
Sbjct  105  IAATAGGMHS--VHWEGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKQDDARLGKH---  157

Query  65   GEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNK  124
                  +G   L+ + P      +    E  F  +  G   RK +    +  +T  +++ 
Sbjct  158  -----LRGKLILTHVSPE-----IHKKKEHTFAVETTG---RKMFF---MSCDTELEKDM  201

Query  125  WLEVARNALSAKRQLTRQAIDQSVSP  150
            W+E+ + A+S      RQ  ++   P
Sbjct  202  WVEMIQAAISEAAAPQRQHANRHGQP  227

>PYVX_14527
Length=1269

 Score = 35.4 bits (80),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G+V K+G   ++W+ RF+VL G  L  +YY++ A   P        KGSF L ++E
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGRQL--TYYDT-ARLTPSV----KAKGSFTLITVE  951

 Score = 32.0 bits (71),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            G+V K G   +SW+ RFLV  G++L  +YY++
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKN  618

>SPRG_00889
Length=994

 Score = 35.0 bits (79),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+LVLDG+ L  +YY  +      +G+    +G   L+ + P  
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDAR--SGK--NLRGRMVLTYVGPD-  175

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
                    ++K  GF +      KG+    +   T  +++ W+E+ + AL
Sbjct  176  ------FKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  215

>PYVX_13084
Length=1267

 Score = 35.0 bits (79),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 34/71 (48%), Gaps = 16/71 (23%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR---------AACHPPTGEPSAPKGSFY  75
            GY+ K+G F K+WR R+ VL      +SY+ S+         A     T EP APK  F 
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKDDLMKLGEIAIDESTTVEP-APKDGF-  299

Query  76   LSSIEPHEYVV  86
                 P+ ++V
Sbjct  300  -----PNRFIV  305

>CCA27255
Length=1125

 Score = 35.0 bits (79),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACH  61
            GY+ K+G +R++W+ RF +L     +  YY+S+   H
Sbjct  167  GYLLKQGSWRRNWKSRFFMLRQDYPSFCYYKSQHKLH  203

>SDRG_14070
Length=630

 Score = 35.0 bits (79),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  3   ILRVPEVGATASGDKARP-TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYE  55
           +L   E  A+  G K +      G + KRGH RK+W  RF VL  ++L   YY+
Sbjct  5   VLHPQESSASMGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>PYAR_19291
Length=711

 Score = 35.0 bits (79),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query  1    MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            +N L +    A+   D    + C G++ K GH RK+W++R+ VL+ S L   YY   A
Sbjct  189  LNGLYLDHPTASPFDDTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEA  243

>PHALS_06334
Length=1064

 Score = 35.0 bits (79),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRA  58
            C G++ K G   KSW+ R+  L GS L  SYY+S+ 
Sbjct  726  CVGWLKKEGKNVKSWKWRYFTLYGSKL--SYYKSKT  759

>PYAR_13429
Length=694

 Score = 35.0 bits (79),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 16/75 (21%)

Query  33   FRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAA  92
            +RK W+ RF+ L+G  L  SYYE     H  TG   AP+ S ++++   + ++V V    
Sbjct  124  WRKKWKPRFVELNGRVL--SYYE---VLHATTGRARAPRQSVHITA---NAHIVDVDSCT  175

Query  93   --------EKPFGFK  99
                    EKP+ F+
Sbjct  176  FSLLPNPGEKPWVFR  190

>PYAR_18690
Length=2455

 Score = 35.0 bits (79),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 4/69 (6%)

Query  6     VPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTG  65
             V E+ A  S  +      EGY+ KRGH   S R R+ VL  + L  +YY ++        
Sbjct  1120  VDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSR--NS  1175

Query  66    EPSAPKGSF  74
             + S P GSF
Sbjct  1176  DTSQPLGSF  1184

>PYU1_G012274
Length=873

 Score = 35.0 bits (79),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  22   SCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
            S EGY+ K+    +SW+  + VL+G  +  +YYESR
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESR  343

>PHALS_08097
Length=1069

 Score = 35.0 bits (79),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56
            G++TK+G +R++W+ RF +L     ++ Y+ S
Sbjct  144  GFLTKQGSWRRNWKTRFFILRSDCPSLCYFTS  175

>PHYCA_505441
Length=694

 Score = 35.0 bits (79),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLERYFLLDGNQLR--YYRKR-------GDP-APRGTYILT  46

>SPRG_08834
Length=825

 Score = 35.0 bits (79),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE  80
            G++ K+G   K+W+ RF+VL   +L+  Y+E+      PT +   PKGSF +  IE
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT--PTLK---PKGSFQVLVIE  176

>HYAP_13688
Length=1036

 Score = 35.0 bits (79),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 47/112 (42%), Gaps = 24/112 (21%)

Query  23   CEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPH  82
            C G++ K G   KSW+ R+  L G+ L  SYY+               KGS  L S++  
Sbjct  698  CVGWLRKEGGNVKSWKRRYFTLYGAKL--SYYK-------------CEKGSL-LRSVD--  739

Query  83   EYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALS  134
               VGV      P G  +     RK  ++ D  VE     ++WL   + A S
Sbjct  740  --TVGVTVHPSMPNGLMVATAGGRKLIIQADTNVEF----DRWLNAIQRAAS  785

>SPRG_00364
Length=255

 Score = 34.3 bits (77),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (46%), Gaps = 27/111 (24%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G+V KRG   ++W+ R+ VL  + L  +YY+         G+P   KG  ++ SIE    
Sbjct  166  GWVEKRGAVMRTWKRRYFVLRENVL--AYYDINL-----EGQPK--KGGDFVQSIET---  213

Query  85   VVGVMGAAEKPFG--FKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
                  +  KP G  FKMV      G      F ET +D  +WL +A N L
Sbjct  214  ------STIKPNGLEFKMVSGRSLLG------FTETTDDHVQWL-LAANTL  251

>PHYSO_304784
Length=694

 Score = 34.7 bits (78),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGNQLR--YYRKR-------GDP-APRGTYILT  46

>SDRG_08383
Length=1321

 Score = 35.0 bits (79),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 4/59 (7%)

Query  53   YYESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVE  111
            ++E  A CH    E SA  GS  LS+  P E     + AA   FGFK    AP +  +E
Sbjct  507  FFEHLAVCHTVMPETSA-DGSLRLSASSPDE---QALVAAAACFGFKFFARAPGEAVIE  561

>CCI10928
Length=1530

 Score = 35.0 bits (79),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query  10   GATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSA  69
            GA A   K    +  GY+ KRG   KS+R R++ L G+ L  SYY+ + +        + 
Sbjct  288  GAKAC-QKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTY  344

Query  70   PKGSFYLSSI  79
             +GS +L S+
Sbjct  345  LRGSIHLESV  354

>PPTG_16174
Length=693

 Score = 34.7 bits (78),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGNQLR--YYRKR-------GDP-APRGTYILT  46

>PHYRA_84567
Length=696

 Score = 34.7 bits (78),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGNQLR--YYRKR-------GDP-APRGTYILT  46

>SDRG_01408
Length=916

 Score = 34.7 bits (78),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 17/110 (15%)

Query  24   EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHE  83
            EG+V K+G +   W  R+LVLDG+ L  +YY  +      +G+    +G   L+ + P  
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDAR--SGK--NLRGRMVLTYVGPD-  177

Query  84   YVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
                     +K  GF +      KG+    +   T  +++ W+E+ + AL
Sbjct  178  ------FKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  217

>PYAP_19560
Length=337

 Score = 34.3 bits (77),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 25/134 (19%)

Query  2    NILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACH  61
            +ILR+P +         R     G++ K+G   K+W+ RF +L+GS L  +YY       
Sbjct  73   SILRLPTM-------YVRGPVFHGWLWKKGASFKTWKKRFFLLNGSTL--TYYTQSCVVA  123

Query  62   PPTGEPS---APKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVET  118
               G        KG   ++S +  +         E  FG ++V  + R  +V+       
Sbjct  124  TEVGTRCFDMPAKGGLRVASADFTD---------ETSFGIRIVSSSGRVLFVQ----AGD  170

Query  119  LNDRNKWLEVARNA  132
               R KWL V + A
Sbjct  171  RTSRIKWLGVLQEA  184

>SPRG_04912
Length=261

 Score = 34.3 bits (77),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 18/106 (17%)

Query  20   PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSI  79
            P    GYV K+G F K+W+ R + L    L   YY S  A        + P+G F ++S+
Sbjct  38   PPDFSGYVRKQGSFVKNWKRRIMALHDDTL--FYYVSERAM-------AKPRGVFRVTSV  88

Query  80   E-PHEYVVGVM--GAAEKPFGFKMVGHAPRKGYVELDVFVETLNDR  122
                + + G++  G   +   F +          E D + ETL++R
Sbjct  89   AYAPDLLHGLIADGTGTRRLKFTLADSD------ECDAWYETLSER  128

>PYIR_16780
Length=1352

 Score = 34.7 bits (78),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 87/196 (44%), Gaps = 45/196 (23%)

Query  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACH--PPTGE--PSAPKGSFYL  76
            T   G++ K+G   +S++ R++ L+GS L  SYY+ +   H  P + E   +  +G+  L
Sbjct  158  TFISGFLRKKGETNRSFKRRYMELNGSIL--SYYKKKPEKHGIPLSREDKKAYERGNIDL  215

Query  77   ---SSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNA-  132
               SS++P       M +  +P+G  +V  A  + +V   +  E+  D ++WL+V  +  
Sbjct  216  ERVSSLQP-------MESKSEPYGIHLVTTA--RTWV---IAAESEQDYHRWLKVLCSVV  263

Query  133  ------LSAKRQLTRQAID-QSVSPNRK----------------NLFGFNISLSPQPNMS  169
                  ++ KR    Q +  Q+++  R                 N +   +  +P     
Sbjct  264  KFSAVHVTYKRMFQLQEVSAQAITDVRMVITTGDTVGEIVEHIFNCYKQALDAAPLRPYD  323

Query  170  PQKQMQTLTKSRDELL  185
            P K +  +T SRD L+
Sbjct  324  PAKYLLKITGSRDYLI  339

>PITG_21026
Length=694

 Score = 34.7 bits (78),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGNQLR--YYRKR-------GDP-APRGTYILT  46

>PYIR_24588
Length=909

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (43%), Gaps = 16/110 (15%)

Query  25   GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIEPHEY  84
            G++ K GH RK+W+ R+ VL+ S L     ES A            KG   L       +
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARL----------KGEVLLFHPATRVH  461

Query  85   VVGVMGAAEKPFGFKM-VGHAPRKGYVELDVFVETLNDRNKWLEVARNAL  133
             V +  +  K   F + VG    K Y  L +  + L+DR  W+    +AL
Sbjct  462  YVDIHLSGGKDCTFAIHVG----KDYALL-LQADQLSDRENWMYCIEDAL  506

>CCA19033
Length=1883

 Score = 34.7 bits (78),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESR  57
             EGY+ KRGH   S R R+ VL   N  + Y+E++
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETK  1054

>H310_01921
Length=341

 Score = 34.3 bits (77),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (55%), Gaps = 8/66 (12%)

Query  25  GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSSIE-PHE  83
           G+V K+G   KSW+ R++VL   N  ++Y+ES           S  KGSF + ++E  H+
Sbjct  24  GWVYKQGSMIKSWKKRYMVL--KNKQLTYFESE-----KVEGNSKAKGSFQVITVEIAHD  76

Query  84  YVVGVM  89
              G++
Sbjct  77  IKNGLL  82

>SPRG_15871
Length=101

 Score = 32.3 bits (72),  Expect = 0.99, Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 35/86 (41%), Gaps = 5/86 (6%)

Query  8   EVGATASGDK---ARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPT  64
           E   TAS D    A  T  EGY+ KR  + K W   + VL G  L        A   P  
Sbjct  16  ETTITASVDTPAVAVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPEN  75

Query  65  GEPSAPKGSFYLSSIEPHEYVVGVMG  90
            +     G+F  +S    ++VV + G
Sbjct  76  SK--IKHGAFSFTSHVVLQHVVSIHG  99

>PPTG_16659
Length=916

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query  13  ASGDKARPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAP  70
           A G   R + C+  G+  K+G   KSW+ R+ VL G  L   Y+  R+    P+G+    
Sbjct  32  AVGRVVRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGREL--IYFSERS----PSGKGIDE  85

Query  71  KGSFYLSSIE  80
           KG   +S +E
Sbjct  86  KGRLRISGVE  95

>PHALS_02739
Length=648

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 11/55 (20%)

Query  24  EGYVTKR-GHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLS  77
           EG++TKR  H    W  R+ +LDG+ L   YY  R       G+P AP+G++ L+
Sbjct  2   EGWLTKRRDHMNLIWLDRYFLLDGNQLR--YYRKR-------GDP-APRGTYVLT  46

Lambda      K        H        a         alpha
   0.317    0.133    0.379    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22951312005

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40