Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_353401534611461467852e-108
PHYRA_81105534612011467088e-96
PPTG_17123147532011467071e-95
PHYCA_537323449662001467019e-95
PITG_18452147538561467143e-89
HYAP_07096534612511466052e-79
PYVX_18173449665001425652e-70
PYU1_G001739932032661444848e-61
PYU1_G001738534612261384373e-54
PYU1_G001740147522061404241e-52
PYIR_25089854042621394273e-52
PPTG_10635528561991444197e-52
PYIW_18788932032441464159e-51
PHYCA_14369109792481444151e-50
PPTG_10634720132081384093e-50
PHYSO_341599109791851444056e-50
PYU1_G001742932042131384076e-50
PPTG_10636109792461444107e-50
PYU1_G001744568762131384061e-49
PHYCA_102852242061951394022e-49
PHYRA_85631109792281394052e-49
PHYSO_536424606911971454013e-49
PHYSO_507031586531971454013e-49
PHYRA_84190720132061394014e-49
PHYCA_102624720131951393971e-48
PHYCA_102550457052681444004e-48
PYU1_G001741854041991383944e-48
PHYKE_8388568762051423921e-47
PPTG_10643457052501383951e-47
PHALS_00498109791991423874e-47
PYIW_18791854041941453822e-46
PHYRA_81107568762021423823e-46
PHYRA_82864231281931393813e-46
PHYSO_477820568762021423823e-46
PYIR_26626147522121393754e-45
PHYCA_511409568762041423737e-45
PHYKE_839053461130783669e-45
PPTG_15264231281941433711e-44
PPTG_17366239131941433711e-44
PHYKE_3446231281991393711e-44
PPTG_10048213141901433701e-44
PPTG_17121568762021423711e-44
PHALS_03284309411881423673e-44
PHYKE_7718109792201393704e-44
PHYKE_8389147522041423651e-43
PHYCA_129425147522041423633e-43
PHYSO_284086147522041423633e-43
PYAR_24096932032271403618e-43
PYVX_18174854042041433572e-42
PHYRA_81106147522021423572e-42
PYAP_22273932032681403604e-42
PPTG_17122147522041423484e-41
PHYCA_510817445761881403431e-40
PYVX_18176568762011423415e-40
PPTG_14254445761881403381e-39
PPTG_14255469372681383389e-39
PYIR_26546866052391413351e-38
PHYKE_9185445762811383362e-38
PYAP_22279854042231473295e-38
PITG_18450147522031423232e-37
PHYSO_417649445761851383205e-37
PYAP_22278932042891503181e-35
PPTG_0882086622501423109e-35
PHYSO_343376532371721173031e-34
PHYSO_262732469371881383031e-34
PHYCA_53693413059831383232e-34
PHYSO_499978231281741172995e-34
PHYSO_501575820771741172995e-34
PITG_1049986623231423071e-33
PITG_13520109791711072892e-32
PHYSO_254168462841701412822e-31
PHYSO_527908600641741252779e-31
PHYSO_340369526762001402772e-30
PHYSO_34159652856231962713e-29
PYAP_18131991722261192443e-25
PHYSO_342364529831941322241e-22
PHYRA_74651699693441342284e-22
PHYRA_73607194343431362251e-21
PYAP_246891014392521322174e-21
PYIR_1643542333041222152e-20
PHYCA_14368528562191392103e-20
PYAP_18711943562101212085e-20
PHYRA_7358442332871362116e-20
PHYCA_534473423310501362167e-20
PHYKE_2937571983661382121e-19
PPTG_04622696962731362072e-19
PHYSO_484051571982851332073e-19
PHYSO_533903604652081272024e-19
PPTG_04647194343271352065e-19
PYVX_14662510865401322096e-19
PHYCA_13036542352661272036e-19
PHYCA_531163194343141382057e-19
PITG_0494842342321262018e-19
PHYRA_73606571983661302068e-19
PHYCA_534296526713091322012e-18
PITG_0527144782781241993e-18
H310_0636217301971271953e-18
PHYKE_600144782891281993e-18
PHYKE_2809752822911231976e-18
PHYKE_10578778802391111956e-18
PHALS_0539242353671301996e-18
PPTG_0461842353261311987e-18
PYU1_G005323943552511191957e-18
PPTG_0461942342761261968e-18
PYU1_G01469042342951241968e-18
PHYSO_48395542353201301971e-17
PHYSO_340333526712841261951e-17
PHYSO_34033244782951261951e-17
PYAP_18709943552351191921e-17
PHYCA_1961197755311311972e-17
H257_1355017302661381913e-17
PHYRA_78175764333191291934e-17
PYIW_19151831912481281895e-17
PHYRA_77971705552301091885e-17
PHYRA_85794726192301091886e-17
PPTG_0313997753201261916e-17
SPRG_199171339462411411887e-17
PHYRA_86016727462361111871e-16
PHYRA_7868968382961321891e-16
SDRG_173181339462411411871e-16
PHYKE_6077188563221321891e-16
PYU1_G007476539131951271841e-16
PHYSO_48552442342781261871e-16
PHYRA_86752732363001111881e-16
PYU1_G007364851643161261882e-16
PHYRA_83499204334731111902e-16
PHYSO_438103557212381321842e-16
PYIR_16443823992751231853e-16
PYIR_1644442341821231813e-16
PITG_0494942353371311873e-16
PHYCA_12942213313531001873e-16
PPTG_0750738072991111853e-16
PPTG_07509718142991111853e-16
PYIW_27477823991801211804e-16
PHYSO_533682604462781311844e-16
PHYCA_12727044782791321835e-16
PYVX_20789539132901331836e-16
PHYKE_2454751493741221856e-16
PHYRA_78161375713731291856e-16
PHYSO_459106194342231341807e-16
PHYCA_19598375713901261857e-16
PITG_1193697753331261847e-16
PYVX_1817514752147411768e-16
PHYRA_7358342346301271858e-16
PHYRA_7358242353261301839e-16
SDRG_081291363312181491791e-15
PHYSO_533747604512061261781e-15
SDRG_081371363342821491811e-15
PHYKE_391342343211231821e-15
PYVX_16138786195591251832e-15
PHYRA_7862657895473491822e-15
PYIR_16375823732621201792e-15
PYIR_24743851643571411812e-15
PYAR_14256943551991191762e-15
PHYRA_7862554146434491822e-15
PHYSO_524101597733081311802e-15
PHALS_0648053461159401732e-15
PHYCA_12943369712871111793e-15
PHYCA_97965401872881111793e-15
SPRG_077951259793351231793e-15
SDRG_075651244122781481783e-15
PYVX_1817953461147411713e-15
PHYSO_246676457051871391743e-15
PHYSO_374518539131161061693e-15
PHYRA_7914038074241111804e-15
PYU1_G005324845341911201744e-15
PYU1_G005326463491911201744e-15
PYU1_G00532842331911201744e-15
PHYCA_69583463492241341754e-15
PYVX_20783375052761271774e-15
PYAR_14260845342121191736e-15
PHYCA_1865738072951091767e-15
PPTG_0462042333421311778e-15
CCA1717917291851291718e-15
PYU1_G005325943562071201728e-15
PHYCA_98479819502761061758e-15
PYIR_23585845342401201739e-15
PHALS_0317644782071261729e-15
PYAP_19707995792411061739e-15
SPRG_19916161733051411751e-14
PHYKE_6079597733021261751e-14
H257_112641259792821361741e-14
PHYRA_8063173983201331751e-14
PYVX_21297798802631081741e-14
PYIW_2196497752651281731e-14
PHYRA_83500718143941111761e-14
PHYRA_78176597733121281741e-14
PPTG_04803375052681271731e-14
PITG_0889273983091331741e-14
PPTG_07521450302811061732e-14
SPRG_076271258855361351752e-14
PPTG_0625673983181211732e-14
PHYRA_84947539132651341722e-14
SDRG_154261258855231351742e-14
PHALS_03179308833721271742e-14
PHYCA_112615308831961141682e-14
PHYRA_78174188562791441713e-14
PHYSO_255056463492691251713e-14
PHYSO_24648197753181311723e-14
PYAP_24691101441145661644e-14
PYAR_1816599579261961694e-14
PHYKE_902473982991331704e-14
CCI4738117292111261666e-14
PITG_0494742332981291696e-14
PPTG_1422144782751321696e-14
SDRG_17317161731221051617e-14
H257_112651431862821361687e-14
SPRG_077971259813181231698e-14
PHALS_03177526712591371661e-13
PHYCA_15125371743341181681e-13
PHYKE_771752856568451681e-13
PPTG_03153597733141271671e-13
PPTG_06253371743031331671e-13
PHYKE_1913732362801051662e-13
PHYRA_86241728921951261622e-13
PPTG_0752038142941051662e-13
PPTG_07516464352941051662e-13
PHYKE_6002526711971231622e-13
PYAP_1871342341841251612e-13
PHYCA_18729375053911271672e-13
PHYRA_8075044782751211652e-13
PPTG_0315697874451221672e-13
SPRG_2216117303001411653e-13
PHYKE_2379539132851301643e-13
SDRG_0878217304501411663e-13
PYAP_18138991732681181633e-13
SDRG_165341259793201231643e-13
PYVX_2250897752981261643e-13
PPTG_0316097913791261654e-13
PPTG_03138188562941311634e-13
PYU1_G00152797792781261634e-13
PYU1_G00152397762781261634e-13
PYAP_1971299581276961634e-13
PHYCA_19612188566101311655e-13
PHYRA_83494464352241061615e-13
PITG_1193797763051071635e-13
PHYKE_607897753171321635e-13
PHYCA_12331697763161221635e-13
HYAP_1192397766061071646e-13
PHYKE_574938073001051626e-13
PHYSO_525076188573661281637e-13
PPTG_18166242064451061637e-13
PYU1_G00152697803341261628e-13
PYIW_1552617302561261609e-13
PYVX_24563161732541351609e-13
PYIR_2213497753001281611e-12
PYAP_22462820772101401562e-12
PHYKE_6076764332721321582e-12
PYU1_G006403823732521271572e-12
PYIW_1879293204125781512e-12
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_353401

Length=147
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_353401                                                          306        2e-108
PHYRA_81105                                                           277        8e-96 
PPTG_17123                                                            276        1e-95 
PHYCA_537323                                                          274        9e-95 
PITG_18452                                                            279        3e-89 
HYAP_07096                                                            237        2e-79 
PYVX_18173                                                            222        2e-70 
PYU1_G001739                                                          191        8e-61 
PYU1_G001738                                                          172        3e-54 
PYU1_G001740                                                          167        1e-52 
PYIR_25089                                                            169        3e-52 
PPTG_10635                                                            166        7e-52 
PYIW_18788                                                            164        9e-51 
PHYCA_14369                                                           164        1e-50 
PPTG_10634                                                            162        3e-50 
PHYSO_341599                                                          160        6e-50 
PYU1_G001742                                                          161        6e-50 
PPTG_10636                                                            162        7e-50 
PYU1_G001744                                                          160        1e-49 
PHYCA_102852                                                          159        2e-49 
PHYRA_85631                                                           160        2e-49 
PHYSO_536424                                                          159        3e-49 
PHYSO_507031                                                          159        3e-49 
PHYRA_84190                                                           159        4e-49 
PHYCA_102624                                                          157        1e-48 
PHYCA_102550                                                          158        4e-48 
PYU1_G001741                                                          156        4e-48 
PHYKE_8388                                                            155        1e-47 
PPTG_10643                                                            156        1e-47 
PHALS_00498                                                           153        4e-47 
PYIW_18791                                                            151        2e-46 
PHYRA_81107                                                           151        3e-46 
PHYRA_82864                                                           151        3e-46 
PHYSO_477820                                                          151        3e-46 
PYIR_26626                                                            149        4e-45 
PHYCA_511409                                                          148        7e-45 
PHYKE_8390                                                            145        9e-45 
PPTG_15264                                                            147        1e-44 
PPTG_17366                                                            147        1e-44 
PHYKE_3446                                                            147        1e-44 
PPTG_10048                                                            147        1e-44 
PPTG_17121                                                            147        1e-44 
PHALS_03284                                                           145        3e-44 
PHYKE_7718                                                            147        4e-44 
PHYKE_8389                                                            145        1e-43 
PHYCA_129425                                                          144        3e-43 
PHYSO_284086                                                          144        3e-43 
PYAR_24096                                                            143        8e-43 
PYVX_18174                                                            142        2e-42 
PHYRA_81106                                                           142        2e-42 
PYAP_22273                                                            143        4e-42 
PPTG_17122                                                            138        4e-41 
PHYCA_510817                                                          136        1e-40 
PYVX_18176                                                            135        5e-40 
PPTG_14254                                                            134        1e-39 
PPTG_14255                                                            134        9e-39 
PYIR_26546                                                            133        1e-38 
PHYKE_9185                                                            134        2e-38 
PYAP_22279                                                            131        5e-38 
PITG_18450                                                            129        2e-37 
PHYSO_417649                                                          127        5e-37 
PYAP_22278                                                            127        1e-35 
PPTG_08820                                                            124        9e-35 
PHYSO_343376                                                          121        1e-34 
PHYSO_262732                                                          121        1e-34 
PHYCA_536934                                                          129        2e-34 
PHYSO_499978                                                          119        5e-34 
PHYSO_501575                                                          119        5e-34 
PITG_10499                                                            122        1e-33 
PITG_13520                                                            115        2e-32 
PHYSO_254168                                                          113        2e-31 
PHYSO_527908                                                          111        9e-31 
PHYSO_340369                                                          111        2e-30 
PHYSO_341596                                                          108        3e-29 
PYAP_18131                                                            98.6       3e-25 
PHYSO_342364                                                          90.9       1e-22 
PHYRA_74651                                                           92.4       4e-22 
PHYRA_73607                                                           91.3       1e-21 
PYAP_24689                                                            88.2       4e-21 
PYIR_16435                                                            87.4       2e-20 
PHYCA_14368                                                           85.5       3e-20 
PYAP_18711                                                            84.7       5e-20 
PHYRA_73584                                                           85.9       6e-20 
PHYCA_534473                                                          87.8       7e-20 
PHYKE_2937                                                            86.3       1e-19 
PPTG_04622                                                            84.3       2e-19 
PHYSO_484051                                                          84.3       3e-19 
PHYSO_533903                                                          82.4       4e-19 
PPTG_04647                                                            84.0       5e-19 
PYVX_14662                                                            85.1       6e-19 
PHYCA_130365                                                          82.8       6e-19 
PHYCA_531163                                                          83.6       7e-19 
PITG_04948                                                            82.0       8e-19 
PHYRA_73606                                                           84.0       8e-19 
PHYCA_534296                                                          82.0       2e-18 
PITG_05271                                                            81.3       3e-18 
H310_06362                                                            79.7       3e-18 
PHYKE_6001                                                            81.3       3e-18 
PHYKE_2809                                                            80.5       6e-18 
PHYKE_10578                                                           79.7       6e-18 
PHALS_05392                                                           81.3       6e-18 
PPTG_04618                                                            80.9       7e-18 
PYU1_G005323                                                          79.7       7e-18 
PPTG_04619                                                            80.1       8e-18 
PYU1_G014690                                                          80.1       8e-18 
PHYSO_483955                                                          80.5       1e-17 
PHYSO_340333                                                          79.7       1e-17 
PHYSO_340332                                                          79.7       1e-17 
PYAP_18709                                                            78.6       1e-17 
PHYCA_19611                                                           80.5       2e-17 
H257_13550                                                            78.2       3e-17 
PHYRA_78175                                                           79.0       4e-17 
PYIW_19151                                                            77.4       5e-17 
PHYRA_77971                                                           77.0       5e-17 
PHYRA_85794                                                           77.0       6e-17 
PPTG_03139                                                            78.2       6e-17 
SPRG_19917                                                            77.0       7e-17 
PHYRA_86016                                                           76.6       1e-16 
PHYRA_78689                                                           77.4       1e-16 
SDRG_17318                                                            76.6       1e-16 
PHYKE_6077                                                            77.4       1e-16 
PYU1_G007476                                                          75.5       1e-16 
PHYSO_485524                                                          76.6       1e-16 
PHYRA_86752                                                           77.0       1e-16 
PYU1_G007364                                                          77.0       2e-16 
PHYRA_83499                                                           77.8       2e-16 
PHYSO_438103                                                          75.5       2e-16 
PYIR_16443                                                            75.9       3e-16 
PYIR_16444                                                            74.3       3e-16 
PITG_04949                                                            76.6       3e-16 
PHYCA_12942                                                           76.6       3e-16 
PPTG_07507                                                            75.9       3e-16 
PPTG_07509                                                            75.9       3e-16 
PYIW_27477                                                            73.9       4e-16 
PHYSO_533682                                                          75.5       4e-16 
PHYCA_127270                                                          75.1       5e-16 
PYVX_20789                                                            75.1       6e-16 
PHYKE_2454                                                            75.9       6e-16 
PHYRA_78161                                                           75.9       6e-16 
PHYSO_459106                                                          73.9       7e-16 
PHYCA_19598                                                           75.9       7e-16 
PITG_11936                                                            75.5       7e-16 
PYVX_18175                                                            72.4       8e-16 
PHYRA_73583                                                           75.9       8e-16 
PHYRA_73582                                                           75.1       9e-16 
SDRG_08129                                                            73.6       1e-15 
PHYSO_533747                                                          73.2       1e-15 
SDRG_08137                                                            74.3       1e-15 
PHYKE_3913                                                            74.7       1e-15 
PYVX_16138                                                            75.1       2e-15 
PHYRA_78626                                                           74.7       2e-15 
PYIR_16375                                                            73.6       2e-15 
PYIR_24743                                                            74.3       2e-15 
PYAR_14256                                                            72.4       2e-15 
PHYRA_78625                                                           74.7       2e-15 
PHYSO_524101                                                          73.9       2e-15 
PHALS_06480                                                           71.2       2e-15 
PHYCA_12943                                                           73.6       3e-15 
PHYCA_97965                                                           73.6       3e-15 
SPRG_07795                                                            73.6       3e-15 
SDRG_07565                                                            73.2       3e-15 
PYVX_18179                                                            70.5       3e-15 
PHYSO_246676                                                          71.6       3e-15 
PHYSO_374518                                                          69.7       3e-15 
PHYRA_79140                                                           73.9       4e-15 
PYU1_G005324                                                          71.6       4e-15 
PYU1_G005326                                                          71.6       4e-15 
PYU1_G005328                                                          71.6       4e-15 
PHYCA_69583                                                           72.0       4e-15 
PYVX_20783                                                            72.8       4e-15 
PYAR_14260                                                            71.2       6e-15 
PHYCA_18657                                                           72.4       7e-15 
PPTG_04620                                                            72.8       8e-15 
CCA17179                                                              70.5       8e-15 
PYU1_G005325                                                          70.9       8e-15 
PHYCA_98479                                                           72.0       8e-15 
PYIR_23585                                                            71.2       9e-15 
PHALS_03176                                                           70.9       9e-15 
PYAP_19707                                                            71.2       9e-15 
SPRG_19916                                                            72.0       1e-14 
PHYKE_6079                                                            72.0       1e-14 
H257_11264                                                            71.6       1e-14 
PHYRA_80631                                                           72.0       1e-14 
PYVX_21297                                                            71.6       1e-14 
PYIW_21964                                                            71.2       1e-14 
PHYRA_83500                                                           72.4       1e-14 
PHYRA_78176                                                           71.6       1e-14 
PPTG_04803                                                            71.2       1e-14 
PITG_08892                                                            71.6       1e-14 
PPTG_07521                                                            71.2       2e-14 
SPRG_07627                                                            72.0       2e-14 
PPTG_06256                                                            71.2       2e-14 
PHYRA_84947                                                           70.9       2e-14 
SDRG_15426                                                            71.6       2e-14 
PHALS_03179                                                           71.6       2e-14 
PHYCA_112615                                                          69.3       2e-14 
PHYRA_78174                                                           70.5       3e-14 
PHYSO_255056                                                          70.5       3e-14 
PHYSO_246481                                                          70.9       3e-14 
PYAP_24691                                                            67.8       4e-14 
PYAR_18165                                                            69.7       4e-14 
PHYKE_9024                                                            70.1       4e-14 
CCI47381                                                              68.6       6e-14 
PITG_04947                                                            69.7       6e-14 
PPTG_14221                                                            69.7       6e-14 
SDRG_17317                                                            66.6       7e-14 
H257_11265                                                            69.3       7e-14 
SPRG_07797                                                            69.7       8e-14 
PHALS_03177                                                           68.6       1e-13 
PHYCA_15125                                                           69.3       1e-13 
PHYKE_7717                                                            69.3       1e-13 
PPTG_03153                                                            68.9       1e-13 
PPTG_06253                                                            68.9       1e-13 
PHYKE_1913                                                            68.6       2e-13 
PHYRA_86241                                                           67.0       2e-13 
PPTG_07520                                                            68.6       2e-13 
PPTG_07516                                                            68.6       2e-13 
PHYKE_6002                                                            67.0       2e-13 
PYAP_18713                                                            66.6       2e-13 
PHYCA_18729                                                           68.9       2e-13 
PHYRA_80750                                                           68.2       2e-13 
PPTG_03156                                                            68.9       2e-13 
SPRG_22161                                                            68.2       3e-13 
PHYKE_2379                                                            67.8       3e-13 
SDRG_08782                                                            68.6       3e-13 
PYAP_18138                                                            67.4       3e-13 
SDRG_16534                                                            67.8       3e-13 
PYVX_22508                                                            67.8       3e-13 
PPTG_03160                                                            68.2       4e-13 
PPTG_03138                                                            67.4       4e-13 
PYU1_G001527                                                          67.4       4e-13 
PYU1_G001523                                                          67.4       4e-13 
PYAP_19712                                                            67.4       4e-13 
PHYCA_19612                                                           68.2       5e-13 
PHYRA_83494                                                           66.6       5e-13 
PITG_11937                                                            67.4       5e-13 
PHYKE_6078                                                            67.4       5e-13 
PHYCA_123316                                                          67.4       5e-13 
HYAP_11923                                                            67.8       6e-13 
PHYKE_5749                                                            67.0       6e-13 
PHYSO_525076                                                          67.4       7e-13 
PPTG_18166                                                            67.4       7e-13 
PYU1_G001526                                                          67.0       8e-13 
PYIW_15526                                                            66.2       9e-13 
PYVX_24563                                                            66.2       9e-13 
PYIR_22134                                                            66.6       1e-12 
PYAP_22462                                                            64.7       2e-12 
PHYKE_6076                                                            65.5       2e-12 
PYU1_G006403                                                          65.1       2e-12 
PYIW_18792                                                            62.8       2e-12 
PHYRA_78162                                                           66.2       2e-12 
PYU1_G005868                                                          65.5       2e-12 
PYU1_G005869                                                          65.5       2e-12 
PHYCA_6388                                                            65.5       2e-12 
PPTG_03144                                                            65.5       2e-12 
PYAR_21940                                                            65.1       2e-12 
SDRG_17448                                                            65.1       3e-12 
PYIW_24288                                                            63.9       3e-12 
PYVX_19277                                                            65.1       3e-12 
PYIR_19612                                                            64.7       4e-12 
PYAR_20617                                                            64.3       4e-12 
H310_05432                                                            64.7       4e-12 
PHALS_04411                                                           64.3       4e-12 
PHYSO_488139                                                          64.3       5e-12 
PYAR_16493                                                            64.3       5e-12 
PHYRA_73581                                                           64.3       5e-12 
PYAP_22257                                                            63.9       6e-12 
PHYSO_262844                                                          63.9       8e-12 
PHYCA_132255                                                          61.2       8e-12 
PHYRA_78172                                                           64.3       9e-12 
PYIW_18794                                                            63.2       9e-12 
PHYKE_10295                                                           63.5       9e-12 
PHYRA_93650                                                           63.2       1e-11 
PHYKE_7445                                                            63.9       1e-11 
PYIR_24867                                                            63.9       1e-11 
PYIW_24289                                                            62.4       1e-11 
PPTG_06249                                                            63.5       1e-11 
PHYKE_3912                                                            63.2       1e-11 
SPRG_07825                                                            63.5       1e-11 
PYU1_G006404                                                          63.2       1e-11 
PYIR_22634                                                            63.2       1e-11 
PHYRA_84732                                                           63.2       1e-11 
HYAP_01683                                                            63.5       1e-11 
PYAP_18221                                                            62.4       1e-11 
PYIR_15187                                                            62.4       1e-11 
PHYCA_15124                                                           62.8       2e-11 
PPTG_07511                                                            61.6       2e-11 
SPRG_07826                                                            63.2       2e-11 
PHYSO_337515                                                          62.8       2e-11 
PPTG_03143                                                            63.2       2e-11 
PYVX_22510                                                            63.2       2e-11 
PYIR_16437                                                            62.4       2e-11 
PHYRA_78177                                                           62.8       2e-11 
PYIR_24421                                                            61.6       3e-11 
PHALS_05394                                                           62.4       3e-11 
SPRG_04679                                                            62.0       3e-11 
PHYCA_120062                                                          61.6       3e-11 
PHYSO_476077                                                          62.4       3e-11 
PHYSO_472009                                                          62.4       3e-11 
PYAR_15391                                                            60.8       3e-11 
PPTG_03140                                                            62.4       3e-11 
H310_05438                                                            62.4       3e-11 
PYU1_G005871                                                          62.0       3e-11 
PYU1_G006405                                                          62.4       3e-11 
SDRG_00948                                                            62.4       4e-11 
PYU1_G005872                                                          62.0       4e-11 
PYIR_26867                                                            60.1       4e-11 
SPRG_07799                                                            62.0       4e-11 
SDRG_00972                                                            62.0       4e-11 
PYIR_14463                                                            62.0       5e-11 
PPTG_18176                                                            61.2       5e-11 
PHYCA_122958                                                          61.2       6e-11 
PHYKE_2539                                                            61.2       6e-11 
PYIR_17978                                                            60.8       6e-11 
PYAR_24818                                                            60.5       7e-11 
PYU1_G001475                                                          61.2       7e-11 
PHYRA_77291                                                           60.8       7e-11 
PITG_08895                                                            60.1       8e-11 
PITG_08202                                                            60.1       8e-11 
PHYRA_78169                                                           61.2       8e-11 
PHYSO_324715                                                          60.8       8e-11 
PPTG_04617                                                            61.6       8e-11 
PHALS_10635                                                           61.2       8e-11 
PHYRA_86751                                                           59.3       1e-10 
PITG_20631                                                            60.5       1e-10 
PHYSO_318683                                                          60.8       1e-10 
PITG_20312                                                            60.5       1e-10 
PPTG_10186                                                            60.5       1e-10 
PYAP_23672                                                            60.5       1e-10 
PYIW_19601                                                            60.1       1e-10 
PPTG_10073                                                            59.3       1e-10 
PYU1_G005873                                                          59.7       2e-10 
H257_11258                                                            60.5       2e-10 
PYAR_21271                                                            59.3       2e-10 
PYU1_G001524                                                          60.1       2e-10 
PYIR_20481                                                            59.7       2e-10 
PHYSO_426658                                                          58.9       3e-10 
PHYRA_95184                                                           60.1       3e-10 
PHALS_01293                                                           59.7       3e-10 
PHYCA_562062                                                          58.9       3e-10 
PHYRA_77293                                                           59.3       3e-10 
PYIR_20483                                                            58.9       4e-10 
SDRG_16535                                                            59.3       4e-10 
PYU1_G005985                                                          58.2       4e-10 
PYVX_21174                                                            55.8       5e-10 
PYU1_G005866                                                          57.8       5e-10 
PYU1_G001514                                                          58.9       6e-10 
PHYKE_9023                                                            58.5       7e-10 
PYIW_17867                                                            58.5       7e-10 
HYAP_14170                                                            58.2       8e-10 
PHYCA_19608                                                           58.5       8e-10 
PYAP_16994                                                            58.2       8e-10 
PYIR_25999                                                            58.5       8e-10 
SPRG_07796                                                            58.5       8e-10 
PYAR_17163                                                            55.8       8e-10 
PHYCA_15126                                                           58.5       9e-10 
PHYCA_10471                                                           58.2       9e-10 
PYU1_G005867                                                          57.0       1e-09 
PYIW_18065                                                            58.2       1e-09 
PHYSO_375794                                                          55.5       1e-09 
PYU1_G001516                                                          57.8       1e-09 
PPTG_01148                                                            57.8       1e-09 
PHYCA_103479                                                          57.8       1e-09 
PHYCA_14560                                                           57.8       1e-09 
PYIR_22133                                                            58.2       1e-09 
PHYSO_488921                                                          57.8       1e-09 
PHYSO_329293                                                          57.8       2e-09 
PYIW_25463                                                            56.6       2e-09 
PPTG_04801                                                            57.0       2e-09 
PYAP_18226                                                            56.6       2e-09 
PYU1_G001518                                                          57.0       2e-09 
PITG_01966                                                            57.0       2e-09 
PYAP_16347                                                            55.8       2e-09 
PYIR_22135                                                            57.0       2e-09 
PITG_11944                                                            56.6       3e-09 
PHYRA_78167                                                           56.6       3e-09 
PHYSO_525490                                                          56.6       3e-09 
PHYKE_10296                                                           57.0       3e-09 
H257_11306                                                            56.6       4e-09 
PPTG_20376                                                            55.1       4e-09 
PHYCA_12944                                                           54.7       5e-09 
PYAR_17166                                                            53.5       5e-09 
PYAP_23673                                                            56.2       5e-09 
PHYSO_256017                                                          54.3       6e-09 
PHYSO_454780                                                          54.7       6e-09 
PHYRA_78168                                                           55.8       6e-09 
PHYCA_14559                                                           55.5       6e-09 
PYAP_14265                                                            55.8       6e-09 
PPTG_01152                                                            55.5       6e-09 
PPTG_01147                                                            55.5       7e-09 
PYIW_16208                                                            55.5       7e-09 
PHYRA_80632                                                           55.5       1e-08 
PPTG_03145                                                            55.1       1e-08 
PITG_21641                                                            55.5       1e-08 
PYVX_22511                                                            55.1       1e-08 
PHYSO_255975                                                          54.3       1e-08 
PPTG_13879                                                            55.1       1e-08 
PYAP_20077                                                            54.7       1e-08 
HYAP_01682                                                            55.1       1e-08 
PHALS_02295                                                           55.1       1e-08 
PHYRA_77290                                                           55.1       1e-08 
PYVX_16673                                                            55.1       1e-08 
PHYCA_19599                                                           54.7       2e-08 
PYIR_23689                                                            53.9       2e-08 
PHYSO_525121                                                          53.9       2e-08 
PYIW_16810                                                            53.9       2e-08 
PYIW_24287                                                            54.3       2e-08 
H257_11271                                                            54.3       2e-08 
PYIW_18790                                                            51.2       2e-08 
PHYKE_7446                                                            54.3       2e-08 
PPTG_03161                                                            54.3       3e-08 
PYVX_21643                                                            53.9       3e-08 
PHYSO_374025                                                          53.9       3e-08 
PITG_01969                                                            53.5       3e-08 
PYU1_G001519                                                          53.5       3e-08 
PYU1_G001528                                                          53.5       3e-08 
PHYCA_552912                                                          53.5       4e-08 
PHYRA_86201                                                           53.1       4e-08 
PHALS_02041                                                           53.1       5e-08 
PHYRA_78164                                                           53.1       5e-08 
PYAR_14261                                                            51.6       5e-08 
PHYSO_318693                                                          53.1       6e-08 
PPTG_22744                                                            51.6       7e-08 
PHYRA_79881                                                           52.8       7e-08 
PHYSO_489485                                                          51.2       7e-08 
PYIW_23030                                                            52.4       8e-08 
PHYKE_6069                                                            52.8       8e-08 
PHALS_02044                                                           52.0       1e-07 
PPTG_00483                                                            52.0       1e-07 
H310_05433                                                            52.4       1e-07 
PPTG_01153                                                            52.4       1e-07 
PHYRA_75781                                                           52.0       1e-07 
PYAR_17307                                                            52.0       1e-07 
PHYRA_87941                                                           50.8       1e-07 
PYIW_25573                                                            52.0       1e-07 
PYIW_14252                                                            51.6       2e-07 
PHALS_02296                                                           51.2       2e-07 
PYAR_25093                                                            50.8       2e-07 
PYAP_23455                                                            51.6       2e-07 
PHYCA_123476                                                          51.6       2e-07 
PPTG_03147                                                            51.2       2e-07 
PHYRA_86151                                                           50.1       3e-07 
PITG_11957                                                            51.2       3e-07 
PHYRA_78165                                                           51.2       3e-07 
PYAP_16338                                                            50.8       3e-07 
PYU1_G001520                                                          51.2       3e-07 
PYU1_G007250                                                          50.1       3e-07 
PYIR_20850                                                            50.4       4e-07 
PHYSO_339832                                                          50.4       4e-07 
PHYSO_257305                                                          50.1       4e-07 
PYIR_20304                                                            50.1       4e-07 
PITG_11946                                                            50.1       4e-07 
PHALS_01460                                                           50.4       5e-07 
PYU1_G005878                                                          47.4       5e-07 
PYIR_25571                                                            50.4       5e-07 
PHALS_05110                                                           49.3       7e-07 
PPTG_03148                                                            50.1       7e-07 
PYIR_25334                                                            49.7       8e-07 
PHYCA_558591                                                          47.8       8e-07 
PYVX_23997                                                            49.3       8e-07 
PPTG_06106                                                            49.7       9e-07 
PYU1_G007254                                                          48.5       1e-06 
PYAP_18584                                                            48.9       1e-06 
PITG_11942                                                            49.3       1e-06 
PHYKE_7443                                                            49.3       1e-06 
PYAR_22058                                                            48.5       1e-06 
PHYCA_559281                                                          47.4       2e-06 
PYVX_22509                                                            48.9       2e-06 
PITG_11951                                                            48.1       2e-06 
PYU1_G007242                                                          48.5       2e-06 
PYAR_24113                                                            48.1       2e-06 
PYIW_26655                                                            48.5       2e-06 
PYAP_24338                                                            48.5       2e-06 
PHYKE_6066                                                            48.1       3e-06 
PYIR_24935                                                            48.1       3e-06 
PPTG_09880                                                            47.8       3e-06 
PHYCA_19606                                                           48.1       3e-06 
PYIW_14247                                                            47.8       4e-06 
PHYCA_97699                                                           47.4       5e-06 
PHYCA_10470                                                           47.8       5e-06 
PYAR_15390                                                            46.6       6e-06 
PYU1_G001525                                                          47.4       6e-06 
PYAP_16337                                                            47.0       6e-06 
PHALS_08575                                                           47.0       9e-06 
PYIW_21963                                                            47.0       9e-06 
PITG_04404                                                            46.2       9e-06 
PYAR_23090                                                            45.4       1e-05 
PYIR_23622                                                            46.2       1e-05 
PYIR_20482                                                            45.4       1e-05 
PYU1_G003057                                                          45.8       1e-05 
PHYSO_324755                                                          46.2       1e-05 
PYVX_21644                                                            45.8       2e-05 
PYIW_15528                                                            45.8       2e-05 
PYU1_G001517                                                          45.8       2e-05 
PYAR_22574                                                            43.5       2e-05 
PYIR_22549                                                            45.4       2e-05 
PYU1_G006672                                                          42.4       2e-05 
PYU1_G005862                                                          45.1       2e-05 
PYIW_20715                                                            45.1       3e-05 
PYAP_20161                                                            45.1       3e-05 

>PHYSO_353401
Length=146

 Score = 306 bits (785),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 146/146 (100%), Positives = 146/146 (100%), Gaps = 0/146 (0%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP
Sbjct  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL
Sbjct  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120

Query  121  GIKYVEGAYSWQVYKNCVALSKTATA  146
            GIKYVEGAYSWQVYKNCVALSKTATA
Sbjct  121  GIKYVEGAYSWQVYKNCVALSKTATA  146

>PHYRA_81105
Length=201

 Score = 277 bits (708),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            MALAYLQEQGVNTSIEAQ WMQ+HGYASLR+MLDDESLY+VTEEA+FDCGLTSPKTETQ 
Sbjct  56   MALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQL  115

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IP+NSSFQ+SGYTLDGPCEVWLDDTK AAGRNCHT+FPHGQH+IDYSACG +C L WYWL
Sbjct  116  IPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWL  175

Query  121  GIKYVEGAYSWQVYKNCVALSKTATA  146
            GIKYVEGAYSWQVYKNC+AL K ATA
Sbjct  176  GIKYVEGAYSWQVYKNCIALGKEATA  201

>PPTG_17123
Length=201

 Score = 276 bits (707),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            MALAYLQEQGVNTSIEAQSWMQ+HGY SLRAMLDDESLYKVTEEA+F+CGLTSP+TETQP
Sbjct  56   MALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  115

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IP+N+SFQTSGYTLDGPCEVWLDDTKV++GRNCHT+FPHGQHE+DYS+CG +CTL WYWL
Sbjct  116  IPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWL  175

Query  121  GIKYVEGAYSWQVYKNCVALSKTATA  146
            GIKY+EG YSWQVYKNCV LS   TA
Sbjct  176  GIKYIEGIYSWQVYKNCVGLSTAPTA  201

>PHYCA_537323
Length=200

 Score = 274 bits (701),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            MALAYLQEQGVNTSIEAQSWM++HGY SLRAMLDDESLY+VTEEA+F+CGLTSPKTETQP
Sbjct  55   MALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQP  114

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IP+N+SFQTSGYTLDGPCEVWLDDTKV+AGRNCHT+FP GQH++DYS+CG+SCTL WYWL
Sbjct  115  IPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWL  174

Query  121  GIKYVEGAYSWQVYKNCVALSKTATA  146
            GIKYVEG YSWQVYKNCV L   ATA
Sbjct  175  GIKYVEGIYSWQVYKNCVGLGTAATA  200

>PITG_18452
Length=856

 Score = 279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            MALAYLQEQG+NTSIEAQSWMQ+ GY+SLRAMLDDESLYKVTEEA+F+CGLTSP+TETQP
Sbjct  711  MALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTEEAIFECGLTSPRTETQP  770

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IP+N+SFQTSGYTLDGPCE+WLDDTKVA+GRNCHT+FPHGQH++DYS+CG SC L WYWL
Sbjct  771  IPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWL  830

Query  121  GIKYVEGAYSWQVYKNCVALSKTATA  146
            GIKYVEG YSWQVYKNCV LSK  TA
Sbjct  831  GIKYVEGIYSWQVYKNCVGLSKNPTA  856

>HYAP_07096
Length=251

 Score = 237 bits (605),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 127/146 (87%), Gaps = 1/146 (1%)

Query  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTET-QP  60
            ALAYLQEQG++TSIEAQSW QEHGY SLRAMLDD+SLY V+++A+FDCG TS  +ET Q 
Sbjct  106  ALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQD  165

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IP+N + ++SGYTLDGPCEVW DDT+V +GRNC T+FPHGQH++DYS+CGDSCTL WYWL
Sbjct  166  IPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWL  225

Query  121  GIKYVEGAYSWQVYKNCVALSKTATA  146
            GI+Y++G YSWQVYKNC+ L +  TA
Sbjct  226  GIQYMDGIYSWQVYKNCIGLGRNVTA  251

>PYVX_18173
Length=500

 Score = 222 bits (565),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            +AYL++QGV+T+IEAQ+W+ E GYA+LRA++DD+ LY VTEE LFDCGLT P TETQPIP
Sbjct  59   VAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP  118

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +N SF TSGYTLDGPCE+W+D+T   AGRNCHT+FP G H IDYS CG+SC + W+WLGI
Sbjct  119  TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGI  178

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            KY    YSWQV+KNC+ LS +A
Sbjct  179  KYQGERYSWQVFKNCINLSASA  200

 Score = 153 bits (386),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V   A F CG T P    QPIP
Sbjct  257  LAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             +   +++GYT DGPCEVWLDDT+V    NCH       +++DYSAC  SCTL+WYWLG+
Sbjct  317  -DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGV  375

Query  123  KYVEGAYSWQVYKNCVALS  141
            +Y++  YSWQVYK CV +S
Sbjct  376  RYLKQVYSWQVYKACVPIS  394

>PYU1_G001739
Length=266

 Score = 191 bits (484),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 109/144 (76%), Gaps = 0/144 (0%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QGVNTS +   +M++ GYA+LRA++DDE LY+V  +ALF+CG T P  E+QPIP
Sbjct  46   LAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +  + +++GYT DGPCEVWLDD KV +G NCH +FP     +DYS+C  SCTL WYWLG+
Sbjct  106  TTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGV  165

Query  123  KYVEGAYSWQVYKNCVALSKTATA  146
            +Y++  YSWQ+YK CV+LS  A+ 
Sbjct  166  RYLKKRYSWQIYKECVSLSDNASG  189

>PYU1_G001738
Length=226

 Score = 172 bits (437),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 101/138 (73%), Gaps = 0/138 (0%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            +A+L+EQG+ TS +   +M++ GYA+LRAMLDD+ LY V  +AL +CG T P  E+QPIP
Sbjct  44   VAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP  103

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++F ++GY L+GPCEVWLDD KV +  NCHT++P     +DYS+C  SC L WYWLGI
Sbjct  104  VTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGI  163

Query  123  KYVEGAYSWQVYKNCVAL  140
            + V   YSWQVYK CV+L
Sbjct  164  QPVNETYSWQVYKVCVSL  181

>PYU1_G001740
Length=206

 Score = 167 bits (424),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 2/140 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV   A F+CG T+     QPIP
Sbjct  50   LAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP  109

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +N  F+T+GYT DGPCEVWLD+TKV +G NCH  FP   H + Y+AC  SCTL WYW+GI
Sbjct  110  AN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGI  167

Query  123  KYVEGAYSWQVYKNCVALSK  142
            ++++G +SWQVYK CV L +
Sbjct  168  RFLKGKHSWQVYKECVPLGR  187

>PYIR_25089
Length=262

 Score = 169 bits (427),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 0/139 (0%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T+ +  ++ +  GY +LRA +DD+S YKV + A F+CG T      QPIP
Sbjct  50   LAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYKVADGADFECGWTKLAGTPQPIP  109

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            S S+ +++GYT DGPCEVWLD T+V  G NCH++FP    +IDYS+C  SC L WYW+GI
Sbjct  110  SASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPGTTFKIDYSSCKGSCVLRWYWMGI  169

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++G YSWQVYKNCV ++
Sbjct  170  RFLKGQYSWQVYKNCVPVT  188

>PPTG_10635
Length=199

 Score = 166 bits (419),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 1/144 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  + +SW  E+GY SLR  +D  + Y+VT  A F CG T PK   QPIP
Sbjct  33   LAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEVTSGADFSCGFTDPKGTPQPIP  91

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  SCTL WYWLG+
Sbjct  92   AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGSCTLRWYWLGV  151

Query  123  KYVEGAYSWQVYKNCVALSKTATA  146
            ++++ +YSWQVYK C+ L+  A A
Sbjct  152  RFLKNSYSWQVYKACIPLTGGAGA  175

>PYIW_18788
Length=244

 Score = 164 bits (415),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 101/146 (69%), Gaps = 1/146 (1%)

Query  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
            ++A L++Q V TS +   ++++ GYASLRAMLDDE+LY V  +++F+CG T P  E+QPI
Sbjct  48   SVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPI  107

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
            P+N   + +GY  DGPCE+W+DD K+ +  NC   FP    ++DYS+C   CTL WY L 
Sbjct  108  PTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALS  167

Query  122  I-KYVEGAYSWQVYKNCVALSKTATA  146
            + K   G+YSW+VYKNCVALS   TA
Sbjct  168  VSKTTGGSYSWEVYKNCVALSDEPTA  193

>PHYCA_14369
Length=248

 Score = 164 bits (415),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 98/144 (68%), Gaps = 1/144 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W  E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  50   LAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTVTNGADFSCGFTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG+
Sbjct  109  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALSKTATA  146
            ++++ AYSWQVYK C+ L+ +  A
Sbjct  169  RFLKNAYSWQVYKACIPLAGSGGA  192

>PPTG_10634
Length=208

 Score = 162 bits (409),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ +G  T  +  +W +E+GY SLR  LD+   Y VT+ A F CG T PK   QPIP
Sbjct  50   LAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPVTDGADFKCGFTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL+WYWLG+
Sbjct  109  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLYWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVAL  140
            ++++  YSWQVYK C+ L
Sbjct  169  RFLKNDYSWQVYKACIPL  186

>PHYSO_341599
Length=185

 Score = 160 bits (405),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 1/144 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W +E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  33   LAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPIP  91

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              +  +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG+
Sbjct  92   EGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGV  151

Query  123  KYVEGAYSWQVYKNCVALSKTATA  146
            ++++  YSWQVYK C+ L+  + A
Sbjct  152  RFLKNDYSWQVYKACIPLTSGSMA  175

>PYU1_G001742
Length=213

 Score = 161 bits (407),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T+++  ++ +  GY +LRA +DD   YKV   A F CG T    + QPIP
Sbjct  50   LAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKVAAGADFQCGWTKLDGKRQPIP  109

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +  + +++GYT DGPCEVWLD T+V  G NCH++FP    +IDYS+C  SCTL WYW+GI
Sbjct  110  A-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTTFKIDYSSCKGSCTLRWYWMGI  168

Query  123  KYVEGAYSWQVYKNCVAL  140
            ++++G YSWQVYKNCV +
Sbjct  169  RFLKGKYSWQVYKNCVPI  186

>PPTG_10636
Length=246

 Score = 162 bits (410),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 98/144 (68%), Gaps = 1/144 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  SW  E+ Y SLR  +D+ + Y+VT  A F CG T PK   QPIP
Sbjct  50   LAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEVTSGADFSCGFTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLGI
Sbjct  109  AGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYTVDYSSCKGTCTLRWYWLGI  168

Query  123  KYVEGAYSWQVYKNCVALSKTATA  146
            ++++  YSWQVYK C+ LS +  A
Sbjct  169  RFLKNQYSWQVYKACIPLSGSGEA  192

>PYU1_G001744
Length=213

 Score = 160 bits (406),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 97/138 (70%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV   A F CG T    + QPIP
Sbjct  50   LAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKVAAGADFQCGWTKLDGKRQPIP  109

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +  + +++GYT DGPCEVWLD+T V  G NCH++FP   H+I Y++C  SCTL WYW+GI
Sbjct  110  A-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTTHKISYASCKGSCTLRWYWMGI  168

Query  123  KYVEGAYSWQVYKNCVAL  140
            ++++G YSWQVYKNCV +
Sbjct  169  RFLKGKYSWQVYKNCVPI  186

>PHYCA_102852
Length=195

 Score = 159 bits (402),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 96/139 (69%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ +G  T  +  +W  E+GY SLR  +D  + Y VTE A F CG T P    QPIP
Sbjct  50   LAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPVTEGADFKCGFTDPNGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + IDYS+C  +CTL+W+WLG+
Sbjct  109  AGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKGYTIDYSSCKGTCTLYWFWLGV  168

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++  YSWQVYK C+ L+
Sbjct  169  RFLKNDYSWQVYKACIPLT  187

>PHYRA_85631
Length=228

 Score = 160 bits (405),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 96/139 (69%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ +G  T  +  SW  E+GY SLR  +D+ + Y V + A F CG T PK   QPIP
Sbjct  50   LAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNVADGADFSCGFTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLGI
Sbjct  109  AGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGI  168

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++  YSWQVYK C+ L+
Sbjct  169  RFLKNDYSWQVYKECIPLT  187

>PHYSO_536424
Length=197

 Score = 159 bits (401),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 1/145 (1%)

Query  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
             LA+L+ +G  T  +  +W +E+GY SLR  +D  + Y VT  A F CG T PK   QPI
Sbjct  44   PLAFLENEGFTTQEDFTAWRKENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPI  102

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
            P  +  +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG
Sbjct  103  PEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLG  162

Query  122  IKYVEGAYSWQVYKNCVALSKTATA  146
            +++++  YSWQVYK C+ L+  + A
Sbjct  163  VRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYSO_507031
Length=197

 Score = 159 bits (401),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 96/145 (66%), Gaps = 1/145 (1%)

Query  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
             LA+L+ +G  T  +  +W +E+GY SLR  +D  + Y VT  A F CG T PK   QPI
Sbjct  44   PLAFLENEGFTTQEDFTAWRKENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPI  102

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
            P  +  +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYWLG
Sbjct  103  PEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLG  162

Query  122  IKYVEGAYSWQVYKNCVALSKTATA  146
            +++++  YSWQVYK C+ L+  + A
Sbjct  163  VRFLKNDYSWQVYKACIPLTSGSMA  187

>PHYRA_84190
Length=206

 Score = 159 bits (401),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 97/139 (70%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ +G  T  +  +W  E+GY SLR  +D+ + Y VT  A F CG T PK   QPIP
Sbjct  33   LAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSVTNGADFSCGFTDPKGTPQPIP  91

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            ++++ +++GYT DGPCEVWLDDT V  G NCH +FP   + +DYS+C  +CTL WYW+G+
Sbjct  92   ADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYTVDYSSCKGTCTLRWYWMGV  151

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++  YSWQVYK C+ L+
Sbjct  152  RFLKETYSWQVYKECIPLT  170

>PHYCA_102624
Length=195

 Score = 157 bits (397),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 93/139 (67%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L +L+  G  T  +  +W +E+GY SLR  +D+   Y V+E A F CG T P    QPIP
Sbjct  50   LTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPVSEGADFKCGFTDPNGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVW+DDT V  G NCH +FP   + IDYS C   CTL+WYWLG+
Sbjct  109  AGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKDYTIDYSPCKGKCTLYWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++  YSWQVYK C+ L+
Sbjct  169  RFLKNRYSWQVYKECIPLT  187

>PHYCA_102550
Length=268

 Score = 158 bits (400),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 1/144 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W  E+GY SLR  +D  + Y V   A F CG T P    QPIP
Sbjct  50   LAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTVRNGADFKCGYTDPNGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ +++GYT DGPCEVW+DDT V  G NCH +FP   + IDYS C   CTL+WYWLG+
Sbjct  109  AGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKGYTIDYSPCKGKCTLYWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALSKTATA  146
            ++++ +YSWQVYK C+ L+ +  A
Sbjct  169  RFLKNSYSWQVYKECIPLAGSGGA  192

>PYU1_G001741
Length=199

 Score = 156 bits (394),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T+ +  ++ +  GY +LRA +DD+  Y V   A F+CG T      Q IP
Sbjct  49   LAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTVASGADFECGWTKLDGTRQSIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + +  +++GYT DGPCEVWLD T+V  G NCHT+F    H IDYS+C  SCTL WYW+GI
Sbjct  109  AGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTTHTIDYSSCKGSCTLRWYWMGI  167

Query  123  KYVEGAYSWQVYKNCVAL  140
            ++++G YSWQVYKNCV +
Sbjct  168  RFLKGEYSWQVYKNCVPI  185

>PHYKE_8388
Length=205

 Score = 155 bits (392),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 97/142 (68%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG +T  +  +W  ++GYASLRA  DD S Y V++ A F CG T      QPIP
Sbjct  50   LAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTVSDGADFTCGFTDINGAAQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             +++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+W+G+
Sbjct  109  DDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKDYTIDYSSCTSTCTLYWFWMGV  168

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y++  YSWQVYK CV LS +A
Sbjct  169  RYLKNEYSWQVYKACVPLSASA  190

>PPTG_10643
Length=250

 Score = 156 bits (395),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 94/138 (68%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG     +  +W +E+GY SLR  +D  + Y+VT  A F CG T+PK   QPIP
Sbjct  50   LAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEVTPGADFSCGFTNPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +    +++GYT DGPCEV+LDDT V  G NCH +FP     IDYS+C  +CTL WYWLGI
Sbjct  109  AQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKDCPIDYSSCKGTCTLRWYWLGI  168

Query  123  KYVEGAYSWQVYKNCVAL  140
            ++++ AYSWQVYK C+ L
Sbjct  169  RFLKNAYSWQVYKECIPL  186

>PHALS_00498
Length=199

 Score = 153 bits (387),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 100/142 (70%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ Q   T+ +AQ++ +++ + +LR  +D+   Y V + A   CG T P    QPIP
Sbjct  50   LAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAK-YTVVKGADPACGFTDPNGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +N++ +++GYT DGPCEVWL++T+V +  NCH +FP   + IDYS+C D+C L WYWLG+
Sbjct  109  ANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGKDYTIDYSSCKDNCLLRWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            ++++  YSWQVYK C+ LS++A
Sbjct  169  RFLKEKYSWQVYKACIPLSRSA  190

>PYIW_18791
Length=194

 Score = 151 bits (382),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 98/145 (68%), Gaps = 2/145 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEA-LFDCGLTSPKTETQPI  61
            L++L++ GV TS     +M++ GY++LRA++DD  LYK    A  F CG T P   +Q I
Sbjct  44   LSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYKTNSNADNFLCGYTDPSKGSQVI  103

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
            P +S+ +T+GYT  GPCEVW+DD +V AG NCH Q  +   ++DYS C   CT+ WYWLG
Sbjct  104  PKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSN-TTKVDYSNCKGECTMRWYWLG  162

Query  122  IKYVEGAYSWQVYKNCVALSKTATA  146
            ++Y++  +SWQVYKNC+AL+    A
Sbjct  163  LRYLKKKWSWQVYKNCIALTGDGAA  187

>PHYRA_81107
Length=202

 Score = 151 bits (382),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 96/142 (68%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG +T  +  +W +E+GY SLRA  DD + Y V++ A F CG T    + Q IP
Sbjct  47   LAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTVSDGADFTCGFTDINGDVQAIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+W+G+
Sbjct  106  DGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKDYTIDYSSCTSTCTLYWFWMGV  165

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y+  AYSWQVYK CV LS +A
Sbjct  166  RYLNNAYSWQVYKACVPLSASA  187

>PHYRA_82864
Length=193

 Score = 151 bits (381),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 98/139 (71%), Gaps = 2/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W +++GY +LR  +D  + Y VTE A + CG T P    QPIP
Sbjct  50   LAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTDPNGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +  + +++GYT DGPCEVWLD+T+V  G NCH QFP   + IDYS+C  +CTL WYW+G+
Sbjct  109  A-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKDYPIDYSSCKGTCTLHWYWIGV  167

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++ +YSWQVYK C++L+
Sbjct  168  RFLKNSYSWQVYKECISLT  186

>PHYSO_477820
Length=202

 Score = 151 bits (382),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 95/142 (67%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG  T  +  +W  ++GY SLRA  D  S Y V + A F CG T+   E QPIP
Sbjct  47   LAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS-YTVADGADFTCGFTNTNGEVQPIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             +++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+WLG+
Sbjct  106  DDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGKDYTIDYSSCTSTCTLYWFWLGV  165

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y++  YSWQ+YK CV LS +A
Sbjct  166  RYLKNEYSWQIYKACVPLSTSA  187

>PYIR_26626
Length=212

 Score = 149 bits (375),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 96/139 (69%), Gaps = 2/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61
            LA+L+ QG  T+ +   +++  GY +LRA +DD+  YKV    A F+CG T+   + QPI
Sbjct  50   LAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPI  109

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121
            P+  + +++GYT DGPCEVWLD+TKV +G NC+  FP   H I Y++C  SCTL WYW+G
Sbjct  110  PA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMG  168

Query  122  IKYVEGAYSWQVYKNCVAL  140
            +++++  +SWQVYK CV +
Sbjct  169  LRFLKNKWSWQVYKECVPI  187

>PHYCA_511409
Length=204

 Score = 148 bits (373),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (68%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG  T  +  +W Q++GY SLRA  +D + Y V++ A F CG T+   + Q IP
Sbjct  49   LAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTVSDGADFTCGFTNKNGDVQAIP  107

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+WLG+
Sbjct  108  DANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKDYTIDYSSCTSTCTLYWFWLGV  167

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y++  YSWQ+YK CV LS +A
Sbjct  168  RYLKNEYSWQIYKACVPLSASA  189

>PHYKE_8390
Length=130

 Score = 145 bits (366),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            MALAYLQEQGVNTSIE Q WM  HGY SLRAMLDDE+LYKVTEEALFDCGLTSPKTETQ 
Sbjct  50   MALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQL  109

Query  61   IPSNSSFQTSGYTLDGPC  78
            IP+NS+FQTSGYT+DGPC
Sbjct  110  IPTNSTFQTSGYTMDGPC  127

>PPTG_15264
Length=194

 Score = 147 bits (371),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 94/143 (66%), Gaps = 3/143 (2%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W +++GY +LR  +D  + Y VTE A + CG T PK   QPIP
Sbjct  47   LAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTDPKGTPQPIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYWL  120
            +  + +++GYT DGPCEVWLDD +V  G NCH   P   + IDYS+C     C L WYWL
Sbjct  106  AGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWL  165

Query  121  GIKYVEGAYSWQVYKNCVALSKT  143
            G+++++ +YSWQVYK C+ L+ T
Sbjct  166  GVRFLKNSYSWQVYKECIPLTTT  188

>PPTG_17366
Length=194

 Score = 147 bits (371),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 94/143 (66%), Gaps = 3/143 (2%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W +++GY +LR  +D  + Y VTE A + CG T PK   QPIP
Sbjct  47   LAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTVTEGADYFCGWTDPKGTPQPIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYWL  120
            +  + +++GYT DGPCEVWLDD +V  G NCH   P   + IDYS+C     C L WYWL
Sbjct  106  AGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWL  165

Query  121  GIKYVEGAYSWQVYKNCVALSKT  143
            G+++++ +YSWQVYK C+ L+ T
Sbjct  166  GVRFLKNSYSWQVYKECIPLTTT  188

>PHYKE_3446
Length=199

 Score = 147 bits (371),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 94/139 (68%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +A +W +++GY +LRA +D  + Y+VTE A + CG T P    QPIP
Sbjct  50   LAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQVTEGADYFCGWTDPNGTAQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
               + +++GYT DGPCEVW+D+T+V    NCH       + IDYSAC  +C L WYWLG+
Sbjct  109  EGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++ +YSWQVYK C+ L+
Sbjct  169  RFLKNSYSWQVYKACIPLT  187

>PPTG_10048
Length=190

 Score = 147 bits (370),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 96/143 (67%), Gaps = 1/143 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  + +SW  ++GY +LR  ++  + Y VTE A F CG T+PK   QPIP
Sbjct  47   LAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTVTEGADFSCGWTNPKGTPQPIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            +    +++GYT +GPCE+W+ DT+V    NCH   P  ++ IDYS C  +C L+WYWLG+
Sbjct  106  AGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKEYPIDYSPCKGNCVLYWYWLGV  165

Query  123  KYVEGAYSWQVYKNCVALSKTAT  145
            ++++ +YSWQVYK C+ L+  +T
Sbjct  166  RFLKNSYSWQVYKECIPLTTNST  188

>PPTG_17121
Length=202

 Score = 147 bits (371),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 95/142 (67%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG  T  +  +W +++GY SLRA  D  S Y V++ A   CG T+   + QPIP
Sbjct  47   LAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-YTVSDGADLTCGFTNINGDVQPIP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++ +++GYT DGPCEVWLDDT V    NCH       + IDYS+C  +CTL+W+WLG+
Sbjct  106  DGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKYYTIDYSSCTSTCTLYWFWLGV  165

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y++  YSWQ+YK CV LS +A
Sbjct  166  RYLKNEYSWQIYKACVPLSTSA  187

>PHALS_03284
Length=188

 Score = 145 bits (367),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ Q   TS +   +++++ Y SLR  L   + Y VTE A  DCG T P    QPIP
Sbjct  36   LAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANYTVTEGADRDCGFTDPNGTPQPIP  94

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            + ++ + +GYT DG CE+WLDDTKV +G NCH  FP     +DYS+C D+C ++WYWL +
Sbjct  95   AGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKDCPVDYSSCKDNCVMYWYWLAV  154

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            + ++  YSWQVYK C+ L+++ 
Sbjct  155  RLLKNEYSWQVYKACIPLTRSG  176

>PHYKE_7718
Length=220

 Score = 147 bits (370),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 90/139 (65%), Gaps = 1/139 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ +G     +  +W  E+GY SLR  +D+ + Y VT  A   CG T P    QPIP
Sbjct  54   LAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSVTSGADSACGFTDPNGTPQPIP  112

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++ +++GYT DGPCEVW+DDT      NCH  FP   + IDYSAC  +CTL WYWLG+
Sbjct  113  EGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKDYTIDYSACKGTCTLRWYWLGV  172

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++ +YSWQVYK C+ L+
Sbjct  173  RFLKNSYSWQVYKACIPLT  191

>PHYKE_8389
Length=204

 Score = 145 bits (365),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W + +GY +LRA +D    Y VT+ A + CG T+     Q IP
Sbjct  49   LAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIP  107

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            S ++ +++GYT DGPCEVWLD T+V    NCH       + IDYS+C  +CTL WYWLG+
Sbjct  108  SGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGV  167

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            ++++  YSWQVYK CV LS +A
Sbjct  168  RFLKNEYSWQVYKACVPLSASA  189

>PHYCA_129425
Length=204

 Score = 144 bits (363),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 92/142 (65%), Gaps = 2/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +   W + +GY +LRA +D    Y VT+ A + CG T+ K   QPIP
Sbjct  50   LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTVTDGADYYCGFTNAKAAPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +++GYT DGPCEVWLD T+V    NCH  FP   + +DYS+C  SC L WYWLG 
Sbjct  109  -DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGT  167

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            ++++  +SWQVYK C+ LS +A
Sbjct  168  RFLKNEHSWQVYKACIPLSSSA  189

>PHYSO_284086
Length=204

 Score = 144 bits (363),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 94/142 (66%), Gaps = 2/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W ++ GY +LRA +D  S Y V + A + CG T  K   QPIP
Sbjct  50   LAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTVADGADYYCGFTDIKGVAQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +++GYT DGPCEVWLD T+V    NCH  F    +++DYS+C  SCTL WYWLG+
Sbjct  109  -DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGV  167

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            ++++  YSWQVYK CV LS +A
Sbjct  168  RFLKNEYSWQVYKACVPLSTSA  189

>PYAR_24096
Length=227

 Score = 143 bits (361),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 2/140 (1%)

Query  4    AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63
            A L++QG  T+ +  ++++ + Y +LR  +D    YK    A F+CG T PK   QPIP 
Sbjct  50   AKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  109

Query  64   NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLG  121
            + +F+TSGYT +GPCE+W+DD +V  G NCH          +IDYSAC  +C L WYWLG
Sbjct  110  DGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  169

Query  122  IKYVEGAYSWQVYKNCVALS  141
            I+    +YSWQ+YK C+ LS
Sbjct  170  IRPTGKSYSWQIYKACIPLS  189

>PYVX_18174
Length=204

 Score = 142 bits (357),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 4/143 (3%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG  T  +  +W + +GY +LRA +D  S Y VT+ A   CG T      QPIP
Sbjct  50   LAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTVTDGADQTCGFTEIDGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGD-SCTLWWYWLG  121
            +N  F+++GYT DGPCE+WLD T+V A  NCH         IDYS     +CTL+WYW+G
Sbjct  109  AN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKDTAIDYSXXXXGTCTLYWYWMG  166

Query  122  IKYVEGAYSWQVYKNCVALSKTA  144
            ++Y+  AYSWQVYKNCV LS +A
Sbjct  167  VRYLNNAYSWQVYKNCVPLSTSA  189

>PHYRA_81106
Length=202

 Score = 142 bits (357),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 1/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W + +GY +LRA +D    Y V + A + CG T+     Q IP
Sbjct  50   LAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTVADGADYYCGFTNADATPQAIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              ++ +++GYT DGPCEVWLD T+V    NCH       + IDYS+C  +CTL WYW+G+
Sbjct  109  DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGV  168

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y++ AYSWQVYK CV LS +A
Sbjct  169  RYLKNAYSWQVYKACVPLSASA  190

>PYAP_22273
Length=268

 Score = 143 bits (360),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 2/140 (1%)

Query  4    AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63
            A L+ QG  T+ +  +++  +GY +LR  +D    YK  + A  +CG T P    QPIP+
Sbjct  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108

Query  64   NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ--HEIDYSACGDSCTLWWYWLG  121
            N  F+TSGYT +GPCE+W+DD  V +G+NCH          +IDYSAC   C L WYWLG
Sbjct  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168

Query  122  IKYVEGAYSWQVYKNCVALS  141
            I+ +   YSWQ+YK C+ L+
Sbjct  169  IRPMGKKYSWQIYKACIPLA  188

>PPTG_17122
Length=204

 Score = 138 bits (348),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 91/142 (64%), Gaps = 2/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +   W + +GY +LR  +D  + Y VT+ A + CG T+     QPIP
Sbjct  50   LAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTVTDGADYYCGFTNVNAAPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +++GYT DGPCEVWLD  +V    NCH       + +DYS+C  +CTL WYWLG+
Sbjct  109  -DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGV  167

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y++ AYSWQ+YK C+ LS +A
Sbjct  168  RYLKNAYSWQIYKACIPLSASA  189

>PHYCA_510817
Length=188

 Score = 136 bits (343),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 91/140 (65%), Gaps = 1/140 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L++L+++G  T      +  ++GY SLR  ++ ++ YKV++ A   CG + PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            S+ + +TSGYT DGPCE+W+ D    +  NCH   P    ++DYS CGDSC L+WYWLG+
Sbjct  109  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALSK  142
            + ++G YSWQVYK C+ L K
Sbjct  169  RKLKGKYSWQVYKECIPLYK  188

>PYVX_18176
Length=201

 Score = 135 bits (341),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 93/142 (65%), Gaps = 2/142 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L++QG +T  +  +W  ++GY SLRA +D  S Y VT+ A   CG T+     Q +P
Sbjct  47   LAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTVTDGADQTCGWTNKDGTAQALP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             +   +++GYT  GPCEVWLDDT V    NCH       +++DYS+C  +CTL+W+W+G+
Sbjct  106  -DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKTYDLDYSSCTSTCTLYWFWMGV  164

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            +Y+   YSWQVYKNCV LS +A
Sbjct  165  RYLNNEYSWQVYKNCVPLSASA  186

>PPTG_14254
Length=188

 Score = 134 bits (338),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 89/140 (64%), Gaps = 1/140 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L++L+++G  T      +  ++GY SLR  +D  + YKVTE A   CG T PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +T+GYT DGPCE+++ +    +  NCH   P    ++DYS CGDSC L+WYWLG+
Sbjct  109  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  123  KYVEGAYSWQVYKNCVALSK  142
            + ++G YSWQVYK C+ + K
Sbjct  169  RKLKGKYSWQVYKECIPIYK  188

>PPTG_14255
Length=268

 Score = 134 bits (338),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L++L+++G  T      +  ++GY SLR  +D+ + Y VT+ A   CG T PK   Q IP
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  107

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +TSGYT DGPCE+++ DT   +  NCH        ++DYSACGDSC L+WYWLG+
Sbjct  108  EDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV  167

Query  123  KYVEGAYSWQVYKNCVAL  140
            +Y++  YSWQVYK C+ L
Sbjct  168  RYLKKKYSWQVYKECIPL  185

>PYIR_26546
Length=239

 Score = 133 bits (335),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 89/141 (63%), Gaps = 3/141 (2%)

Query  3    LAYLQEQ-GVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61
            +AYL+ Q G + + +   ++   G+ ++R  +D++ LY+   +A F CG T    E QPI
Sbjct  50   MAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYRPVSDADFKCGYTKLDGEPQPI  109

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYW  119
            P N   +T+GYT +GPCE+WLDD KV  G+NCH     G +  ++D+S+C   CT++WYW
Sbjct  110  PKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVASGMNFQKLDFSSCVGKCTMYWYW  169

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            +GI+    + SWQ+YK C+ L
Sbjct  170  MGIRGSGKSVSWQIYKECIPL  190

>PHYKE_9185
Length=281

 Score = 134 bits (336),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 91/138 (66%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L++L+++G+ T      +  ++ YASLR  +D ++ YKV++ A   CG T PK   Q IP
Sbjct  52   LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  110

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +TSGYT DGPCE+++ D    +  NCH        ++DYSACGDSC L+WYWLG+
Sbjct  111  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGV  170

Query  123  KYVEGAYSWQVYKNCVAL  140
            + ++G+YSWQ+YK C+ L
Sbjct  171  RKLKGSYSWQIYKECIPL  188

>PYAP_22279
Length=223

 Score = 131 bits (329),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 91/147 (62%), Gaps = 5/147 (3%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61
            LA+L+ QGV  + +   ++++ G  +LR  +D+++ YKV    A F+CG T P    QPI
Sbjct  43   LAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKVEAAGATFECGYTDPNGARQPI  102

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKV--AAGRNCHTQFPHGQ--HEIDYSACGDSCTLWW  117
            PSN   +++GYT DGPCEVWLD+T+V  +   +CH     G   ++ID+S C  +C L W
Sbjct  103  PSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIGQGMISYKIDFSKCKGNCMLRW  162

Query  118  YWLGIKYVEGAYSWQVYKNCVALSKTA  144
            YWL  + +   +SWQVYK CV L  +A
Sbjct  163  YWLAKRKIGSKWSWQVYKQCVPLKGSA  189

>PITG_18450
Length=203

 Score = 129 bits (323),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 88/142 (62%), Gaps = 5/142 (4%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L +L+ QG  T  +   W + +GY +LR  ++    Y V + A + CG T+     QP P
Sbjct  50   LTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAPQPNP  105

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +++GYT DGPCEVWLD T+V    NCH       + +DYS+C  +CTL WYWLG+
Sbjct  106  -DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGV  164

Query  123  KYVEGAYSWQVYKNCVALSKTA  144
            ++++ AYSWQ+YK C+ LS +A
Sbjct  165  RFLKNAYSWQIYKACIPLSASA  186

>PHYSO_417649
Length=185

 Score = 127 bits (320),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 87/138 (63%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L++L+++G  T      +  ++GY SLR  ++  + YK+T+ A   CG T PK   Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +TSGYT DGPCE+++ D    +  NCH        ++DYS CGDSC L+WYWLG+
Sbjct  107  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  166

Query  123  KYVEGAYSWQVYKNCVAL  140
            + ++G +SWQVYK C+ L
Sbjct  167  RKLKGKFSWQVYKECIPL  184

>PYAP_22278
Length=289

 Score = 127 bits (318),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 91/150 (61%), Gaps = 6/150 (4%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61
            LA+L+ QGV    +   +++  G  +LR  +D+++ YK+    A F+CG T+P    QPI
Sbjct  47   LAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKIEARGASFECGYTNPNGARQPI  106

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAG--RNCHTQFPHG--QHEIDYSACGDSCTLWW  117
            P N   +++GYT DGPCEVWLD+T+V      NCH    +    ++ID+S C  +C L W
Sbjct  107  PKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVGNKAVSYKIDFSKCKGNCMLRW  166

Query  118  YWLGIKYVEG-AYSWQVYKNCVALSKTATA  146
            YWLG + + G  +SWQ+YK CV L  + TA
Sbjct  167  YWLGKRLIGGKKWSWQIYKACVPLKGSGTA  196

>PPTG_08820
Length=250

 Score = 124 bits (310),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 84/142 (59%), Gaps = 3/142 (2%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLY-KVTEEALFDCGLTSPKTETQPI  61
            LA+L+ QG     +   W  + GY +LR  +D       VT  A   CGLT  K   +PI
Sbjct  52   LAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYTTSVTPGADQTCGLTELKGPPRPI  111

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDS--CTLWWYW  119
            P +   +++GYT DGPC V+LDD  V    NCH + P   ++IDYS+C     CTL+W+W
Sbjct  112  PKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLPGKSYKIDYSSCEKKGGCTLYWFW  171

Query  120  LGIKYVEGAYSWQVYKNCVALS  141
            LGI++V+  +SWQVYK CV L+
Sbjct  172  LGIRFVKSRWSWQVYKECVPLT  193

>PHYSO_343376
Length=172

 Score = 121 bits (303),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%), Gaps = 1/117 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  + ++W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  48   LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  106

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
               + +++GYT DGPCEVW+D+T+V  G NCH +     + IDYSAC  +CTL WYW
Sbjct  107  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PHYSO_262732
Length=188

 Score = 121 bits (303),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 15/138 (11%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T               LR  +D+   Y VTE A   CG T PK   Q IP
Sbjct  49   LAFLENQGFQTH--------------LRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIP  93

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
            S+ + +TSGYT DGPCE+++ D    +  NCH        ++DYS CGDSCTL+WYWLG+
Sbjct  94   SDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGV  153

Query  123  KYVEGAYSWQVYKNCVAL  140
            +++   YSWQVYK C+ +
Sbjct  154  RFLNNKYSWQVYKECIPI  171

>PHYCA_536934
Length=983

 Score = 129 bits (323),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 1/138 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            L++L+++G  T      +  ++GY +LR  +D+   Y VT+ A   CG + P    Q IP
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIP  124

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +TSGYT DGPCE+W+ D    +  NCH        ++DYS CGDSC L+WYWLG+
Sbjct  125  EDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  184

Query  123  KYVEGAYSWQVYKNCVAL  140
            +Y++  YSWQVYK C+ L
Sbjct  185  RYLKKKYSWQVYKECIPL  202

>PHYSO_499978
Length=174

 Score = 119 bits (299),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 1/117 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  + + W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  50   LAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
               + +++GYT DGPCEVW+D+T+V  G NCH +     + IDYSAC  +CTL WYW
Sbjct  109  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 119 bits (299),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 74/117 (63%), Gaps = 1/117 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  + + W  ++GY +LR  +D    Y VT+ A F CG T PK   QPIP
Sbjct  50   LAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYW  119
               + +++GYT DGPCEVW+D+T+V  G NCH +     + IDYSAC  +CTL WYW
Sbjct  109  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PITG_10499
Length=323

 Score = 122 bits (307),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 86/142 (61%), Gaps = 3/142 (2%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDES-LYKVTEEALFDCGLTSPKTETQPI  61
            LA+L+ QG     +   W  ++GY  LR  +D    +  VT  A   CGLT  K   +PI
Sbjct  22   LAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGLTELKGPPRPI  81

Query  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYW  119
            P + + +++GYT DGPC ++LDD  V    NCH   P   ++ID+S+C     CTL+W+W
Sbjct  82   PKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQKKGGCTLYWFW  141

Query  120  LGIKYVEGAYSWQVYKNCVALS  141
            LGI++V+  +SWQVYK C++L+
Sbjct  142  LGIRFVKSRWSWQVYKECISLT  163

>PITG_13520
Length=171

 Score = 115 bits (289),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 1/107 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  + ++W  E+GY SLR  +D  + Y VT  A F CG T PK   QPIP
Sbjct  50   LAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDVTSGADFSCGFTDPKGTPQPIP  108

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC  109
            +  + +++GYT DGPCEVWLDD  V  G NCH +FP   + +DYS+C
Sbjct  109  AGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSC  155

>PHYSO_254168
Length=170

 Score = 113 bits (282),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 84/141 (60%), Gaps = 18/141 (13%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T     +  +++GY +LR  +D    Y VT+ A + CG T+PK   QPIP
Sbjct  38   LAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWTNPKGTPQPIP  96

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYWL  120
                 +++GYT DGPCE+WLDD +V                IDYS+C     CT+ WYWL
Sbjct  97   -----RSTGYTHDGPCEIWLDDVRVL----------ERSPTIDYSSCEKKGGCTMHWYWL  141

Query  121  GIKYVEGAYSWQVYKNCVALS  141
            G+++++ +YSWQVYK C+ L+
Sbjct  142  GVRFLKNSYSWQVYKECIPLT  162

>PHYSO_527908
Length=174

 Score = 111 bits (277),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 77/125 (62%), Gaps = 1/125 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T      +M ++GY SLR  +D+ + Y VT+ A   CG T P    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  107

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
             + + +TSG+T D PCE+++ D    +  NCH        ++DYSACGDSC L+WYWLG+
Sbjct  108  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  167

Query  123  KYVEG  127
            ++++G
Sbjct  168  RFIKG  172

>PHYSO_340369
Length=200

 Score = 111 bits (277),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 79/140 (56%), Gaps = 15/140 (11%)

Query  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60
            M LAY ++QG NTS     W   +G+ +LR  +D+ +             +TSP    Q 
Sbjct  50   MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNY-----------SVTSP----QQ  94

Query  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120
            IP ++  +T GYT DGPCE+WLD+T   +  +C    P+  + +DYS CG SC ++WY L
Sbjct  95   IPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTL  154

Query  121  GIKYVEGAYSWQVYKNCVAL  140
            G+   +  YSW+VYK C+ L
Sbjct  155  GVAKPDRVYSWEVYKECIPL  174

>PHYSO_341596
Length=231

 Score = 108 bits (271),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 64/96 (67%), Gaps = 1/96 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  SW  ++GY SLR  +D ++ Y VT  A F CG T PK   QPIP
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  100

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFP  98
            +  + +++GYT DGPCEVWLDDTKV  G NCH +FP
Sbjct  101  AGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFP  136

>PYAP_18131
Length=226

 Score = 98.6 bits (244),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 71/119 (60%), Gaps = 7/119 (6%)

Query  33   LDDESLYKVTEE-ALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGR  91
            +DD++ YKV    A F+CG T P    QPIP N   +++G+T DG   VW+D+T+V   +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  92   --NCHTQFPHG--QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
              NCH     G   ++ID+S C   C + WYWLG++ +   +SWQVYK C+ +  + TA
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PHYSO_342364
Length=194

 Score = 90.9 bits (224),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDG  76
             S    H Y  LR +LD+ ++Y        +CG T+P    QPIP+N  +  + G    G
Sbjct  67   NSLKTSHNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTG  120

Query  77   PCEVWLDDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGA  128
            PCE+WLDD KV A  +C++++ H       +  +DYS C     C + +YWLG + +   
Sbjct  121  PCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKK  180

Query  129  YSWQVYKNCVAL  140
              WQ YKNC+ L
Sbjct  181  TVWQTYKNCIPL  192

>PHYRA_74651
Length=344

 Score = 92.4 bits (228),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 18/134 (13%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLD  75
            S  + +GY+ +R +LD D SLY        DCG T P    +  PS  +++F + G    
Sbjct  71   SLKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATF-SRGMVHA  123

Query  76   GPCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSAC-GDSCTLWWYWLGIKYVEG  127
            GPCE+WLDDTKV +  NC   +  G  E       +DYS+C    CTL +YWL  + ++ 
Sbjct  124  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  183

Query  128  AYSWQVYKNCVALS  141
            +  WQVYKNCV L+
Sbjct  184  STVWQVYKNCVPLT  197

>PHYRA_73607
Length=343

 Score = 91.3 bits (225),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 72/136 (53%), Gaps = 16/136 (12%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
            S    +GY+ +R +LD D SLY        DCG T+P  T   P  +  +  + G    G
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
            PCE+WLDDTKV +  NC   +  G  +       +DYS+C  S C L +YWL  + V+ +
Sbjct  125  PCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSS  184

Query  129  YSWQVYKNCVALSKTA  144
              WQVYKNCV L+  A
Sbjct  185  MVWQVYKNCVPLTGPA  200

>PYAP_24689
Length=252

 Score = 88.2 bits (217),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (53%), Gaps = 13/132 (10%)

Query  11   VNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-T  69
            + T  +  +  ++HG  +LRA L+ +            CG T+P  + +PIP +   +  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  70   SGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGA  128
            S     GPCE+W D+T+V    +C+ +F    Q +IDYS C   C L +YWLG++  +G 
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGG  166

Query  129  YSWQVYKNCVAL  140
              WQ YKNCV L
Sbjct  167  KRWQSYKNCVPL  178

>PYIR_16435
Length=304

 Score = 87.4 bits (215),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 69/122 (57%), Gaps = 14/122 (11%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEV  80
            +E GY++LR+ ++D+            CG T+P    + IPS+++ + S   +  GPCE+
Sbjct  72   KEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPCEL  122

Query  81   WLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            WLDD +V    NC   F       +ID+S+C  SC L W+WLG++  +    WQVYKNCV
Sbjct  123  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCV  180

Query  139  AL  140
             L
Sbjct  181  PL  182

>PHYCA_14368
Length=219

 Score = 85.5 bits (210),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 64/139 (46%), Gaps = 46/139 (33%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  SW  E+ Y SLR  +D+ + Y VT+ A F CG T PK       
Sbjct  50   LAFLENQGFKTQQDFASWRTENNYKSLRDFMDN-AKYTVTDGADFSCGFTDPK-------  101

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
                                                   + +DYS+C  +CTL WYWLGI
Sbjct  102  --------------------------------------DYTVDYSSCKGTCTLRWYWLGI  123

Query  123  KYVEGAYSWQVYKNCVALS  141
            ++++  YSWQVYK C+ LS
Sbjct  124  RFLKNQYSWQVYKACIPLS  142

>PYAP_18711
Length=210

 Score = 84.7 bits (208),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 13/121 (11%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEV  80
            ++ G  +LRA L+ +           +CG T+P  + +PIPS+   +  S     GPCEV
Sbjct  66   KKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEV  116

Query  81   WLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVA  139
            W D+T V +  +C  +F    Q +IDYS C  +C L +YWLG++  +G   WQ YKNCV 
Sbjct  117  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  140  L  140
            +
Sbjct  175  I  175

>PHYRA_73584
Length=287

 Score = 85.9 bits (211),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 16/136 (12%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
            S  + +GY+ +R +LD D +LY        +CG T+P  T   P  +  +  + G    G
Sbjct  68   SLKKSNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHAG  121

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
            PCE+WLDDT V +  +C T +  G  E       +DYS+C  S C L +YWL  + V+  
Sbjct  122  PCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSK  181

Query  129  YSWQVYKNCVALSKTA  144
              WQVYK+CV L+  A
Sbjct  182  TVWQVYKDCVPLTGPA  197

>PHYCA_534473
Length=1050

 Score = 87.8 bits (216),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 16/136 (12%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
            S  + +GY+ +R +LD D  LY        +CG T P  T   P  +  +  + G    G
Sbjct  843  SLKESNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATFSRGMVHAG  896

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
            PCE+WLDDTKV +  +C T +  G  E       +DYS+C  S C L +YWL  + V+  
Sbjct  897  PCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  956

Query  129  YSWQVYKNCVALSKTA  144
              WQVYK+CV L+  A
Sbjct  957  IVWQVYKDCVPLTGPA  972

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 65/131 (50%), Gaps = 18/131 (14%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPC  78
            + +    +R M+D D  LY        DCG T PK + +  PS  +++F + G    GPC
Sbjct  541  KSNNVKDIRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATF-SRGIVHAGPC  593

Query  79   EVWLDDTKVAAGRNCHTQFPHGQH-------EIDYSACG-DSCTLWWYWLGIKYVEGAYS  130
            E+WLDD  V    +C + +  G          +DYS+C    C   +YWL ++  +    
Sbjct  594  EIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTL  653

Query  131  WQVYKNCVALS  141
            WQVYKNC+ L+
Sbjct  654  WQVYKNCIPLT  664

 Score = 62.8 bits (151),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 15/119 (13%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVW  81
            ++ Y  +R ++D   +Y        DCG T PK T   P    ++  + G    GPCE+W
Sbjct  73   KNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  126

Query  82   LDDTKVAAGRNCHTQFPHGQHE-------IDYSACGD-SCTLWWYWLGIKYVEGAYSWQ  132
            LDD  V    +C   +  G  E       +DYS+C    C L +YWL ++ ++G  + Q
Sbjct  127  LDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGGGASQ  185

 Score = 58.9 bits (141),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 56/115 (49%), Gaps = 16/115 (14%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
            +R +LD D  LY        DCG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  285  IRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  338

Query  87   VAAGRNCHTQFPHGQHE-------IDYSACGD-SCTLWWYWLGIKYVEGAYSWQV  133
            V +  +C + +  G  E       +DYS+C    C   +YWL ++ ++G  + Q 
Sbjct  339  VLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGGGASQT  393

>PHYKE_2937
Length=366

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 73/138 (53%), Gaps = 16/138 (12%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
            S    +GY+ +R +LD D SLY        DCG T+P  T   P  +  +  + G    G
Sbjct  75   SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVG  128

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
            PCE+WLDDT V +  +C T +  G  +       +DYS+C  S C L +YWL  + V+ +
Sbjct  129  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSS  188

Query  129  YSWQVYKNCVALSKTATA  146
              WQVYK+CV L+  A+ 
Sbjct  189  MVWQVYKDCVPLTGPASG  206

>PPTG_04622
Length=273

 Score = 84.3 bits (207),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 70/136 (51%), Gaps = 16/136 (12%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDG  76
            S  + +GY+ +RA+LD D  LY        +CG T P  T   P  +  +  + G    G
Sbjct  71   SLKESNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGD-SCTLWWYWLGIKYVEGA  128
            PCE+WLDDT V +  +C T +  G  +       +DYS+C    C L +YWL  + V+  
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  129  YSWQVYKNCVALSKTA  144
              WQVYK+CV L+  A
Sbjct  185  MVWQVYKDCVPLTGPA  200

>PHYSO_484051
Length=285

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 16/133 (12%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDG-PCE  79
            + +GY+ +R +LD D SLY        DCG T+P    +  P+      S   +   PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  80   VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
            +WLDDT V +  +C T +  G  E       +DYS+C  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  132  QVYKNCVALSKTA  144
            QVYK+CV L+  A
Sbjct  188  QVYKDCVPLTGPA  200

>PHYSO_533903
Length=208

 Score = 82.4 bits (202),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (54%), Gaps = 16/127 (13%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDGPCEVWL  82
            + +  L+ MLDD SLY        DCG T P    QPIP++  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  83   DDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYS-WQV  133
            DD KV    +C++++ H       +  IDYS+C  G    + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  134  YKNCVAL  140
            YK+C+ L
Sbjct  188  YKDCIPL  194

>PPTG_04647
Length=327

 Score = 84.0 bits (206),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 70/135 (52%), Gaps = 16/135 (12%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCE  79
              +GY+ +R +LD D  LY        DCG T+P  T   P  +  +  + G    GPCE
Sbjct  73   SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  126

Query  80   VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
            +WLDDT V +  NC T +  G  +       +DYS+C  S C L +YWL  + V+    W
Sbjct  127  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  186

Query  132  QVYKNCVALSKTATA  146
            QVYK+CV L+  A+ 
Sbjct  187  QVYKDCVPLTGPASG  201

>PYVX_14662
Length=540

 Score = 85.1 bits (209),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDG  76
            +S   E G   +R++LDD S+Y        DCG T P    Q IP++     S G    G
Sbjct  68   KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATFSRGMVHVG  121

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
            PCE+WLDDT V    +C++ +     ++      DYS+C  G    + +YWL  + V+G 
Sbjct  122  PCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGD  181

Query  129  YSWQVYKNCVAL  140
              WQVYKNC+ L
Sbjct  182  TVWQVYKNCIPL  193

>PHYCA_130365
Length=266

 Score = 82.8 bits (203),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 15/127 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
            + Y  +R+M+D  S+Y        DCG T P  T   P    ++  + G    GPCE+WL
Sbjct  73   NNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWL  126

Query  83   DDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
            DD  V    +C + +  G  +       +DYS+C    C L +YWLG++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAY  186

Query  135  KNCVALS  141
            KNC+ L+
Sbjct  187  KNCIPLT  193

>PHYCA_531163
Length=314

 Score = 83.6 bits (205),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 71/138 (51%), Gaps = 16/138 (12%)

Query  19   SWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDG  76
            S    +GY+ +R +LD D SLY        DCG T+     +  PS      S G    G
Sbjct  71   SLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVG  124

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGA  128
            PCE+WLDDT V +  +C T +  G  +       +DYS+C  S C L +YWL  + V+ A
Sbjct  125  PCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSA  184

Query  129  YSWQVYKNCVALSKTATA  146
              WQVYK+CV L+  A+ 
Sbjct  185  IVWQVYKDCVPLTGPASG  202

>PITG_04948
Length=232

 Score = 82.0 bits (201),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 16/126 (13%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
            +R +LD D SLY        DCG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  87   VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
            V    +C + +  G  E       +DYS+C    C L +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  192

Query  139  ALSKTA  144
             LS  A
Sbjct  193  PLSGPA  198

>PHYRA_73606
Length=366

 Score = 84.0 bits (206),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 69/130 (53%), Gaps = 16/130 (12%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCE  79
              +GY+ +R +LD D SLY        DCG T+P  T   P  +  +  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  80   VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
            +WLDDT V +  +C T +  G  +       +DYS+C  S C L +YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  187

Query  132  QVYKNCVALS  141
            QVYK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PHYCA_534296
Length=309

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
            +S    + +  L+ ++DD S+Y        DCG T+P    QPIP++     S   +  G
Sbjct  41   KSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVG  94

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
            PCE+WLDDTKV    +C++++ +   +I      DYS+C  G    + +YWL  + V+G 
Sbjct  95   PCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGK  154

Query  129  YSWQVYKNCVAL  140
              WQ YK+C+ L
Sbjct  155  TVWQSYKDCIPL  166

>PITG_05271
Length=278

 Score = 81.3 bits (199),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 15/124 (12%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWLDD  84
            +  L+ ++DD S+Y        DCG T P  + QPIP +     S   +  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  85   TKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVYKN  136
            TKV    +C +++ +   +I      DYS+C  G    + +YWL  + V+G   WQ YK+
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  137  CVAL  140
            C+ L
Sbjct  189  CIPL  192

>H310_06362
Length=197

 Score = 79.7 bits (195),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 61/127 (48%), Gaps = 24/127 (19%)

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLD--G  76
            G+ +LRAMLD             DCG T      +PIP++            G+     G
Sbjct  51   GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  77   PCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            PCE+WLD+T+V    NC   FP     Q  +D+S+C  SCT+ +YWL +        WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH----EDLWQV  157

Query  134  YKNCVAL  140
            YKNC  L
Sbjct  158  YKNCAPL  164

>PHYKE_6001
Length=289

 Score = 81.3 bits (199),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 15/128 (12%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEV  80
            + + Y  L+ ++DD S+Y        DCG T P    QPIPS+     S      GPCE+
Sbjct  71   KANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEI  124

Query  81   WLDDTKVAAGRNCHTQFPHGQHEI------DYSAC-GDSCT-LWWYWLGIKYVEGAYSWQ  132
            WLDD  V +  +C+ ++ +   ++      DYS+C G  C  + +YWL  + V+G   WQ
Sbjct  125  WLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQ  184

Query  133  VYKNCVAL  140
             YKNC+ L
Sbjct  185  SYKNCIPL  192

>PHYKE_2809
Length=291

 Score = 80.5 bits (197),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
            +R MLD D  LY        DCG T PK   +  P++ +   S G    GPCE+WLDD  
Sbjct  66   IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  87   VAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNCV
Sbjct  120  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  179

Query  139  ALS  141
             LS
Sbjct  180  PLS  182

>PHYKE_10578
Length=239

 Score = 79.7 bits (195),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 57/111 (51%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
            CG T    + QP+PS+          +G+T  GPCEV++DD  V  G NC  ++P G  E
Sbjct  86   CGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPDE  145

Query  104  --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    IDYS+C   C L +YWLG +  +    WQ Y NCV L+ +  +
Sbjct  146  SGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLTGSGKS  192

>PHALS_05392
Length=367

 Score = 81.3 bits (199),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 15/130 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWL  82
            + +  +R+++D   +Y        DCG T P       PSN     S G    GPCE+WL
Sbjct  157  NNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWL  210

Query  83   DDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVY  134
            DD  V    +C   +  G  E       +DYS+C  D C L +YWL ++ ++G   WQ Y
Sbjct  211  DDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAY  270

Query  135  KNCVALSKTA  144
            KNC+ L+  A
Sbjct  271  KNCIPLNGPA  280

>PPTG_04618
Length=326

 Score = 80.9 bits (198),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 68/131 (52%), Gaps = 15/131 (11%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVW  81
            ++ Y  +R+++D   +Y        DCG T PK T ++P    ++  + G    GPCE+W
Sbjct  73   KNNYKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  82   LDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQV  133
            LDD  V    +C + +  G  +       +DYS+C    C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  186

Query  134  YKNCVALSKTA  144
            YKNC+ L+  A
Sbjct  187  YKNCIPLTGPA  197

>PYU1_G005323
Length=251

 Score = 79.7 bits (195),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 13/119 (11%)

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVWLD  83
            GY  L++ L+D+            CG + P  + +PIPS+   +  S     GPCEVW D
Sbjct  68   GYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWFD  118

Query  84   DTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
            D +     +C   F      ++D+SAC  SC L +YWLG++  +G   WQ YKNC+ L+
Sbjct  119  DVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLT  175

>PPTG_04619
Length=276

 Score = 80.1 bits (196),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 16/126 (13%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
            +R +LD D SLY        DCG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  87   VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
            V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  139  ALSKTA  144
             LS  A
Sbjct  193  PLSGPA  198

>PYU1_G014690
Length=295

 Score = 80.1 bits (196),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 65/124 (52%), Gaps = 18/124 (15%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEV  80
            +E G+ +LR+ ++D+            CG T P    + IPS++    S   +  GPCE+
Sbjct  68   KEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEI  118

Query  81   WLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
            WLDD +V    +C   F  G       ID+S+C  +C L ++WLG++  +    WQVYKN
Sbjct  119  WLDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKN  174

Query  137  CVAL  140
            CV L
Sbjct  175  CVPL  178

>PHYSO_483955
Length=320

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 15/130 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWL  82
            + Y  +R+++D   +Y        DCG T PK +    P++ +   S G    GPCE+WL
Sbjct  74   NNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWL  127

Query  83   DDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVY  134
            DD  V    +C + +  G  E       +DYS+C    C L +YWL ++ ++G   WQ Y
Sbjct  128  DDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAY  187

Query  135  KNCVALSKTA  144
            KNC+ L+  A
Sbjct  188  KNCIPLTGPA  197

>PHYSO_340333
Length=284

 Score = 79.7 bits (195),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
            + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  83   DDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
            DD KV    +C +++ +   +I      DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  135  KNCVAL  140
            K+C+ L
Sbjct  187  KDCIPL  192

>PHYSO_340332
Length=295

 Score = 79.7 bits (195),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
            + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  83   DDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
            DD KV    +C +++ +   +I      DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  135  KNCVAL  140
            K+C+ L
Sbjct  187  KDCIPL  192

>PYAP_18709
Length=235

 Score = 78.6 bits (192),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 63/119 (53%), Gaps = 13/119 (11%)

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVWLD  83
            G+  LR+ L+D+            CG + P    +PIPS+ + +  S     GPCEVWLD
Sbjct  68   GFKDLRSFLEDKGPT---------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLD  118

Query  84   DTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
            +T+     +C   F      ++D+ AC  SC L +YWLG++  +G   WQ YKNC+ L+
Sbjct  119  NTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PHYCA_19611
Length=531

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 66/131 (50%), Gaps = 13/131 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
            M    Y SL+  ++D+ +  V +E   +CG T+PK   QP+P      S     G+T   
Sbjct  280  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  338

Query  75   DGPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
            +GPCEVW DDT+V    NC   FP    +   D  AC  S  L  YW+ +     + SWQ
Sbjct  339  EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH----SPSWQ  394

Query  133  VYKNCVALSKT  143
            VY NC AL KT
Sbjct  395  VYINCAALEKT  405

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 45/109 (41%), Gaps = 17/109 (16%)

Query  37   SLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQ  96
            S YK  +E + D G T  +   Q   SN           GP  V      +    NC   
Sbjct  50   SKYKSLKEVINDLGKTKLRNRFQRRTSN-----------GPTVVAKALPPLTKDDNCAAN  98

Query  97   FPHGQHEIDYS--ACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKT  143
            +P    ++ Y   AC  +  L +YWL +     + +WQVY NC AL KT
Sbjct  99   YPTAPAKVPYDRDACLGASRLTFYWLALH----SSTWQVYTNCAALEKT  143

>H257_13550
Length=266

 Score = 78.2 bits (191),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 68/138 (49%), Gaps = 27/138 (20%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLD  75
            Q  G+ +LRAMLD +           DCG +      +PIPS+ +          G+   
Sbjct  103  QATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPS  153

Query  76   --GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACGDSCTLWWYWLGIKYVEGAYS  130
              GPCE+WLD+T+V    +C T FP        +D+++C  SCT+ +YW+ +        
Sbjct  154  HTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALHQ----DL  209

Query  131  WQVYKNC---VALSKTAT  145
            WQVYKNC   V LS T T
Sbjct  210  WQVYKNCAPLVGLSATPT  227

>PHYRA_78175
Length=319

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 67/129 (52%), Gaps = 13/129 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y+SL+  + D+ L  V +E   +CG T+P    QP+P      S     G+T   +GPCE
Sbjct  78   YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  136

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DDT+V    NC   FP    ++ Y   AC  S  L  YW+ +     + SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH----SASWQVYINC  192

Query  138  VALSKTATA  146
             AL KT ++
Sbjct  193  AALEKTTSS  201

>PYIW_19151
Length=248

 Score = 77.4 bits (189),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 70/128 (55%), Gaps = 14/128 (11%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEV  80
            +E G+++LR+ L+D+            CG T PK   + IP++ + + S      GPCE+
Sbjct  66   KEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCEL  116

Query  81   WLDDTKVAAGRNCHTQFPH--GQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            ++DDT+V    +C + F       ++D+S C   C + +YWLG++       WQVYK+CV
Sbjct  117  YIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQVYKSCV  174

Query  139  ALSKTATA  146
             +S +A A
Sbjct  175  PVSSSAVA  182

>PHYRA_77971
Length=230

 Score = 77.0 bits (188),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 53/109 (49%), Gaps = 17/109 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
            CG T    + QP+P+N           GYT  GPCE+++DD  V    NC   +P G ++
Sbjct  87   CGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPND  146

Query  104  --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                    +DYS+C   CT   YWLG +  +    WQ Y NCV LS T 
Sbjct  147  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTG  191

>PHYRA_85794
Length=230

 Score = 77.0 bits (188),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 53/109 (49%), Gaps = 17/109 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
            CG T    + QP+P+N           GYT  GPCE+++DD  V    NC   +P G ++
Sbjct  87   CGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPND  146

Query  104  --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                    +DYS+C   CT   YWLG +  +    WQ Y NCV LS T 
Sbjct  147  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTG  191

>PPTG_03139
Length=320

 Score = 78.2 bits (191),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 13/126 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y+SL+  + D+ +  V+++   +CG T+P    QP+P      S     G+T   +GPCE
Sbjct  78   YSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCE  136

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DDT+V    NC   FP    ++  D+ AC  S  L  YW+ +     + SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH----SPSWQVYINC  192

Query  138  VALSKT  143
             AL KT
Sbjct  193  AALEKT  198

>SPRG_19917
Length=241

 Score = 77.0 bits (188),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 69/141 (49%), Gaps = 30/141 (21%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQT  69
            N + +AQS      Y +LRA+LD             DCG T      + IPSN   +FQ 
Sbjct  64   NKAFKAQS-----KYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQN  109

Query  70   S----GYTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYW  119
                 G+ L   GPCEVWLD+ +V    +C T F   P     +DYS+CG   C L +YW
Sbjct  110  PDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYW  169

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            + +     +  WQVYKNCV L
Sbjct  170  IALH----SPRWQVYKNCVPL  186

>PHYRA_86016
Length=236

 Score = 76.6 bits (187),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + QPIP++   +       G+T  GPCE+++DDT V  G +C  ++P G   
Sbjct  22   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  81

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +DYS+C   CTL  YWL  +  +    WQ Y NCV L  + +A
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSA  128

>PHYRA_78689
Length=296

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
            +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  G
Sbjct  67   KSLKTANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVG  120

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
            PCE+WLDDTKV    +C +++ +   +I      DYS+C  G    + +YWL  + ++  
Sbjct  121  PCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSK  180

Query  129  YSWQVYKNCVAL  140
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>SDRG_17318
Length=241

 Score = 76.6 bits (187),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 68/141 (48%), Gaps = 30/141 (21%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQT  69
            N + +AQS      Y +LRAMLD             DCG T      + IPSN   +FQ 
Sbjct  64   NKAFKAQS-----KYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQN  109

Query  70   S----GYTLD--GPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACG-DSCTLWWYW  119
                 G+     GPCEVWLD+ +V    +C T FP        +DYS+CG   C L +YW
Sbjct  110  PDTGEGFIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYW  169

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            + +     +  WQVYKNCV L
Sbjct  170  IALH----SPRWQVYKNCVPL  186

>PHYKE_6077
Length=322

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  21   MQEHGYASLRAMLDDESLYKVT-EEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL-  74
            M    Y SL+  +  ++  KVT  E   +CG T+PK   QP+P      S     G+T  
Sbjct  73   MAASKYTSLKEFMAAKA--KVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSS  130

Query  75   -DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYS--ACGDSCTLWWYWLGIKYVEGAYSW  131
             +GPCEVW DDT+V    NC   FP    ++ Y   AC  S  L  YW+ +     + SW
Sbjct  131  HEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH----SPSW  186

Query  132  QVYKNCVALSKT  143
            QVY NC AL KT
Sbjct  187  QVYINCAALEKT  198

>PYU1_G007476
Length=195

 Score = 75.5 bits (184),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 61/127 (48%), Gaps = 17/127 (13%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNS----SFQTSGYTLDGP  77
            ++ GY +LR+ L+++            CG T P T  + IP +     +    G+   GP
Sbjct  71   KQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGP  121

Query  78   CEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CE+WLD+  +    NC   FP       +D+S+C  +C L  YWLG +  +    WQ YK
Sbjct  122  CELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQRWQTYK  179

Query  136  NCVALSK  142
             CV + K
Sbjct  180  YCVPVKK  186

>PHYSO_485524
Length=278

 Score = 76.6 bits (187),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 16/126 (13%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
            +R +LD D  LY        +CG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTKLYGA------NCGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  87   VAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCV  138
            V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  139  ALSKTA  144
             LS  A
Sbjct  193  PLSGPA  198

>PHYRA_86752
Length=300

 Score = 77.0 bits (188),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + QPIP++   +       G+T  GPCE+++DDT V  G +C  ++P G   
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +DYS+C   CTL  YWL  +  +    WQ Y NCV L  + +A
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSA  192

>PYU1_G007364
Length=316

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 23/126 (18%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ------TSGYTLD--GP  77
            YASLR +L              DCG T      +PIPS+            G+     GP
Sbjct  89   YASLRDLLQGHGE---------DCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGP  139

Query  78   CEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CE+WLDDT V    NC  +FP    Q ++D+S+C   C + +YWL ++      +WQ+YK
Sbjct  140  CEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIYK  195

Query  136  NCVALS  141
            NC+ L+
Sbjct  196  NCIPLA  201

>PHYRA_83499
Length=473

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 58/111 (52%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + QPIP++   +       G+T  GPCE+++DDT V  G +C  ++P G   
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +DYS+C   CTL  YWL  +  +    WQ Y NCV+L  + +A
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSA  192

 Score = 57.8 bits (138),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 39/72 (54%), Gaps = 12/72 (17%)

Query  71   GYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE--------IDYSACGDSCTLWWYWLGI  122
            G  + GPCE++LDDT +  G NC  ++  G  +        IDYS+C  +CTL  YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  123  KYVEGAYSWQVY  134
            +  +    WQ Y
Sbjct  406  QNEQ----WQAY  413

>PHYSO_438103
Length=238

 Score = 75.5 bits (184),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
            +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  G
Sbjct  66   KSLKSANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  119

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
            PCE+WLD+TKV    +C +++ +   +I      DYS+C  G    + +YWL  + ++  
Sbjct  120  PCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSK  179

Query  129  YSWQVYKNCVAL  140
              WQ YK+C+ L
Sbjct  180  TVWQSYKDCIPL  191

>PYIR_16443
Length=275

 Score = 75.9 bits (185),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 6/123 (5%)

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGP  77
            +W     +A++      E+L    E+    CG T+P    + IPS+S  + S   +  GP
Sbjct  57   NWKDPKNFATVSKQKGFETLRSYIEDKGALCGRTNPNASPKAIPSDSVVKFSRAIVHPGP  116

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY-  134
            CE+WLDD +V    NC   F       +ID+S+C  SC L W+WLG++  +    WQVY 
Sbjct  117  CEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYS  174

Query  135  KNC  137
            K+C
Sbjct  175  KSC  177

>PYIR_16444
Length=182

 Score = 74.3 bits (181),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 66/123 (54%), Gaps = 14/123 (11%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEV  80
            ++ G+ +LR+ ++++            CG T+ K   +PIPS+     S   +  GPCE+
Sbjct  69   KQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCEL  119

Query  81   WLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            WLD+ +V    NC   F       +ID+S+C  +C L ++WLG++  +    WQVYKNCV
Sbjct  120  WLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCV  177

Query  139  ALS  141
             + 
Sbjct  178  PVK  180

>PITG_04949
Length=337

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 68/131 (52%), Gaps = 15/131 (11%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVW  81
            ++ +  +R+++D   ++   EE    CG T PK +    PS+ +   S G    GPCE+W
Sbjct  73   KNNFKDVRSLMDGNPVF--GEE----CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  82   LDDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQV  133
            LDD  V    +C + +  G  +       +DYS+C    C L +YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQA  186

Query  134  YKNCVALSKTA  144
            YKNC+ L+  A
Sbjct  187  YKNCIPLTGPA  197

>PHYCA_12942
Length=353

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 12/100 (12%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T      QPIPS+   +       G+T  GPCE+++DD  V  G NC  +F  G   
Sbjct  84   CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDTS  143

Query  101  QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +IDYS+C  +C L  YWLG +  +    WQ Y NCV L
Sbjct  144  DMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PPTG_07507
Length=299

 Score = 75.9 bits (185),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + +PIP++   +       G+T  GPCE+++DD  V  G NC   FP G   
Sbjct  85   CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  144

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +D+S+C   CTL  YWLG +  +    WQ Y NCV L  + +A
Sbjct  145  SEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSA  191

>PPTG_07509
Length=299

 Score = 75.9 bits (185),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 56/111 (50%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + +PIP++   +       G+T  GPCE+++DD  V  G NC   FP G   
Sbjct  85   CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  144

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +D+S+C   CTL  YWLG +  +    WQ Y NCV L  + +A
Sbjct  145  SEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSA  191

>PYIW_27477
Length=180

 Score = 73.9 bits (180),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 9/121 (7%)

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGP  77
            SW     +A +      E+L    E+    CG T P  + + IPS++  + S   +  GP
Sbjct  34   SWKDPANFAKVSKEKGFETLRSYIEDKGAKCGKTDPNAKAKAIPSDNVVKFSRAIVHPGP  93

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W+DDT+V    NC   F  G      +ID+SAC   C L W+WLG++  +    WQV
Sbjct  94   CELWIDDTRVMQDDNCEKTF--GSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQV  149

Query  134  Y  134
            Y
Sbjct  150  Y  150

>PHYSO_533682
Length=278

 Score = 75.5 bits (184),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 15/131 (11%)

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGP  77
            S+   + +  L+ ++DD S+Y        DCG T P    QPIP++     S G    GP
Sbjct  68   SFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGP  121

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSAC--GDSCTLWWYWLGIKYVEGAY  129
            CE+WLDD KV +  +C++++ +   +      +DYS+C  G    +  Y LG + +    
Sbjct  122  CEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKT  181

Query  130  SWQVYKNCVAL  140
             WQ YKNC+ L
Sbjct  182  VWQSYKNCIPL  192

>PHYCA_127270
Length=279

 Score = 75.1 bits (183),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
            +S    + +  L+ ++DD S+Y        DCG T P    QPIP++     S   +  G
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVG  120

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
            PCE+WLDD KV    +C +++ +   +I      DYS+C  G    + +YWL  + +   
Sbjct  121  PCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKK  180

Query  129  YSWQVYKNCVAL  140
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>PYVX_20789
Length=290

 Score = 75.1 bits (183),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 65/133 (49%), Gaps = 18/133 (14%)

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDGP  77
            W  E+G +SL+        Y      + +CG T      QP+PS+  +   T G +  GP
Sbjct  69   WFTENGISSLKE-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGP  121

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W DDT+V    NC T F  GQ      ID + C  S    +YWL +     A  WQV
Sbjct  122  CEIWCDDTRVFNSTNCVTDF-SGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQV  176

Query  134  YKNCVALSKTATA  146
            Y NCVAL  T+++
Sbjct  177  YINCVALDGTSSS  189

>PHYKE_2454
Length=374

 Score = 75.9 bits (185),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 62/122 (51%), Gaps = 12/122 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
            Y SL+A++DD++   V+  A   CG   P    QP+PS    S   + G+T   +GPCE 
Sbjct  76   YKSLKALIDDKAKITVSG-ATLTCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHEGPCEA  134

Query  81   WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            W DD +V    NC   FP    E+ Y  S+   +  L +YW+ +       SWQVY NC 
Sbjct  135  WCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH----GPSWQVYVNCA  190

Query  139  AL  140
            AL
Sbjct  191  AL  192

>PHYRA_78161
Length=373

 Score = 75.9 bits (185),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 67/129 (52%), Gaps = 13/129 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y+SL+  ++D++   VT  A   CG   PK E QP+P +    S   + G+T   +GPCE
Sbjct  76   YSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  134

Query  80   VWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DD +     +C   +P    Q   D  AC  S TL +YW+ +     + +WQVY NC
Sbjct  135  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH----SSTWQVYVNC  190

Query  138  VALSKTATA  146
              L+ T ++
Sbjct  191  APLASTTSS  199

>PHYSO_459106
Length=223

 Score = 73.9 bits (180),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 18/134 (13%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPC  78
            + +    +R M+D D  LY        DCG T PK + Q  P+  +++F + G    GPC
Sbjct  72   KANNVKDIRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATF-SRGIVHAGPC  124

Query  79   EVWLDDTKVAAGRNCHTQFPHGQH-------EIDYSACGDS-CTLWWYWLGIKYVEGAYS  130
            E+WLDD  V    +C + +  G          +DYS+C    C   +YWL ++  +    
Sbjct  125  EIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTY  184

Query  131  WQVYKNCVALSKTA  144
            WQVYKNC+ L+  A
Sbjct  185  WQVYKNCIPLTGPA  198

>PHYCA_19598
Length=390

 Score = 75.9 bits (185),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 64/126 (51%), Gaps = 13/126 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y SL+ +  D++   V+  A   CG   PK E QP+P +    S   + G+T   +GPCE
Sbjct  76   YKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCE  134

Query  80   VWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DD +     NC T FP    +   D  AC  + TL +YW+ +     + +WQVY NC
Sbjct  135  VWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH----SDTWQVYVNC  190

Query  138  VALSKT  143
              L KT
Sbjct  191  APLEKT  196

>PITG_11936
Length=333

 Score = 75.5 bits (184),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 13/126 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y SL+  ++D ++  V E+   +CG T+P    QP+P      S     G+TL  +GPCE
Sbjct  78   YKSLKEFMND-NMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCE  136

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            V+ D+T+V    NC   FP    ++  D+ AC  S  L  YW+ +     + SWQVY NC
Sbjct  137  VYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH----SPSWQVYINC  192

Query  138  VALSKT  143
              L KT
Sbjct  193  APLEKT  198

>PYVX_18175
Length=147

 Score = 72.4 bits (176),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)

Query  104  IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
            IDYS+C  SCTL+WYW+G++Y++GAYSWQVYKNCV LS +A
Sbjct  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130

 Score = 32.7 bits (73),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  3   LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLD  34
           LA+L+ QG  T  +  +W + +GY +LR+ +D
Sbjct  50  LAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81

>PHYRA_73583
Length=630

 Score = 75.9 bits (185),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 18/127 (14%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPCEVWLDDT  85
            +R +LD D +LY        +CG T+P    +  PS  +++F + G    GPCE+WLDD 
Sbjct  79   IRTLLDSDTTLYGA------NCGYTNPDASPKDPPSTGDATF-SRGIVHAGPCEIWLDDK  131

Query  86   KVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNC  137
             V    +C + +  G  E       +DYS+C    C   +YWL ++ ++G   WQVYKNC
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNC  191

Query  138  VALSKTA  144
            + LS  A
Sbjct  192  IPLSGPA  198

 Score = 74.3 bits (181),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 63/127 (50%), Gaps = 18/127 (14%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPCEVWLDDT  85
            +R M+D D  LY        DCG T PK   +  PS  +++F + G    GPCEVWLDD 
Sbjct  380  IRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATF-SRGMVHAGPCEVWLDDE  432

Query  86   KVAAGRNCHTQFPHGQH-------EIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
             V    +C + +  G          IDYS+C    C   ++WL ++  +    WQVYKNC
Sbjct  433  MVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNC  492

Query  138  VALSKTA  144
            V LS  A
Sbjct  493  VPLSGPA  499

>PHYRA_73582
Length=326

 Score = 75.1 bits (183),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 16/130 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCEVWL  82
            + Y  L+ ++D     +       DCG T P  T + P    ++  + G    GPCE+WL
Sbjct  74   NNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWL  126

Query  83   DDTKVAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVY  134
            DD  V    +C + +  G  E       +DYS C    C L +YWL ++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSY  186

Query  135  KNCVALSKTA  144
            KNC+ L+  A
Sbjct  187  KNCIPLTGPA  196

>SDRG_08129
Length=218

 Score = 73.6 bits (179),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (46%), Gaps = 29/149 (19%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            N +    ++  +  + +LR ML+ +            CG + P    + IPS+ +     
Sbjct  57   NVAAFTSAFKVQSQFKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGAMTWRN  107

Query  69   -------TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSAC-GDSCTLWW  117
                    S +T  GPCEVWLDD +V    +C T FP        +DYS+C GD C L +
Sbjct  108  PDTGEGFISSHT--GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRF  165

Query  118  YWLGIKYVEGAYSWQVYKNCVALSKTATA  146
            YWL +   +    WQVYKNCV L     A
Sbjct  166  YWLALHQPQ----WQVYKNCVPLQGNGQA  190

>PHYSO_533747
Length=206

 Score = 73.2 bits (178),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 16/126 (13%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN-SSFQTSGYTLDGPCEVWL  82
            + +  L+ MLDD SLY        DCG T P    QPIP++  +  + G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  83   DDTKVAAGRNCHTQFPHG------QHEIDYSAC--GDSCTLWWYWLGIKYVEGAYS-WQV  133
            DD KV    +C++++ H       +  IDYS+C  G    + +YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  134  YKNCVA  139
            Y   + 
Sbjct  188  YSTLLG  193

>SDRG_08137
Length=282

 Score = 74.3 bits (181),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (46%), Gaps = 29/149 (19%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            N +    ++  +  + +LR ML+ +            CG + P    + IPS+ +     
Sbjct  121  NVAAFTSAFKAQSQFKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGTMTWRN  171

Query  69   -------TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSAC-GDSCTLWW  117
                    S +T  GPCEVWLDD +V    +C T FP        +DYS+C GD C L +
Sbjct  172  PDTGEGFISSHT--GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRF  229

Query  118  YWLGIKYVEGAYSWQVYKNCVALSKTATA  146
            YWL +   +    WQVYKNCV L     A
Sbjct  230  YWLALHQPQ----WQVYKNCVPLQGNGQA  254

>PHYKE_3913
Length=321

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  29   LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGPCEVWLDDTK  86
            +R + D D SLY        +CG T+P    +  P++ +   S G    GPCE+WLDD  
Sbjct  106  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  87   VAAGRNCHTQFPHGQHE-------IDYSACG-DSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            V    +C + +  G  E       +DYS+C    C   +YW+ ++ ++G   WQVYKNCV
Sbjct  160  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  219

Query  139  ALS  141
             L+
Sbjct  220  PLT  222

>PYVX_16138
Length=559

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 15/125 (12%)

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS-GYTLDGP  77
            S  +E G   +R++LDD S+Y        DCG T P    Q IP++S+   S G    GP
Sbjct  69   SLAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGP  122

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQHE------IDYSACGDS-CTLW-WYWLGIKYVEGAY  129
            CE+WLDDT V    +C++ +     +      +DYS+C  S C++  +YWL  + V+   
Sbjct  123  CEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDET  182

Query  130  SWQVY  134
             WQVY
Sbjct  183  VWQVY  187

>PHYRA_78626
Length=473

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)

Query  92   NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            NCH        ++DYS CGDSC L+WYWLG +Y++G+YSWQVYK C+ L
Sbjct  350  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PYIR_16375
Length=262

 Score = 73.6 bits (179),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 61/120 (51%), Gaps = 12/120 (10%)

Query  25   GYASLRAM-LDDESLYKVTEEALFDCGLTS---PKTETQPIPSNSSFQTSGYTLDGPCEV  80
            GY SLR + L ++ +Y   E    +CGLT+    K  T P   N +F  SG+T  GPCE+
Sbjct  77   GYTSLRDLILANQDMYD--ESTDKECGLTTLDEAKRTTMPASGNITF--SGFTHPGPCEL  132

Query  81   WLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            W DD K+    NC   +P G+   D + C  +     +W+G+        WQVY NCV L
Sbjct  133  WCDDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVH----GSPWQVYTNCVYL  188

>PYIR_24743
Length=357

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)

Query  11   VNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---  67
             N     +++  +  + +LR +L D            DCG + P    + IP +      
Sbjct  72   ANVDTFTKAFQGQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGDGKVVWQ  122

Query  68   ---QTSGYTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACGDSCTLWWYW  119
                  G+     GPCE+WLDD +V +  NC   F   P  +  +D+S+C ++C L +YW
Sbjct  123  NPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYW  182

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            L +       +WQVYKNCV L
Sbjct  183  LALH----EPTWQVYKNCVPL  199

>PYAR_14256
Length=199

 Score = 72.4 bits (176),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 12/119 (10%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
            + G+ +LRA L+D+            CG T P  + +P         S     GPCE+WL
Sbjct  63   DKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWL  113

Query  83   DDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            DD+      +C  +F      ++D+SAC  SC L +YWLG++       WQ YKNC+ L
Sbjct  114  DDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPL  170

>PHYRA_78625
Length=434

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 0/49 (0%)

Query  92   NCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            NCH        ++DYS CGDSC L+WYWLG +Y++G+YSWQVYK C+ L
Sbjct  311  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYSO_524101
Length=308

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 66/131 (50%), Gaps = 13/131 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
             +   Y+SL+ +++D++   VT+ A   CG+  P    QP+P      +   + G+T   
Sbjct  73   FESSSYSSLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
            +GPCEVW DD +V    +C   +     E+ Y   AC  S TL +YWL +     + +WQ
Sbjct  132  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQ  187

Query  133  VYKNCVALSKT  143
            VY NC  L  T
Sbjct  188  VYVNCAPLEAT  198

>PHALS_06480
Length=159

 Score = 71.2 bits (173),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)

Query  1   MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYK  40
           MALAYL+EQG+NTSIE QSWM++H Y SLRAMLDD+ LYK
Sbjct  54  MALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93

>PHYCA_12943
Length=287

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + QPIPS+   +       G+T  GPCE+++DD  V  G +C  +FP G   
Sbjct  88   CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDG  147

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +D+S+C   CTL  YWL  +  +    WQ Y NCV L    +A
Sbjct  148  SDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPLQGDGSA  194

>PHYCA_97965
Length=288

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + QPIPS+   +       G+T  GPCE+++DD  V  G +C  +FP G   
Sbjct  88   CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKG  147

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                 +  +D+S+C   CTL  YWL  +  +    WQ Y NCV L    +A
Sbjct  148  SDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPLQGDGSA  194

>SPRG_07795
Length=335

 Score = 73.6 bits (179),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 59/123 (48%), Gaps = 15/123 (12%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GY--TLDGPCEVW  81
            + +L+A LD             DCG+T P    QP+PS   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELW  128

Query  82   LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
             D+T+V    NC   +P G   ID S C  +  L   WL +   E    WQVYKNCV LS
Sbjct  129  CDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

Query  142  KTA  144
              A
Sbjct  185  GAA  187

>SDRG_07565
Length=278

 Score = 73.2 bits (178),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 69/148 (47%), Gaps = 34/148 (23%)

Query  13   TSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ----  68
            T+ +AQS      + +LR ML+ +            CG + P    + IPS+ +      
Sbjct  125  TAFKAQSQ-----FKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGTMTWLNP  170

Query  69   ------TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPH---GQHEIDYSACGDS-CTLWWY  118
                   S +T  GPCEVWLDD +V    +C T FP        +DYS+CG S C L +Y
Sbjct  171  DTGEGFISSHT--GPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFY  228

Query  119  WLGIKYVEGAYSWQVYKNCVALSKTATA  146
            WL +   +    WQVYKNCV L     A
Sbjct  229  WLALHQPQ----WQVYKNCVPLQGNGQA  252

>PYVX_18179
Length=147

 Score = 70.5 bits (171),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)

Query  104  IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
            +DYS+C  SCTL+W+W+G++Y++GAYSWQVYKNCV LS +A
Sbjct  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131

 Score = 33.9 bits (76),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  3   LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLD  34
           LA+L++QG  T  +  SW   +GY +LRA +D
Sbjct  50  LAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81

>PHYSO_246676
Length=187

 Score = 71.6 bits (174),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 63/139 (45%), Gaps = 39/139 (28%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG  T  +  +W +E+GY +LR  +D ++ Y VT  A F CG T PK   QPIP
Sbjct  33   LAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDVTSGADFSCGFTDPKGTPQPIP  91

Query  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122
              +  +++GYT DG                                      L    L +
Sbjct  92   EGNKMRSTGYTHDG--------------------------------------LVHASLVL  113

Query  123  KYVEGAYSWQVYKNCVALS  141
              ++ +YSW+VYK C+ LS
Sbjct  114  DGMKNSYSWKVYKACIPLS  132

>PHYSO_374518
Length=116

 Score = 69.7 bits (169),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 55/106 (52%), Gaps = 9/106 (8%)

Query  46   LFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGPCEVWLDDTKVAAGRNCHTQFP---HG  100
            + +CG T  K   QP+PS+   Q  T G +  GPCE+W DDT+V    NC  ++      
Sbjct  5    ISECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPT  64

Query  101  QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
            +  ID S C  S    +YWL +     A  WQVY NCVAL  TA A
Sbjct  65   KLPIDVSTCKASSEFVFYWLALH----AQPWQVYINCVALDGTAAA  106

>PHYRA_79140
Length=424

 Score = 73.9 bits (180),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 54/111 (49%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T      QPIPS+   +       G+T  GPCE++LDDT V    NC   +P G   
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +DYS+C   CTL  YWL  +  +    WQ Y NCV LS + +A
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLSGSGSA  192

>PYU1_G005324
Length=191

 Score = 71.6 bits (174),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 13/120 (11%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  82   LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005326
Length=191

 Score = 71.6 bits (174),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 13/120 (11%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  82   LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005328
Length=191

 Score = 71.6 bits (174),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 13/120 (11%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  82   LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ YKNCV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PHYCA_69583
Length=224

 Score = 72.0 bits (175),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 21/134 (16%)

Query  22   QEHGYAS-LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDGP  77
            +E GYA+ +R +LD D +LY        +CG ++P  + +  PS+  ++F+  G    GP
Sbjct  73   KEAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFE-RGLAHHGP  125

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS-CTLWWYWLGIK-YVEG  127
            CE+WLDD  V    +C   F    +         IDYS+C  S C   +YWL  +    G
Sbjct  126  CEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSG  185

Query  128  AYSWQVYKNCVALS  141
             Y WQ+YK+C+ L+
Sbjct  186  KYVWQIYKDCIPLT  199

>PYVX_20783
Length=276

 Score = 72.8 bits (177),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 62/127 (49%), Gaps = 18/127 (14%)

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGP  77
            W   +G +SL+        Y  T  +  +CG T      QP+PS+   Q  T G +  GP
Sbjct  69   WFTANGISSLKE-------YITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGP  121

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W DDT+V    NC T+F  GQ      ID + C  S    +YWL +     A  WQV
Sbjct  122  CEIWCDDTRVFTSTNCVTEF-SGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQV  176

Query  134  YKNCVAL  140
            Y NCVAL
Sbjct  177  YINCVAL  183

>PYAR_14260
Length=212

 Score = 71.2 bits (173),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 13/119 (11%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVWL  82
             G+ +LR+ L+ +            CG +    + +PIPS+   +  S     GPCE+WL
Sbjct  44   KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFASTLEHPGPCEIWL  94

Query  83   DDTKVAAGRNCHTQFPHGQH-EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            D+T      +C  QF      ++++SAC  SC L +YWLG++  +    WQ YKNCV L
Sbjct  95   DETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  151

>PHYCA_18657
Length=295

 Score = 72.4 bits (176),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 17/109 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHE  103
            CG T    + +P+P+N           G+T  GPCE+++DD  V    +C   +P G ++
Sbjct  172  CGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPND  231

Query  104  --------IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144
                    +DYS+C   CT   YWLG +  +    WQ Y NCV LS T 
Sbjct  232  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTG  276

>PPTG_04620
Length=342

 Score = 72.8 bits (177),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 18/131 (14%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPS--NSSFQTSGYTLDGPC  78
            + +    +R M+D D  LY        DCG T PK   +  PS  +++F + G    GPC
Sbjct  74   KSNNVKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATF-SRGIVHAGPC  126

Query  79   EVWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYS  130
            E+WLDD  V    +C + +  G  +       +DYS+C    C   +YWL ++  +    
Sbjct  127  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTL  186

Query  131  WQVYKNCVALS  141
            WQVYKNC+ LS
Sbjct  187  WQVYKNCIPLS  197

>CCA17179
Length=185

 Score = 70.5 bits (171),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (49%), Gaps = 23/129 (18%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLD--GP  77
            + +LR  L D+  Y         CG T+P  + +PIP++ +          G+     GP
Sbjct  46   FQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGP  96

Query  78   CEVWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CEVWL++ +V    NC  H +    +  ID+S C + C L ++WL +   +    WQVYK
Sbjct  97   CEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQVYK  152

Query  136  NCVALSKTA  144
            NC+ ++   
Sbjct  153  NCIPIAPNG  161

>PYU1_G005325
Length=207

 Score = 70.9 bits (172),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 13/120 (11%)

Query  23   EHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ-TSGYTLDGPCEVW  81
            + GY  L++ LD +            CG T    + + IP +   +  S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  82   LDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            L +T+     +C   F      +ID+SAC  +C L +YWLG++  +G   WQ YKNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIPL  175

>PHYCA_98479
Length=276

 Score = 72.0 bits (175),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 54/106 (51%), Gaps = 17/106 (16%)

Query  48   DCGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG--  100
            +CG T      QP+P++   +       G+T  GPCE+++DDT V  G NC  ++P G  
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  101  ------QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                     +DYS+C   CTL  YWLG +  +    WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PYIR_23585
Length=240

 Score = 71.2 bits (173),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 14/120 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEVWL  82
             G+A+ RA L+              CG T      +PIPS+++ + S   +  GPCE+W+
Sbjct  69   KGFATTRAFLESRGPT---------CGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWI  119

Query  83   DDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            D+T+V    +C   F       +ID+SAC  SC L +YWLG++  +G   +Q Y  C+AL
Sbjct  120  DNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLAL  177

>PHALS_03176
Length=207

 Score = 70.9 bits (172),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 11/126 (9%)

Query  26   YASLRAMLDDESLYKVTEEALF--DCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEVWL  82
            +  L+A    + L  + + + F   CG + PK + QPIP +     S   +  GPCE+WL
Sbjct  66   FQKLKAANKFKDLKTLMDTSAFGAKCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWL  125

Query  83   DDTKVAAGRNCHTQFPH------GQHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
            D+ KV    +C++++ +          +DYS+C  G    + +YWL  + V G   WQ Y
Sbjct  126  DNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSY  185

Query  135  KNCVAL  140
            KNC+ L
Sbjct  186  KNCIPL  191

>PYAP_19707
Length=241

 Score = 71.2 bits (173),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 57/106 (54%), Gaps = 8/106 (8%)

Query  38   LYKVTEEALFDCGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNCHT  95
            +  + E A   CG T      QPIP++   +F  S   + GPCEVWLD+TKVA+ + C  
Sbjct  58   IKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWK  116

Query  96   QFPHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            +FP+ + ++D++ C   SC L W W+          W+ + NCV +
Sbjct  117  EFPNKRIKVDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCVRV  158

>SPRG_19916
Length=305

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 65/141 (46%), Gaps = 30/141 (21%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            N + +AQ+      + +LR MLD +           DCG T      + IP+N       
Sbjct  64   NKAFKAQTQ-----FKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQN  109

Query  69   ---TSGYTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSAC-GDSCTLWWYW  119
                 G+     GPCEVW+DD +V    +C T F   P     IDYS+C GD C L +YW
Sbjct  110  PDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYW  169

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            L +        WQVYKNCV L
Sbjct  170  LALH----EPMWQVYKNCVPL  186

>PHYKE_6079
Length=302

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 13/126 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTLDGPCE  79
            Y SL+ +++D +   VT+  L  CG   P    QP+P      S+SS +    + +GPCE
Sbjct  79   YTSLKELINDLATITVTDATL-TCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  137

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DD +V   ++C   +     E+  D+ AC  + TL +YWL +     + +WQVY NC
Sbjct  138  VWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQVYVNC  193

Query  138  VALSKT  143
              L  T
Sbjct  194  APLETT  199

>H257_11264
Length=282

 Score = 71.6 bits (174),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 16/136 (12%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            + +IE    +++  +ASLRA +D +           +CGLT      + +PS+S  +   
Sbjct  65   DNTIEFTRQLKKSSFASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAH  118

Query  69   -TSGYTL--DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYV  125
             + G+ L  +GPCE+W D T+V    NC    P G   I+ S C  S  L   WL +   
Sbjct  119  GSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS  178

Query  126  EGAYSWQVYKNCVALS  141
            +    WQVYKNCV L+
Sbjct  179  Q----WQVYKNCVRLT  190

>PHYRA_80631
Length=320

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 67/133 (50%), Gaps = 10/133 (8%)

Query  10   GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
            GVN ++   ++   + GY SL A +  ++ LY    +   DCGLT  K   +     S  
Sbjct  62   GVNGTLNFFKATFPDKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKL  119

Query  68   QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
              SG+T  GPCEVW DDTKV    +C T++P     I Y  S C D+  L  YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLH--  177

Query  126  EGAYSWQVYKNCV  138
                 WQVY +CV
Sbjct  178  --GDPWQVYTDCV  188

>PYVX_21297
Length=263

 Score = 71.6 bits (174),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (52%), Gaps = 8/108 (7%)

Query  36   ESLYKVTEEALFDCGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNC  93
            + +  +   A  +CG T      QP+PS+   +F  S   + GPCEVWLDDTKVA+  +C
Sbjct  54   DVIRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDC  112

Query  94   HTQFPHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             + +      IDYS C G SC L W WL          W+++ NCV +
Sbjct  113  WSTYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  156

>PYIW_21964
Length=265

 Score = 71.2 bits (173),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 14/128 (11%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
            ++   Y S+RA++DD++++   +EA  +CG+TSP    QP+P      S   + G+T   
Sbjct  77   LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  134

Query  76   -GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCEVW DD       NC   +     E  ID++ C  +  L   WL +     + +WQ
Sbjct  135  QGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SSTWQ  190

Query  133  VYKNCVAL  140
            +Y NC  L
Sbjct  191  IYINCAPL  198

>PHYRA_83500
Length=394

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 53/111 (48%), Gaps = 17/111 (15%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T      QPIPS+   +       G+T  GPCE++LDDT V    NC   +P G   
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTATA  146
                    +DYS+C   CTL  YWL  +  +    WQ Y NC  LS + +A
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLSGSGSA  192

>PHYRA_78176
Length=312

 Score = 71.6 bits (174),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
             +   Y+SL+  +DD++   VT+  L  CG   P    QP+P      +   + G+T   
Sbjct  74   FESSSYSSLKEFIDDKATITVTDATL-TCGACDPDETAQPLPETYVEWAHSDSEGFTASH  132

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
            +GPCEVW DD +V    +C   F     ++  D+ AC  S  L +YWL +     + +WQ
Sbjct  133  EGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH----SSTWQ  188

Query  133  VYKNCVAL  140
            VY NC  L
Sbjct  189  VYVNCAPL  196

>PPTG_04803
Length=268

 Score = 71.2 bits (173),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 62/127 (49%), Gaps = 17/127 (13%)

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGP  77
            W  ++  ASL+  +   + Y      + +CG T  K   QP+PS+   Q  T G +  GP
Sbjct  69   WFTKNNVASLKEFI---TTYGTD---ISECGNTEKKGTAQPVPSDGYAQHDTLGNSHPGP  122

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W DDT+V    NC   F  GQ      ID S C  S    +YWL +     A  WQV
Sbjct  123  CEIWCDDTRVFHDTNCVVTF-SGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQV  177

Query  134  YKNCVAL  140
            Y NCVAL
Sbjct  178  YINCVAL  184

>PITG_08892
Length=309

 Score = 71.6 bits (174),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 10/133 (8%)

Query  10   GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
            G N +I   ++ +   G  SL A++  ++ LY  + E   DCGLT+ K   +     S  
Sbjct  62   GPNGAINIIKANLATKGGGSLGALIAKNQKLY--SSEVDPDCGLTTFKDSARSKLPASQL  119

Query  68   QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYV  125
            + +G+T  GPCEVW DDTKV    +C T+FP    +I  D S C  +  L  YWL +   
Sbjct  120  EYTGFTHPGPCEVWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVH--  177

Query  126  EGAYSWQVYKNCV  138
                 WQVY +CV
Sbjct  178  --GEQWQVYSDCV  188

>PPTG_07521
Length=281

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 53/106 (50%), Gaps = 17/106 (16%)

Query  48   DCGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG--  100
            +CG T      QPIPS+   +       G+T  GPCE++LDD  V  G NC  ++P G  
Sbjct  85   ECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDV  144

Query  101  ------QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                     +DYS+C + CTL  YWL  +      +WQ Y NCV L
Sbjct  145  GSTVTSDMPVDYSSCTEDCTLTIYWLAFQNA----NWQAYINCVPL  186

>SPRG_07627
Length=536

 Score = 72.0 bits (175),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 25/135 (19%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ------TSG  71
            +++  +  Y +LR +LD             DCG T P    + IPS+            G
Sbjct  62   KAFAAQTQYKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEG  112

Query  72   YTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYWLGIKYV  125
            +     GPCE+WLD T+V    +C T F   P  +  +DY+ CG + C L +YWL +   
Sbjct  113  FIPSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQP  172

Query  126  EGAYSWQVYKNCVAL  140
            +    WQVYKNCV L
Sbjct  173  Q----WQVYKNCVPL  183

>PPTG_06256
Length=318

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 9/121 (7%)

Query  21   MQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCE  79
            +   G  SL A++  ++ LY  + +   DCGLT+ K   +     S  + +G+T  GPCE
Sbjct  74   LPTKGGGSLGALIAKNQKLY--SSDVDPDCGLTTFKESARSKLPASQLEYTGFTHPGPCE  131

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DDTKV    +C T+FP    +I Y  S C ++  L  YWL +        WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVH----GEQWQVYSDC  187

Query  138  V  138
            V
Sbjct  188  V  188

>PHYRA_84947
Length=265

 Score = 70.9 bits (172),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 64/134 (48%), Gaps = 17/134 (13%)

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GYTLDG  76
            SW  ++  ASL+  +   + Y      + +CG+T      QP+PS+   Q    G +  G
Sbjct  68   SWFTKNNIASLKEYI---TTYGTD---ISECGVTKKNGAPQPVPSDGYAQHDNLGNSHPG  121

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
            PCE+W DDT+V    NC  +F  GQ      ID S C  S  L +YWL +        WQ
Sbjct  122  PCEIWCDDTRVFHDSNCVAKF-SGQSPAKIPIDVSTCKSSSELVFYWLALHI----QPWQ  176

Query  133  VYKNCVALSKTATA  146
            VY NCVAL     A
Sbjct  177  VYINCVALDGAGAA  190

>SDRG_15426
Length=523

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 25/135 (19%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ------TSG  71
            +++  +  Y +LR +LD             DCG T      +PIPS+            G
Sbjct  38   KAFAAQSQYKTLRDLLDLSGP---------DCGNTRTNVAPKPIPSDGMMTWQNPDTGEG  88

Query  72   YTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYWLGIKYV  125
            +     GPCE+WLD+ +V    NC T F   P  +  +DY+ CG + C L +YWL +   
Sbjct  89   FIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLALHQP  148

Query  126  EGAYSWQVYKNCVAL  140
            +    WQVYKNCV L
Sbjct  149  Q----WQVYKNCVPL  159

>PHALS_03179
Length=372

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (52%), Gaps = 11/127 (9%)

Query  25   GYASLRAMLDDESLYKVTEEALF--DCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEVW  81
             Y SL+A  + + L  + E      +CG + PK + QPIP +     S   +  GPCE+W
Sbjct  106  AYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  165

Query  82   LDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGAYSWQV  133
            LD+ KV    +C+ ++ +   +I      DYS+C  G    + +YWL  + ++G   WQ 
Sbjct  166  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  225

Query  134  YKNCVAL  140
            YKNC+ L
Sbjct  226  YKNCIPL  232

>PHYCA_112615
Length=196

 Score = 69.3 bits (168),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 59/114 (52%), Gaps = 19/114 (17%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
            + +  L+ ++DD S+Y        DCG T P  + QPIPS+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  83   DDTKVAAGRNCHTQFPHGQHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQVY  134
            DDTK     +  + FP     +DYS+C  G    + +YWL  + V+G   WQ Y
Sbjct  127  DDTK-----DIKSIFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  170

>PHYRA_78174
Length=279

 Score = 70.5 bits (171),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 72/144 (50%), Gaps = 22/144 (15%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTE-EALFDCGLTSPKTETQPIP--------  62
            NT+  A+ + +   Y SL+ M+ D  L KVT  +   +CG T+P    QP+P        
Sbjct  64   NTAAFAKGF-EASKYTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAH  120

Query  63   -SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYW  119
             S   F +S    +GPCEVW DD +V    +C   +     ++  D+ AC  +  L +YW
Sbjct  121  GSGEGFTSS---HEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYW  177

Query  120  LGIKYVEGAYSWQVYKNCVALSKT  143
            L +     + +WQVY NC AL KT
Sbjct  178  LALH----SSTWQVYTNCAALEKT  197

>PHYSO_255056
Length=269

 Score = 70.5 bits (171),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 65/125 (52%), Gaps = 17/125 (14%)

Query  22   QEHGYAS-LRAMLD-DESLYKVTEEALFDCGLTSP--KTETQPIPSNSSFQTSGYTLDGP  77
            +E GYA+ +R +LD D +LY        DCG ++P  K +  P    ++F+  G    GP
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFE-RGLAHHGP  126

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIK-YVEGAYSWQVYKN  136
            CE+WLDDT V    +C   F       DY +  + C   +YWL  +    G Y WQ+YKN
Sbjct  127  CEIWLDDTMVLHNDDCAKAF----SVEDYMSI-NGCMFRFYWLAFQGSTSGKYVWQIYKN  181

Query  137  CVALS  141
            C+ L+
Sbjct  182  CIPLT  186

>PHYSO_246481
Length=318

 Score = 70.9 bits (172),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 64/131 (49%), Gaps = 13/131 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTL  74
             +   Y SL+ +++D++   VT+ A   CG   P    QP+P      S+SS +    + 
Sbjct  74   FEASSYTSLKELINDKATITVTD-ATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSH  132

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCEVW DD +V    +C   +     E+  D  AC  + TL +YWL +     + +WQ
Sbjct  133  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQ  188

Query  133  VYKNCVALSKT  143
            VY NC  L  T
Sbjct  189  VYINCAPLEST  199

>PYAP_24691
Length=145

 Score = 67.8 bits (164),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 3/66 (5%)

Query  76   GPCEVWLDDTKVAAGRNCHTQFPHG-QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
            GPCE+W D+T+V    +C  +F    Q +IDYS C  +C L +YWLG++  +G   WQ Y
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSY  62

Query  135  KNCVAL  140
            KNCV +
Sbjct  63   KNCVPI  68

>PYAR_18165
Length=261

 Score = 69.7 bits (169),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 9/96 (9%)

Query  49   CGLTSPKTETQPIPSNS--SFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY  106
            CG T+     QP PS+   +F  S   + GPCE+WLDDTKV +  +C  QFP  +  +D+
Sbjct  69   CGKTNANAAVQPAPSDGVVAFAISAQHI-GPCEIWLDDTKVVSATDCWKQFPDKRIPVDF  127

Query  107  SACGD--SCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            S C +  SC L W W+          W+ Y NCV +
Sbjct  128  SKCANKASCELRWIWMATHT----SPWEFYDNCVRV  159

>PHYKE_9024
Length=299

 Score = 70.1 bits (170),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 66/133 (50%), Gaps = 10/133 (8%)

Query  10   GVNTSIEA-QSWMQEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
            GVN ++   +      GY SL A +  ++ LY    +A  DCGLT  K   +     S  
Sbjct  62   GVNGTLNFFKDTFPSKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKL  119

Query  68   QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
              SG+T  GPCEVW DDTKV    +C T++P     + Y  S C ++  L  YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLH--  177

Query  126  EGAYSWQVYKNCV  138
                 WQVY +CV
Sbjct  178  --GDPWQVYTDCV  188

>CCI47381
Length=211

 Score = 68.6 bits (166),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 23/126 (18%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF------QTSGYTLD--GP  77
            + +LR  L D+  Y         CG T+P    +PIP++++          G+     GP
Sbjct  72   FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  122

Query  78   CEVWLDDTKVAAGRNCHTQF--PHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CEVWL +T+V    NC   F     +  I++S+C   C L ++WL +   +    WQVYK
Sbjct  123  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYK  178

Query  136  NCVALS  141
            NC+ ++
Sbjct  179  NCIPIA  184

>PITG_04947
Length=298

 Score = 69.7 bits (169),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query  22   QEHGYASLRAMLD-DESLYKVTEEALFDCGLTSPK-TETQPIPSNSSFQTSGYTLDGPCE  79
            + +    +R M+D D  LY        DCG T PK T   P  +  +  + G    GPCE
Sbjct  47   KSNNIKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCE  100

Query  80   VWLDDTKVAAGRNCHTQFPHGQHE-------IDYSACGDS-CTLWWYWLGIKYVEGAYSW  131
            +WLDD  V    +C + +  G  +       +DYS+C    C   +YWL ++  +    W
Sbjct  101  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLW  160

Query  132  QVYKNCVAL  140
            QVYKNC+ L
Sbjct  161  QVYKNCIPL  169

>PPTG_14221
Length=275

 Score = 69.7 bits (169),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query  18   QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-G  76
            +S    + +  L+ ++DD S+Y        DCG T+P    QPIP++     S   +  G
Sbjct  67   KSLKAANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHG  120

Query  77   PCEVWLDDTKVAAGRNCHTQFPHGQHEI------DYSAC--GDSCTLWWYWLGIKYVEGA  128
            PC +WLDD  V    +C  ++ +   +I      DYS+C  G    + +YWL  + +   
Sbjct  121  PCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKK  180

Query  129  YSWQVYKNCVAL  140
              WQ YK+C+ L
Sbjct  181  TVWQSYKDCIPL  192

>SDRG_17317
Length=122

 Score = 66.6 bits (161),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 52/105 (50%), Gaps = 16/105 (15%)

Query  48   DCGLTSPKTETQPIPSNSSFQ------TSGYTLD--GPCEVWLDDTKVAAGRNCHTQF--  97
            DCG T      + IPS+ +          G+     GPCEVWLDD +V    +C T F  
Sbjct  8    DCGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPA  67

Query  98   -PHGQHEIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             P     IDYS+C GD C L +YWL +        WQVYKNCV L
Sbjct  68   KPAAHLPIDYSSCSGDGCMLRFYWLALH----EPMWQVYKNCVPL  108

>H257_11265
Length=282

 Score = 69.3 bits (168),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 66/136 (49%), Gaps = 16/136 (12%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            + +I     +++  +ASLRA +D +           +CGLT      + +PS+S  +   
Sbjct  65   DNTIAFTRQLKKSSFASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAH  118

Query  69   -TSGYTL--DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYV  125
             + G+ L  +GPCE+W D T+V    NC    P G   I+ S C  S  L   WL +   
Sbjct  119  GSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS  178

Query  126  EGAYSWQVYKNCVALS  141
            +    WQVYKNCV L+
Sbjct  179  Q----WQVYKNCVRLT  190

>SPRG_07797
Length=318

 Score = 69.7 bits (169),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 59/123 (48%), Gaps = 15/123 (12%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GY--TLDGPCEVW  81
            + +L+A LD          +  DCG+T      QP+PS   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQGPCELW  128

Query  82   LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
             D+ +V    NC   +P+G   ID S C  +  L   WL +   +    WQVYKNCV LS
Sbjct  129  CDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ----WQVYKNCVNLS  184

Query  142  KTA  144
              A
Sbjct  185  GAA  187

>PHALS_03177
Length=259

 Score = 68.6 bits (166),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query  14   SIEA-QSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGY  72
            S++A QS    + +  L+ ++D+  L +       DCG + P  + QPIP +     S  
Sbjct  62   SVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRA  114

Query  73   TL-DGPCEVWLDDTKVAAGRNCHTQFPH------GQHEIDYSAC--GDSCTLWWYWLGIK  123
             +  GPCE+WLD+ KV    +C++++ +          +DYS+C  G    + +YWL  +
Sbjct  115  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  174

Query  124  YVEGAYSWQVYKNCVAL  140
             + G   WQ YK C+ L
Sbjct  175  GINGKTFWQSYKMCIPL  191

>PHYCA_15125
Length=334

 Score = 69.3 bits (168),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 61/118 (52%), Gaps = 9/118 (8%)

Query  24   HGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWL  82
             GY SL A +  ++ LY    +   DCGLT  K   +     S  + SG+T  GPCEVW 
Sbjct  114  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPCEVWC  171

Query  83   DDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            DDTKV    +C T++P    ++ Y  S C ++  L  YW+G+        WQVY +CV
Sbjct  172  DDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLH----GDPWQVYTDCV  225

>PHYKE_7717
Length=568

 Score = 69.3 bits (168),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)

Query  97   FPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
            FP   + IDYSAC  +CTL WYWLG+++++ AYSWQVYK C+ L+
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>PPTG_03153
Length=314

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 12/127 (9%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---QTSGYTL--D  75
             +   Y SL+A++DD++   +   A   CG+  PK   QP+P+   +   ++ G+T   +
Sbjct  70   FESSKYKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHE  128

Query  76   GPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQV  133
            GPCEVW D  +V    NC   +     E+ Y  S C  +  L  YW+ +       SWQV
Sbjct  129  GPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMH----GPSWQV  184

Query  134  YKNCVAL  140
            Y NC  L
Sbjct  185  YVNCAPL  191

>PPTG_06253
Length=303

 Score = 68.9 bits (167),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 67/133 (50%), Gaps = 10/133 (8%)

Query  10   GVNTSIEA-QSWMQEHGYASLRAML-DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF  67
            GVN ++   ++     GY SL A +  ++ LY    +   DCGLT  K   +     S  
Sbjct  62   GVNGTLNFFKATFPTKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASQL  119

Query  68   QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYV  125
            + +G+T  GPCEVW DDTKV    +C T++P    +I Y  S C ++  L  YWL +   
Sbjct  120  EYTGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLALH--  177

Query  126  EGAYSWQVYKNCV  138
                 WQVY +CV
Sbjct  178  --GDPWQVYTDCV  188

>PHYKE_1913
Length=280

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 17/105 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T    + +P+PS+           G+T  GPCEV+++D  V  G +C  ++P G   
Sbjct  86   CGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHGDDCEDEYPGGPDG  145

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                 +  IDYS+C   CTL  YWL  +  +    WQ Y NCV L
Sbjct  146  SNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PHYRA_86241
Length=195

 Score = 67.0 bits (162),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 21/126 (17%)

Query  23   EHGYAS-LRAMLD-DESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDGPC  78
            E GYA+ +R +LD D SLY        DCG + P  + +  PS+  ++F+  G    GPC
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFE-RGLAHHGPC  126

Query  79   EVWLDDTKVAAGRNCHTQFPHGQH--------EIDYSACGDS-CTLWWYWLGIK-YVEGA  128
            E+WLDDT V    +C   F    +         IDYS+C  S C   +YWL  +    G 
Sbjct  127  EIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  129  YSWQVY  134
            Y WQ+Y
Sbjct  187  YVWQIY  192

>PPTG_07520
Length=294

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 17/105 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQF---PHG  100
            CG T    + QPIP++        +  G+T  GPCE++LDD  V  G +C  +F   P+G
Sbjct  84   CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  143

Query  101  QHE-----IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +     +D+S+C   C L  YWL  +  +    WQ Y NCV L
Sbjct  144  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PPTG_07516
Length=294

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 17/105 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQF---PHG  100
            CG T    + QPIP++        +  G+T  GPCE++LDD  V  G +C  +F   P+G
Sbjct  84   CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  143

Query  101  QHE-----IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
              +     +D+S+C   C L  YWL  +  +    WQ Y NCV L
Sbjct  144  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYKE_6002
Length=197

 Score = 67.0 bits (162),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 18/123 (15%)

Query  19   SWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDG  76
            S  + + +  L+ ++DD S+Y        DCG T P    QPIPS+  ++F  +   + G
Sbjct  68   SLKKANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHV-G  120

Query  77   PCEVWLDDTKVAAGRNCHTQ--FPHGQHEIDYSAC--GDSCTLWWYWLGIKYVEGAYSWQ  132
            PCE+WLD TK  +  NC     FP     +DYS+C  G    + +YWL  + ++    WQ
Sbjct  121  PCEIWLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQ  175

Query  133  VYK  135
             Y+
Sbjct  176  SYR  178

>PYAP_18713
Length=184

 Score = 66.6 bits (161),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 18/125 (14%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTL-DGPCEV  80
            ++ G+  LR+ L+D+            CG T+P  + + +PS+S    S   +  GPCE+
Sbjct  68   KDKGFKDLRSFLEDKGPA---------CGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCEL  118

Query  81   WLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
            W+DDT V    +C  +F  G+      +D+S+C   C L +YWLG++  +    WQ Y  
Sbjct  119  WIDDTMVYHNDDCELEF--GKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSYST  174

Query  137  CVALS  141
             +A S
Sbjct  175  YIAES  179

>PHYCA_18729
Length=391

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 60/127 (47%), Gaps = 17/127 (13%)

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ--TSGYTLDGP  77
            W  ++  ASL+  +            + +CG T  K   Q +PS+   Q  T G +  GP
Sbjct  69   WFTKNNVASLKEYITTYGT------GISECGNTEKKGTAQSVPSDGYAQHDTLGNSHPGP  122

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W DDT+V    NC T F  GQ      ID S C  S    +YWL +     A  WQV
Sbjct  123  CEIWCDDTRVFHDTNCVTTF-SGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQV  177

Query  134  YKNCVAL  140
            Y NCVAL
Sbjct  178  YINCVAL  184

>PHYRA_80750
Length=275

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 15/121 (12%)

Query  24   HGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLD-GPCEVWL  82
            + +  L+ ++DD + +        DCG T P    QPIPS+     S   +  GPCE+WL
Sbjct  73   NNFVDLKTLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  83   DDTKVAAGRNCHTQFPHGQHEI------DYSAC-GDSCT-LWWYWLGIKYVEGAYSWQVY  134
            DD KV    +C + + +   +I      DYS C G  C  + +YWL  + V+G   WQ Y
Sbjct  127  DDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  135  K  135
             
Sbjct  187  N  187

>PPTG_03156
Length=445

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 12/122 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSF---QTSGYTL--DGPCEV  80
            Y SL+A +DD++   VT  A   CG   P    QP+P    +   ++ G+T   +GPCE 
Sbjct  76   YKSLKAFIDDKAKITVTG-ATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEA  134

Query  81   WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            W D  +V    NC   F     E+ Y  S C  + TL +YW+ +       +WQVY NC 
Sbjct  135  WCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMH----GPTWQVYVNCA  190

Query  139  AL  140
             L
Sbjct  191  PL  192

>SPRG_22161
Length=300

 Score = 68.2 bits (165),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 65/141 (46%), Gaps = 30/141 (21%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            N + +AQ+      + +LR MLD +           DCG T      + IP+N       
Sbjct  64   NKAFKAQTQ-----FKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQN  109

Query  69   ---TSGYTLD--GPCEVWLDDTKVAAGRNCHTQF---PHGQHEIDYSACG-DSCTLWWYW  119
                 G+     GPCEVW+D+ +V    +C T F   P     +DYS+CG + C L +YW
Sbjct  110  PDTGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYW  169

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            L +        WQVYKNCV L
Sbjct  170  LALH----EPMWQVYKNCVPL  186

>PHYKE_2379
Length=285

 Score = 67.8 bits (164),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 17/130 (13%)

Query  20   WMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN--SSFQTSGYTLDGP  77
            W  ++G +SL+  +   + Y      + +CG T      + IPS+  +   T G +  GP
Sbjct  70   WFTKNGISSLKEYI---TTYGTN---ISECGNTLKDGTAEAIPSDGYAEHDTLGNSHPGP  123

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQH----EIDYSACGDSCTLWWYWLGIKYVEGAYSWQV  133
            CE+W DDT+V    NC T+F  GQ      ID S C  S    +YWL +     A  WQV
Sbjct  124  CEIWCDDTRVFNNTNCVTEF-SGQSPAKIPIDVSTCKASSEFVFYWLALH----AQPWQV  178

Query  134  YKNCVALSKT  143
            Y NCVAL  T
Sbjct  179  YINCVALDGT  188

>SDRG_08782
Length=450

 Score = 68.6 bits (166),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 48/141 (34%), Positives = 65/141 (46%), Gaps = 30/141 (21%)

Query  12   NTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQ---  68
            N + +AQS      + +LR MLD             DCG T    + + IP N       
Sbjct  63   NKAFKAQS-----QFKTLRDMLDPHGP---------DCGYTLTNVDKKAIPGNGQMTWKN  108

Query  69   ---TSGY--TLDGPCEVWLDDTKVAAGRNCHTQFPHGQH---EIDYSACG-DSCTLWWYW  119
                 G+  +  GPCEVW+D+ +V    +C T FP        +DYS+CG + C L +YW
Sbjct  109  PDTGEGFIPSHKGPCEVWIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYW  168

Query  120  LGIKYVEGAYSWQVYKNCVAL  140
            L +        WQVYKNCV L
Sbjct  169  LALH----EPMWQVYKNCVPL  185

>PYAP_18138
Length=268

 Score = 67.4 bits (163),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 16/118 (14%)

Query  22   QEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP-SNSSFQTSGYTLDGPCEV  80
            ++HG   LR+ +D     K+TE     CG +      +PIP +N+       T  GPCE 
Sbjct  80   KQHGVKDLRSYID----AKITE-----CGDSLKDVSPKPIPKTNTVTFERALTHKGPCEF  130

Query  81   WLDDTKVAAGRNCHTQFPHGQH-EIDYSAC-GDSCTLWWYWLGIKYVEGAYSWQVYKN  136
            W+DDT+V    +C   F       +DYS C G +C L +YWLG++  +    WQVY+N
Sbjct  131  WIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQNSD----WQVYRN  184

>SDRG_16534
Length=320

 Score = 67.8 bits (164),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTS--GY--TLDGPCEVW  81
            + +L+A LD             DCG+T      QP+PS   +     G+  +  GPCE+W
Sbjct  76   FKTLKAFLD-------AYPTGGDCGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELW  128

Query  82   LDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
             D+T+V    NC    P G   ID S C  +  L   WL +   E    WQVYKNCV LS
Sbjct  129  CDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

Query  142  KTA  144
              A
Sbjct  185  GVA  187

>PYVX_22508
Length=298

 Score = 67.8 bits (164),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 12/126 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y SL+ M+ D      T      CGLT P    Q +P      +   T G+T   +GPCE
Sbjct  63   YTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASHEGPCE  122

Query  80   VWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            +W DDT+V    +C   +     ++  D  AC  +  L +YWL +     + +WQVY NC
Sbjct  123  IWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH----SSTWQVYINC  178

Query  138  VALSKT  143
             AL +T
Sbjct  179  AALEET  184

>PPTG_03160
Length=379

 Score = 68.2 bits (165),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 13/126 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPCE  79
            Y SL+  + D++   V+  A   CG   PK E QP+P +    S   + G+T   +GPCE
Sbjct  76   YKSLKEYVTDKAKIIVSG-ATLTCGSCDPKQEPQPMPKSTVEWSHSDSEGFTPSHEGPCE  134

Query  80   VWLDDTKVAAGRNC--HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNC  137
            VW DD +     +C  H      +   D  AC  + TL +YW+ +     + SWQVY NC
Sbjct  135  VWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAMH----SSSWQVYVNC  190

Query  138  VALSKT  143
              L+KT
Sbjct  191  APLAKT  196

>PPTG_03138
Length=294

 Score = 67.4 bits (163),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 13/131 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
             +   ++SL+ ++++++   V++ A   CG   P    QP+P      +   + G+T   
Sbjct  73   FESSSFSSLKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
            +GPCE+W DD +V  G +C   +     ++  D+ AC  S  L +YWL +     + +WQ
Sbjct  132  EGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLALH----SSTWQ  187

Query  133  VYKNCVALSKT  143
            VY NC  L  T
Sbjct  188  VYVNCAPLEST  198

>PYU1_G001527
Length=278

 Score = 67.4 bits (163),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 18/126 (14%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTSGYTLDGP  77
            Y S+RA++D + +++       +CG+TSP  E QP+P        SNS   T  +T  GP
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  138

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CEVW D+    +  NC T +P    ++  D S C     L +YWL +     + +WQ Y 
Sbjct  139  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  194

Query  136  NCVALS  141
             C  L+
Sbjct  195  ACAPLA  200

>PYU1_G001523
Length=278

 Score = 67.4 bits (163),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 18/126 (14%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTSGYTLDGP  77
            Y S+RA++D + +++       +CG+TSP  E QP+P        SNS   T  +T  GP
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  138

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CEVW D+    +  NC T +P    ++  D S C     L +YWL +     + +WQ Y 
Sbjct  139  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  194

Query  136  NCVALS  141
             C  L+
Sbjct  195  ACAPLA  200

>PYAP_19712
Length=276

 Score = 67.4 bits (163),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query  49   CGLTSPKTETQPIPSNSSFQ---TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEID  105
            CG T P    QPIP++   Q   T+ +   GPCE+WLD   VA+ + C  ++P  + ++D
Sbjct  72   CGKTDPNGAVQPIPADGYVQLQITAAHI--GPCELWLDGEMVASAKQCVKEYPDRKIKVD  129

Query  106  YSACGDS-CTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
            +S C  S C L W WL          W++Y NCV +
Sbjct  130  FSKCKSSKCQLRWVWLATHN----SPWEIYDNCVTV  161

>PHYCA_19612
Length=610

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 65/131 (50%), Gaps = 13/131 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
             +   Y+SL+ +++D++   VT+ A   CG   P    Q +P+     +   + G+T   
Sbjct  378  FESSSYSSLKELINDKATITVTD-ATLTCGACDPDETAQALPATYVEWAHSDSEGFTASH  436

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
            +GPCEVW DD +V  G +C   +      +  D+ AC  S  L +YWL +     + +WQ
Sbjct  437  EGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH----SSTWQ  492

Query  133  VYKNCVALSKT  143
            VY NC  L  T
Sbjct  493  VYVNCAPLEST  503

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 61/127 (48%), Gaps = 13/127 (10%)

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--DGPC  78
             Y SL+ ++   +   VT+ A   CG  +P    QP+P      S   T G+T   +GPC
Sbjct  80   SYTSLKDLITSLATVTVTD-ATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPC  138

Query  79   EVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKN  136
            EVW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQVY N
Sbjct  139  EVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYVN  194

Query  137  CVALSKT  143
            C  L  T
Sbjct  195  CAPLEST  201

>PHYRA_83494
Length=224

 Score = 66.6 bits (161),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 49/106 (46%), Gaps = 17/106 (16%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T      Q +P++   +       G+T  GPCE+++DD  V  G NC   +P G   
Sbjct  23   CGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDVG  82

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                    +DYS+C   CT   YWL  +  +    WQ Y NCV L+
Sbjct  83   STVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLT  124

>PITG_11937
Length=305

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 53/107 (50%), Gaps = 11/107 (10%)

Query  41   VTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEVWLDDTKVAAGRNCHT  95
            V   A   CGLT P    QP+P     +   T G+T   +GPCE W DDT+V    NC  
Sbjct  86   VATGANLQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCDDTQVFQDTNCAA  145

Query  96   QFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             F     ++ Y  +AC  +  L +YWL +     + +WQVY NC AL
Sbjct  146  HFTTAPAKLPYNKAACSGASRLAFYWLALH----SSTWQVYANCAAL  188

>PHYKE_6078
Length=317

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 15/132 (11%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTL--  74
             +   Y+SL+  ++D++   VT+ A   CG   P    Q +P      +   + G+T   
Sbjct  73   FESSSYSSLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASH  131

Query  75   DGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSW  131
            +GPCEVW DDT+V    +C   +T  P  Q   D+ AC  S T+  YWL +     + +W
Sbjct  132  EGPCEVWCDDTRVFQDDDCAADYTTAP-AQLPFDHDACLGSSTVTLYWLALH----SSTW  186

Query  132  QVYKNCVALSKT  143
            QVY NC  L  T
Sbjct  187  QVYVNCAPLETT  198

>PHYCA_123316
Length=316

 Score = 67.4 bits (163),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 12/122 (10%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEV  80
            Y+S++  + D+    V   A  +CGLT P    Q +P+    +   T G+T   +GPCE 
Sbjct  78   YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  136

Query  81   WLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCV  138
            W DDT+V    NC   F     ++ Y  + C  S  L +YWL +     + +WQ+Y NC 
Sbjct  137  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH----SSTWQIYVNCA  192

Query  139  AL  140
            AL
Sbjct  193  AL  194

>HYAP_11923
Length=606

 Score = 67.8 bits (164),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 53/107 (50%), Gaps = 11/107 (10%)

Query  41   VTEEALFDCGLTSPKTETQPIPSN---SSFQTSGYTL--DGPCEVWLDDTKVAAGRNCHT  95
            V + A  +CGLT P    QPIP     S   T G+T   +GPCE W DDT+V    NC  
Sbjct  93   VAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCDDTQVFQDENCAA  152

Query  96   QFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
             F     ++ Y  + C  +    +YWL +     + +WQVY NC AL
Sbjct  153  HFTTAPAKMPYDKAKCSGASRFTFYWLALH----SSTWQVYVNCAAL  195

>PHYKE_5749
Length=300

 Score = 67.0 bits (162),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 49/105 (47%), Gaps = 17/105 (16%)

Query  49   CGLTSPKTETQPIPSNSSF-----QTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHG---  100
            CG T P  + QPIPS+        +  G+T  GPCE++LDD  V    +C  +F  G   
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  101  -----QHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVAL  140
                    +DYS+C   C    YWL  +  +    WQ Y NCV L
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PHYSO_525076
Length=366

 Score = 67.4 bits (163),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP------SNSSFQTSGYTL  74
             +   Y SL+ +++D++   VT+ A   CG   P    QP+P      S+SS +    + 
Sbjct  74   FEASSYTSLKELINDKATITVTD-ATLTCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSH  132

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDY--SACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCEVW DD +V    +C   +     E+ Y   AC  + TL +YWL +     + +WQ
Sbjct  133  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQ  188

Query  133  VYKNCVAL  140
            VY NC  L
Sbjct  189  VYINCAPL  196

>PPTG_18166
Length=445

 Score = 67.4 bits (163),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 52/106 (49%), Gaps = 17/106 (16%)

Query  49   CGLTSPKTETQPIPSNSSFQ-----TSGYTLDGPCEVWLDDTKVAAGRNCHTQFP-----  98
            CG T      +PIPS+   +       G+T  GPCE++LDD  V  G +C  ++P     
Sbjct  84   CGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDG  143

Query  99   ---HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  141
                 +  +D+S+C   CTL  YWL  +  +    WQ Y NCV LS
Sbjct  144  SSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ----WQTYVNCVPLS  185

>PYU1_G001526
Length=334

 Score = 67.0 bits (162),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 18/126 (14%)

Query  26   YASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP--------SNSSFQTSGYTLDGP  77
            Y S+RA++D + +++       +CG+TSP  E QP+P        SNS   T  +T  GP
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHT--GP  138

Query  78   CEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSWQVYK  135
            CEVW D+    +  NC T +P    ++  D S C     L +YWL +     + +WQ Y 
Sbjct  139  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  194

Query  136  NCVALS  141
             C  L+
Sbjct  195  ACAPLA  200

>PYIW_15526
Length=256

 Score = 66.2 bits (160),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS--FQTSGY------TLDG  76
            GY SL+ MLD         +++  CG T+P      +    S  +Q + Y      +  G
Sbjct  76   GYTSLKEMLD---------KSVSGCGYTNPNAAPVDVSGLKSMKYQNNEYKEGFLGSHRG  126

Query  77   PCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
            PCE W+D+TK+    +C   +P       +DYS C  +C L +YWL +   +    WQVY
Sbjct  127  PCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQVY  182

Query  135  KNCVAL  140
            K CVA+
Sbjct  183  KGCVAI  188

>PYVX_24563
Length=254

 Score = 66.2 bits (160),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 65/135 (48%), Gaps = 35/135 (26%)

Query  25   GYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSNSS-------------FQTSG  71
            GY SLRAM+D         E++ DCG T  +T+  P+                  F +S 
Sbjct  77   GYTSLRAMID---------ESVSDCGNT--RTDVSPVDMTGKKVLHWQNDQEGVGFVSSH  125

Query  72   YTLDGPCEVWLDDTKVAAGRNC---HTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGA  128
            +   GPCEVW+DD  V    +C   +T +P    + D+S C  SCTL +YWL +      
Sbjct  126  H---GPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLRFYWLALH----E  177

Query  129  YSWQVYKNCVALSKT  143
             +WQ+YK C  ++ +
Sbjct  178  PNWQIYKQCAPITNS  192

>PYIR_22134
Length=300

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 14/128 (11%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPSN----SSFQTSGYTLD-  75
            ++   Y S+RA+++ + ++     A  +CG+TS     QP+P+     S   + G+T   
Sbjct  81   LKASTYDSVRALVEAKGVF--ISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSH  138

Query  76   -GPCEVWLDDTKVAAGRNCHTQFPHGQHE--IDYSACGDSCTLWWYWLGIKYVEGAYSWQ  132
             GPCEVW D+ KV +  NC   +P    E  ID++ C  +  L   WL +     + +WQ
Sbjct  139  QGPCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH----SSTWQ  194

Query  133  VYKNCVAL  140
            +Y NC  L
Sbjct  195  IYINCAPL  202

>PYAP_22462
Length=210

 Score = 64.7 bits (156),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 68/140 (49%), Gaps = 29/140 (21%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP----SNSSFQT----SGY  72
             +  G++SLRA+LD          A   CG  + +T+  P+     S   FQ      G+
Sbjct  81   FRAGGFSSLRALLD---------PAAPGCG--NSRTDVAPVDVSGLSVMQFQNDEEGKGF  129

Query  73   TLD--GPCEVWLDDTKVAAGRNCHTQFP--HGQHEIDYSAC--GDSCTLWWYWLGIKYVE  126
                 GPCE W+D+T+V  G +C  QF        I+Y+AC  G +C L +YWL +    
Sbjct  130  ITSHHGPCEAWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLALHEA-  188

Query  127  GAYSWQVYKNCVALSKTATA  146
               +WQVYK CV + +  +A
Sbjct  189  ---NWQVYKQCVPIKRGGSA  205

>PHYKE_6076
Length=272

 Score = 65.5 bits (158),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  21   MQEHGYASLRAMLDDESLYKVTEEA-LFDCGLTSPKTETQPIPSN----SSFQTSGYTL-  74
             +   Y+SL+ ++ D  L K+T  +   +CG T+P    QP+P      +   + G+T  
Sbjct  73   FESSKYSSLKELVTD--LGKLTSTSYTTECGYTNPDETAQPLPDTYVEWAHSDSEGFTPS  130

Query  75   -DGPCEVWLDDTKVAAGRNCHTQFPHGQHEI--DYSACGDSCTLWWYWLGIKYVEGAYSW  131
             +GPCEVW DD +V    +C   +     ++  D+ AC  S  L  YWL +     + +W
Sbjct  131  HEGPCEVWCDDVRVFQDDDCAAHYTTAPAKLPYDHDACLGSSRLTLYWLALH----SSTW  186

Query  132  QVYKNCVALSKT  143
            QVY NC AL  T
Sbjct  187  QVYTNCAALEST  198

>PYU1_G006403
Length=252

 Score = 65.1 bits (157),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 13/127 (10%)

Query  21   MQEHGYASLRAMLDDESLYKVT--EEALFDCGLTS-PKTETQPIPSNSSF---QTSGYTL  74
              E G ASL+ ++ +  +   +  +EA   CG T   + +   +P+   F      G+T 
Sbjct  76   FPESGVASLKDLILENQVMWTSGLDEA---CGYTKLDEAKRSELPTEMKFGNGDVGGFTH  132

Query  75   DGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVY  134
             GPCE+W DDTK++   +C  ++P G   ID S C ++     YWL +     A  WQVY
Sbjct  133  PGPCELWCDDTKLSYDNDCAAKYPSGLVPIDTSKCANANQFTVYWLAVH----ASMWQVY  188

Query  135  KNCVALS  141
             NCV L+
Sbjct  189  TNCVYLT  195

>PYIW_18792
Length=125

 Score = 62.8 bits (151),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 1/78 (1%)

Query  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62
            LA+L+ QG   + +  ++ +  GY +LR  +DD+  YKV +   F+CG +S K   QPIP
Sbjct  46   LAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV-DGGNFECGWSSLKGTPQPIP  104

Query  63   SNSSFQTSGYTLDGPCEV  80
            +  + +++GYT DGP  +
Sbjct  105  AGGALRSTGYTHDGPFGI  122

Lambda      K        H        a         alpha
   0.320    0.132    0.437    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4284931392

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40