Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_3489031475876676633990.0
PPTG_171291475874576426950.0
PHYCA_5114151475874474526840.0
PITG_184581475874774526250.0
PHYRA_810981475874176625520.0
PHYKE_839514758142075024330.0
HYAP_071041475872174422080.0
PHALS_064761475872676921670.0
PYIW_199691475873377215250.0
PYIR_134181475874757815160.0
PYU1_G0017331475873268914950.0
PYAP_177631475879452213584e-176
PYAR_135711475866673713361e-174
PYVX_235901475868977911414e-145
CCI44111147585765128337e-101
CCA22843147585865248339e-101
SPRG_06355147587134585971e-65
SDRG_01763147587364625795e-63
SDRG_045751382110032121615e-10
H310_082921382110072101597e-10
SPRG_126211382110031611454e-08
SDRG_079831335559912211436e-08
SPRG_1903013355510002211401e-07
PYVX_215131382114461771392e-07
H257_117731382110262121382e-07
H257_0193413355510222181356e-07
PYAP_222301382111161411186e-05
PYIR_141071382111764171178e-05
PYAR_14788138217951391104e-04
PYU1_G002110138219994861105e-04
PYIR_233601252822740754.1
PYVX_217761252820340744.4
PITG_0658055211214114764.6
PHYSO_5453781252822443735.6
PYU1_G0122671252821740727.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_348903

Length=767
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_348903                                                          1313       0.0   
PPTG_17129                                                            1042       0.0   
PHYCA_511415                                                          1038       0.0   
PITG_18458                                                            1015       0.0   
PHYRA_81098                                                           987        0.0   
PHYKE_8395                                                            941        0.0   
HYAP_07104                                                            855        0.0   
PHALS_06476                                                           839        0.0   
PYIW_19969                                                            592        0.0   
PYIR_13418                                                            588        0.0   
PYU1_G001733                                                          580        0.0   
PYAP_17763                                                            527        4e-176
PYAR_13571                                                            519        1e-174
PYVX_23590                                                            444        4e-145
CCI44111                                                              325        7e-101
CCA22843                                                              325        9e-101
SPRG_06355                                                            234        1e-65 
SDRG_01763                                                            227        5e-63 
SDRG_04575                                                            66.6       5e-10 
H310_08292                                                            65.9       7e-10 
SPRG_12621                                                            60.5       4e-08 
SDRG_07983                                                            59.7       6e-08 
SPRG_19030                                                            58.5       1e-07 
PYVX_21513                                                            58.2       2e-07 
H257_11773                                                            57.8       2e-07 
H257_01934                                                            56.6       6e-07 
PYAP_22230                                                            50.1       6e-05 
PYIR_14107                                                            49.7       8e-05 
PYAR_14788                                                            47.0       4e-04 
PYU1_G002110                                                          47.0       5e-04 
PYIR_23360                                                            33.5       4.1   
PYVX_21776                                                            33.1       4.4   
PITG_06580                                                            33.9       4.6   
PHYSO_545378                                                          32.7       5.6   
PYU1_G012267                                                          32.3       7.9   

>PHYSO_348903
Length=766

 Score = 1313 bits (3399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 766/766 (100%), Positives = 766/766 (100%), Gaps = 0/766 (0%)

Query  1    MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
            MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT
Sbjct  1    MVGNTMHRIKNKLRSSRLGSSKKDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60

Query  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
            DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ
Sbjct  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120

Query  121  FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlrae  180
            FSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAE
Sbjct  121  FSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAE  180

Query  181  vlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssld  240
            VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLD
Sbjct  181  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLD  240

Query  241  plsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALST  300
            PLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALST
Sbjct  241  PLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALST  300

Query  301  PLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGE  360
            PLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGE
Sbjct  301  PLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGE  360

Query  361  GGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLAR  420
            GGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLAR
Sbjct  361  GGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLAR  420

Query  421  LNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQ  480
            LNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQ
Sbjct  421  LNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQ  480

Query  481  IIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDF  540
            IIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDF
Sbjct  481  IIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDF  540

Query  541  VKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFE  600
            VKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFE
Sbjct  541  VKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFE  600

Query  601  DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVA  660
            DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVA
Sbjct  601  DKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVA  660

Query  661  VRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdg  720
            VRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSSDG
Sbjct  661  VRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGSSSDG  720

Query  721  ttsAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRGTTY  766
            TTSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRGTTY
Sbjct  721  TTSAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRGTTY  766

>PPTG_17129
Length=745

 Score = 1042 bits (2695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/764 (80%), Positives = 677/764 (89%), Gaps = 24/764 (3%)

Query  1    MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
            MVG TM+RIKNKLRSSRL     + AWALDEDSLRLKQ QDD PVR+DRS TL+DTVNVT
Sbjct  1    MVG-TMNRIKNKLRSSRLHKK--EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT  57

Query  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
            DDVE+MFYGR   ST++ +SD+PQYRTTEQ+R  ++TLSALHED E  S  +N+SSSFSQ
Sbjct  58   DDVEEMFYGR---STSNTSSDMPQYRTTEQIRANNMTLSALHEDVEA-SNVSNVSSSFSQ  113

Query  121  FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeeg--elerlr  178
            FS TTPSNYAASTPGNFS+                GF+ + +T G++ A  G  ELERLR
Sbjct  114  FSTTTPSNYAASTPGNFSSTY-------------HGFNTVHSTTGTSRAVSGDFELERLR  160

Query  179  aevlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsss  238
            +EVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGA+AQLTA QHS+PPSVSST+SSS
Sbjct  161  SEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSS  220

Query  239  ldplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDAL  298
             DPLSA++RA L RQTSTKTS ATR+RLAASR N+ KTPPP ARASVRLTQLAPVAD+AL
Sbjct  221  SDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNAL  280

Query  299  STPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVV  358
            STPL+ QQINEMFPLIDFTSELAAHARGLTPG+RTWALTRVEEWLD+RFN G+D LLAVV
Sbjct  281  STPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVV  340

Query  359  GEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQL  418
            GEGGTGKSAFCGTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VDN P FKNQL
Sbjct  341  GEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQL  400

Query  419  ARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFF  478
            ARLNLKYVLEEADP LLA KVLVDPLNA+EEP+ A FM+VDGIDQCAAG  GRNELLEFF
Sbjct  401  ARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFF  460

Query  479  AQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDD  538
            AQ+IPQLP+WVGFL+SSKPSSKLAKRLPVSSVLDFSA+N AFVADV+ +V+DIARNFSDD
Sbjct  461  AQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDD  520

Query  539  DFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEI  598
            D  +AK +LK+KSGGNFAYLEFTKQALSHPGMAAASKEGAVPL VL++LPETLYDIYAEI
Sbjct  521  DTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEI  580

Query  599  FEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDL  658
            FEDKFGQGRARVWGKAKPLLQL+VGAA+GPYSP+TEEQA+EHF  TAEDLRMLRRSFVDL
Sbjct  581  FEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDL  640

Query  659  VAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsss  718
            VAV+HG+YRIESSALCAWLSDPARSEEQFYFSIDDALQALR+MRR  SSGSSSGHSGSSS
Sbjct  641  VAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRRVSSSGSSSGHSGSSS  700

Query  719  dgttsAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKR  762
            DG  +    SR   + ++K+H R+H +HEPRANPD+KPVGILKR
Sbjct  701  DGKATHRASSRV--KTSSKTHQRAHTRHEPRANPDFKPVGILKR  742

>PHYCA_511415
Length=744

 Score = 1038 bits (2684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/745 (79%), Positives = 637/745 (86%), Gaps = 24/745 (3%)

Query  24   DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRN-NRSTASAASDV  82
            + AWALDEDSLRLKQ QDDA VR+DRS TL+DTVNVTDDVE+MFYGRN NRST   AS++
Sbjct  17   EGAWALDEDSLRLKQQQDDA-VRFDRSTTLADTVNVTDDVEEMFYGRNTNRSTT--ASEM  73

Query  83   PQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPgnfsnhng  142
            PQYRTTEQ+R  +LTLSALHE+A TPSA+N  SS  SQFS TTPSNYAASTPGN  N+  
Sbjct  74   PQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSF-SQFSATTPSNYAASTPGNVGNNTY  132

Query  143  qnnntnqsttfARGFSAIPTTVGSavaeeg--elerlraevlevkeevkaIRREVMNELH  200
                         GFS+   T G++       ELERLR+EVLEVKEEVKAIRREVMNELH
Sbjct  133  ------------HGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAIRREVMNELH  180

Query  201  VTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKLVRQTSTKTSP  260
            VTRYDVLKEL LLKGA+AQLTAAQHSSP   S+  SSS    + + RA L RQTSTKTS 
Sbjct  181  VTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSAEE-RAALTRQTSTKTSA  239

Query  261  ATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSEL  320
            ATR+RLAASR NV KTPPP ARASVRLTQLAPVAD+ALSTPL+SQQINEMFPLIDFTS+L
Sbjct  240  ATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINEMFPLIDFTSDL  299

Query  321  AAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNM  380
            AAHARGLTPGSRTWALTRVEEWLD+RFN G+D LLAVVGEGGTGKSAF GTVAQQFRGN+
Sbjct  300  AAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGNL  359

Query  381  LAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVL  440
            LAAHCCQFDRKSKS+PRNVLLSMVHQ+VDN P FKNQLARLNLKYVLEEADP+LLA KVL
Sbjct  360  LAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKVL  419

Query  441  VDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFllsskpssk  500
            VDPLNA+EEPV A FM+VDGIDQC+AG  GRNELL+FFAQ+IPQLP+W+GFL+SSKPSSK
Sbjct  420  VDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSSK  479

Query  501  lakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEF  560
            LAKRLPVSSVLDFSA+N AFVADV+ LV+DIARNFSDDD  +AK +LK KSGGNFAYLEF
Sbjct  480  LAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEF  539

Query  561  TKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  620
            TKQALSHPGM A SKEGAVPLGVL++LPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL
Sbjct  540  TKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQL  599

Query  621  VVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDP  680
            VVGAASGPYSPVTEEQA+EHF LTAEDLRMLRRSFVDLVAV+HGSYRIESSALCAWLSDP
Sbjct  600  VVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIESSALCAWLSDP  659

Query  681  ARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdgttsAPTLSRTTSR--GATKS  738
            ARSEEQFYFSIDDAL ALR+MRR+ SS   S    SS    T   T SR +SR   ++KS
Sbjct  660  ARSEEQFYFSIDDALHALRKMRRNVSSSGHSHSGSSSDSSATHH-TSSRASSRVTASSKS  718

Query  739  HHRSHVKHEPRANPDYKPVGILKRG  763
              RSH +HEPR NP  KPVGILKRG
Sbjct  719  QQRSHTRHEPRTNPG-KPVGILKRG  742

>PITG_18458
Length=747

 Score = 1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/745 (77%), Positives = 640/745 (86%), Gaps = 23/745 (3%)

Query  24   DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNNRSTASAASDVP  83
            + AWALDEDSLRLKQ QDD PVR+DRS TL+DTVNVTDDVE+MFYGR   ST++ +SD+P
Sbjct  17   EGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVTDDVEEMFYGR---STSNTSSDMP  73

Query  84   QYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPgnfsnhngq  143
            QYRTTEQLR  ++TLSALHED E  S  +N+SSSFSQFS TTPSNYAASTPG F++ +  
Sbjct  74   QYRTTEQLRGNNITLSALHEDVEA-SNVSNVSSSFSQFSATTPSNYAASTPGKFTSTH--  130

Query  144  nnntnqsttfARGFSAIPTTVGSavaeeg--elerlraevlevkeevkaIRREVMNELHV  201
                       +G +   TT G + A  G  ELERLR+EVLEVKEEVKAIRREVMNELHV
Sbjct  131  -----------QGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHV  179

Query  202  TRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKLVRQTSTKTSPA  261
            TRYDVLKELALLKGA+AQLTA QH +P SVSST+SSS DPLS D+RA L RQTSTKTS A
Sbjct  180  TRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTSTKTSQA  239

Query  262  TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  321
            TR+RLAASR N+ KTPPP ARASVRLTQLAPVAD+ALSTPL  QQINEMFPLID TSELA
Sbjct  240  TRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDSTSELA  299

Query  322  AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  381
            AHARGLTPG+RTWALTRVEEWLD+R+N G+D LLAVVGEGGTGKS FCGTVAQQFRGN+L
Sbjct  300  AHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQFRGNLL  359

Query  382  AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  441
            AAHCCQFDRKSKS+PRNVLLSMVHQ+VD+ P FKNQLARLNLKYVLEEADP LLA KVLV
Sbjct  360  AAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLLAGKVLV  419

Query  442  DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFllsskpsskl  501
            DPLNA+EEP+ A F++VDGIDQCA G+ GRNELLE FAQ+IPQLP+WVGFL+SSKPSSKL
Sbjct  420  DPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVGFLVSSKPSSKL  479

Query  502  akrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  561
            AKRLPVSSVLDFSA+N AFVAD + LV+DIARNFSDDD  +AK +LK+KSGGNFAYLEFT
Sbjct  480  AKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGGNFAYLEFT  539

Query  562  KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  621
            KQALSHPG+AAASKEGAVPL VL++LPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV
Sbjct  540  KQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  599

Query  622  VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  681
            VGAA+GPYSPVTEEQA+EHFNLT EDLRMLRRSFVDLV+V+HGSYRIESSALCAWLSDPA
Sbjct  600  VGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSALCAWLSDPA  659

Query  682  RSEEQFYFSIDDALQALRQMRRs--gssgsssghsgsssdgttsAPTLSRTTSRGAT--K  737
            RSEEQFYFS+DDAL ALR++RR    SS S    + S      +    SR ++R  T  K
Sbjct  660  RSEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGHASSRPSNRVKTSSK  719

Query  738  SHHRSHVKHEPRANPDYKPVGILKR  762
            +H R+H ++EPR +PDYKPVGILKR
Sbjct  720  THQRAHTRYEPRTSPDYKPVGILKR  744

>PHYRA_81098
Length=741

 Score = 987 bits (2552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/766 (73%), Positives = 623/766 (81%), Gaps = 32/766 (4%)

Query  1    MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
            MVG TMHR+KNKLR  +      DA WALDEDSLRLKQ QDDA +R DRS TL+DTVNVT
Sbjct  1    MVG-TMHRLKNKLRLHKK-----DANWALDEDSLRLKQTQDDA-LRLDRSTTLTDTVNVT  53

Query  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
            DDVE+MFYG   RST S   DVPQYRTTEQLR TH+TLSALHEDAE  +A+++ S     
Sbjct  54   DDVEEMFYG--GRSTVS---DVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQF---  105

Query  121  FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlrae  180
             S TTPSNYAASTPG+  N                 FS   +T  +              
Sbjct  106  -SATTPSNYAASTPGHVPNQGAY-----------HDFSTAHSTTRAISDAFELERLRSEV  153

Query  181  vlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssld  240
            V   +E    IRREVMNELHVTRYDVLKELALLKGA+AQL A QH SP +  S+  SS  
Sbjct  154  VEVKEEVKA-IRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSS  212

Query  241  p-lsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALS  299
              LSAD+RA L RQTSTKTS ATRERLAASRAN+ KTPPP ARASVRLTQLAPVAD+ALS
Sbjct  213  DPLSADERAALTRQTSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALS  272

Query  300  TPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVG  359
            TPLT QQIN+MFPLIDFTSELAAHAR LTPGSRTWALTRVEEWLD+RFN G D LLAVVG
Sbjct  273  TPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVG  332

Query  360  EGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLA  419
            EGGTGKSAF GTVAQQFRGN+LAAHCCQFDRKSKS+PRNVLLSMVHQ+VD+ PPFKNQLA
Sbjct  333  EGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLA  392

Query  420  RLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFA  479
            RLNLKYVLEEADP +LA KVLVDPLNA+EEP+ A FM+VDGIDQC+AG +GRNELLEFFA
Sbjct  393  RLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFA  452

Query  480  QIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDD  539
            Q+IP LP+WVGF++SSKPSSKLAKRLPVSSVLDFSA+N AFV+DV+ LVED+ARNFSD+D
Sbjct  453  QVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDND  512

Query  540  FVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIF  599
              +AK +LKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPL VL++LPETLYDIYAEIF
Sbjct  513  AAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIF  572

Query  600  EDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLV  659
            EDKFGQGRARVWGKAKPLLQL+VGAA+GPYS VTEEQA++HFNLTAEDLRMLR SFVDLV
Sbjct  573  EDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLV  632

Query  660  AVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssd  719
            AVRHG+YRIESSALC WLSDPARSEEQFYF+IDDA+QALR MRRS SS S S    S   
Sbjct  633  AVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQALRSMRRSVSSSSHSNSGSSDDS  692

Query  720  --gttsAPTLSRTTSRGAT-KSHHRSHVKHEPRANPDYKPVGILKR  762
               +    T SR +SR  T KS+ R+H +H+PRA  ++KPVGILKR
Sbjct  693  PPTSRRGHTSSRASSRVTTSKSNQRAHTRHDPRATQEFKPVGILKR  738

>PHYKE_8395
Length=1420

 Score = 941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/750 (70%), Positives = 612/750 (82%), Gaps = 28/750 (4%)

Query  24    DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNN-RSTASAASDV  82
             + AWALDEDSLRL + Q DA  R+DR+  ++DTVNV+DDVEDMFYGR+  +S  S  SDV
Sbjct  687   EGAWALDEDSLRLNKQQQDAD-RFDRNTAMTDTVNVSDDVEDMFYGRSTTQSQLSNTSDV  745

Query  83    PQYRTTEQLRDTHLTLSALHED-AETPSATNNLSSSFSQFSVTTPSNYAASTPgnfsnhn  141
             P YRTTEQ+R T+ TL+ALHE+ A TPSA++ LS+SF+    +TP NY  + P     + 
Sbjct  746   PSYRTTEQMRGTNSTLTALHEEEAMTPSASH-LSNSFASSYASTPGNYQ-NPPTFNGFNT  803

Query  142   gqnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaIRREVMNELHV  201
               +             + +  T+        E+ RLRAE+ EVK EV+ IRREVMNELH+
Sbjct  804   THS-------------TGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIRREVMNELHM  850

Query  202   TRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKLVRQTSTKTSPA  261
             TRYDVLKEL LLKGAVAQL+AAQ  +  SVS + SSS DPLSA+DRA L R  S  TS  
Sbjct  851   TRYDVLKELTLLKGAVAQLSAAQ--TTGSVSPSTSSSSDPLSAEDRAALTRVPSKLTSKT  908

Query  262   TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  321
             T++RLA SR N+   PPP ARASVRLTQLAPVAD+ALSTPL  QQINEMFPLIDFTSELA
Sbjct  909   TKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLIDFTSELA  968

Query  322   AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  381
             AHARGL PG+RTWALTRVEEWLD+RFN G+D +LAVVG+GGTGKSAFCGTVAQQFRGN+L
Sbjct  969   AHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLL  1028

Query  382   AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  441
             AAHCCQFDRKSKSTPRNVLLS VHQ+VDN PPFKNQLARLNLKYVLEE+DP LLAAKV V
Sbjct  1029  AAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEESDPFLLAAKVFV  1088

Query  442   DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFllsskpsskl  501
             DPLNA+EEP+ A FM+V+G+DQC+AG  GRNELLEF +QIIPQLP+WVGF++SSKP SK 
Sbjct  1089  DPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVGFMISSKPFSKF  1148

Query  502   akrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  561
             AKRLPVSSVLDFSA+N AFV+DV+ LV+DIARNFSD+D  +AK +LK+KSGGNFAYLEFT
Sbjct  1149  AKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFT  1208

Query  562   KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  621
             KQALSHPGMA ASKEGAVPL VL+DLP++L+DIY EIFEDKFGQGRAR+W KAKPLLQL+
Sbjct  1209  KQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLI  1268

Query  622   VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  681
             VGAA+GPYSPVTE QA+EHF  T EDLRMLRRSFVDLV V+HG+YR+ESSALC+WLSDPA
Sbjct  1269  VGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPA  1328

Query  682   RSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdg------ttsAPTLSR-TTSRG  734
             RSEEQFY S+DDAL ALR++RRS SSGS+S HS S S        +T++ T SR T+SR 
Sbjct  1329  RSEEQFYLSVDDALTALRKLRRSRSSGSNSDHSHSGSSSSDGSVPSTTSHTPSRATSSRA  1388

Query  735   A-TKSHHRSHVKHEPRANPDYKPVGILKRG  763
             A +KSH R+H +HEPR NP++KP+GILKRG
Sbjct  1389  ASSKSHQRAHTRHEPRVNPEFKPMGILKRG  1418

>HYAP_07104
Length=721

 Score = 855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/744 (65%), Positives = 560/744 (75%), Gaps = 42/744 (6%)

Query  24   DAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVTDDVEDMFYGRNN-RSTASAASDV  82
            D  W LDEDS+RLKQ QD   VR DRSGTL+DTVN TDDVE+MFY     RST    +  
Sbjct  14   DGTWDLDEDSMRLKQNQDHV-VRLDRSGTLTDTVNETDDVEEMFYSSTQTRST----NGP  68

Query  83   PQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPgnfsnhng  142
            PQYR+TEQL    LTL++L+EDAETPS  +N SSSFSQFS     ++A S        + 
Sbjct  69   PQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFS-----DHATSI------SSV  117

Query  143  qnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaIRREVMNELHVT  202
               +T+   T +    + P  VG A +E  +L     EV +       IR+ V+NELHVT
Sbjct  118  NLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAA---IRQHVVNELHVT  174

Query  203  RYDVLKELALLKGAVAQLTAA-QHssppsvsstdsssldplsaddRAKLVRQTSTKTSPA  261
            RYDVLKELALLKGA+AQLT      +     S   S  +PLS+ DR  L RQTST TS A
Sbjct  175  RYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSA  234

Query  262  TRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELA  321
            TR+RLAASR N  K PPP ARASVRLTQLAPVAD ALSTPL+S Q+N++FPLIDFT+ELA
Sbjct  235  TRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELA  294

Query  322  AHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNML  381
            AHAR LTPGSRTWALTR EEWL+SRF  G D LLAVVGEGG+GKSAFCGTVAQQ+RG ++
Sbjct  295  AHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLV  354

Query  382  AAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLV  441
            AAHCCQFDRK KS+PRNVLLS+VHQ+V N P FKNQLARLNLKYVLEEADP+LLA+KVLV
Sbjct  355  AAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLV  414

Query  442  DPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFllsskpsskl  501
            DPLNALE+PV  AFM+VDGIDQC  G  GRNELLEF AQ+IPQLP+W+G ++SSKPSSKL
Sbjct  415  DPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKL  474

Query  502  akrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFT  561
            AKRLPVSSVLDFSA+N+AFVADV+ LV++IA +F  +D  +AK +LK KSGGNFAYLEFT
Sbjct  475  AKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFT  534

Query  562  KQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLV  621
            KQALS  GMA+ SKEG V + VL +LPETLYDIYAEIFEDKFG GRARVW KA+ +LQL 
Sbjct  535  KQALS--GMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLA  592

Query  622  VGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPA  681
            +GA +GPYSPVTEEQA+EHF LT EDLR+LRRSFVDLVAV+HG YRIE+SALCAWL DPA
Sbjct  593  IGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPA  652

Query  682  RSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdgttsAPTLSRTTSRGATKSH--  739
            R+EEQFYF+IDDALQALR+MRR+ +S SS                  + TS G++     
Sbjct  653  RAEEQFYFNIDDALQALRKMRRASASASS-----------------GQLTSSGSSNGSAP  695

Query  740  HRSHVKHEPRANPDYKPVGILKRG  763
             RS    + +   D +PV ILKRG
Sbjct  696  GRSQSPQKVQTESDCQPVSILKRG  719

>PHALS_06476
Length=726

 Score = 839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/769 (66%), Positives = 580/769 (75%), Gaps = 51/769 (7%)

Query  1    MVGNTMHRIknklrssrlgsskkDAAWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT  60
            MVG TMH++KNKLR S L     ++A+ L++DSLR K  QD+  VR DRS TL+DTVN+T
Sbjct  1    MVG-TMHKLKNKLRGSLLLKK--ESAYELNDDSLRRKHTQDET-VRVDRSATLTDTVNMT  56

Query  61   DDVEDMFYGRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQ  120
            DDVE+MFY   NRSTA+  S +PQYRTTEQ+R  +L L ALHED ET S  ++ SSSFSQ
Sbjct  57   DDVEEMFY---NRSTAT--SGIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQ  111

Query  121  FSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlrae  180
            FS TTPS+YAASTPGN +  +   +    +T      S +P   G    E    E L+ +
Sbjct  112  FSATTPSSYAASTPGNHAGIHHDFSTMYNTT------STLPAISGDFDLERLHSEVLKIK  165

Query  181  vlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQL-TAAQHssppsvsstdsssl  239
                      IRREVMNELHVTRYDVLKEL LLKGA+AQL +    +S  SVSSTDSSS 
Sbjct  166  SEVKT-----IRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSS  220

Query  240  dplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALS  299
            DPLS+D+RA L RQT TKTS ATR+RLAA R N  K PP   RAS RLTQLAPVADDALS
Sbjct  221  DPLSSDERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALS  280

Query  300  TPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVG  359
            TPL SQQINE FPLIDFTSELAAHAR LTPGSR+WALTR++EWLD+RF+ G+D LLAVVG
Sbjct  281  TPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVG  340

Query  360  EGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLA  419
            EGG+GKSAFCGTVAQQFRGN+LAAHCCQFDRKSKS PRNVLLSMVHQ+VDN P FKNQLA
Sbjct  341  EGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLA  400

Query  420  RLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFA  479
            RLNL+YVLEE DP LLA KVL+DPLNALEEP  + F+++DGIDQCA G+ GRNELLEF +
Sbjct  401  RLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFIS  460

Query  480  QIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDD  539
            QII  LP+WVGFL+SSKPSSKLAK LPVSSVLDFSA+N AFVAD + LVEDI++ FSDDD
Sbjct  461  QIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDD  520

Query  540  FVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIF  599
             V+AK ML +KSGGNFAYLEFTKQALSHPGMA  S  G VPL VL +LPETLYDIYAEIF
Sbjct  521  AVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIF  580

Query  600  EDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLV  659
            EDKFGQG AR WGKAKPLLQL+VGAA+GPYS VTEEQA++  +L A+DLRMLRRSFVD+V
Sbjct  581  EDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIV  640

Query  660  AVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssd  719
            AV+H                    EEQFYFSI+DAL ALR+MR   +S S S        
Sbjct  641  AVKH--------------------EEQFYFSIEDALLALRKMR--LNSSSDSSSGDPGIS  678

Query  720  gttsAPT----LSRTTSRGATKSHHRSHVKHEPRAN-PDYKPVGILKRG  763
               +AP     LSR  SRG   +  +   +HEPR N  +YKPVGILKRG
Sbjct  679  SDKNAPDHNRRLSRANSRGKLPNKSQ---RHEPRTNFENYKPVGILKRG  724

>PYIW_19969
Length=733

 Score = 592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/772 (45%), Positives = 466/772 (60%), Gaps = 102/772 (13%)

Query  26   AWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT------DDVEDMFY-----------  68
            A A DEDSLR+ +   +   R+ R+ T++ +   +      DDVEDMFY           
Sbjct  28   ATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDMFYNGGDARSTSSS  87

Query  69   -------GRN-----------NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSA  110
                   GR+           +R+T  +      YRTTEQLR T   L  L ED   P+A
Sbjct  88   VRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGTA-NLIPLQEDEVLPAA  146

Query  111  TNNLSSSFSQFSVTTPSNYAASTPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavae  170
            +   ++S     + T  NY+                    +       A+ T +     E
Sbjct  147  SRTTTTS----QMPTNGNYSNGN-----------------SGGGSQLDALRTELSEMKLE  185

Query  171  egelerlraevlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHsspps  230
                                IRRE+MNE+HVTRYDVLKE+ +LKG + QL  A  +   S
Sbjct  186  VQA-----------------IRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLS  228

Query  231  vsstdsssldplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQL  290
                ++             + R T+  TS AT++R A      + + P   RAS RLTQL
Sbjct  229  TDEINT-------------ISRTTALFTSKATKDRRATRD---ESSSPMLVRASSRLTQL  272

Query  291  APVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTG  350
            APVAD+ALSTPL   QI+EMFPLI+ + EL A +R     SR WA+ R +EW+DSRFN G
Sbjct  273  APVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVG  332

Query  351  SDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDN  410
             D LLA+VGEGG+GKS   G ++ +F  N++A H C FDRKSKS+PRNVLLS+V+Q++ N
Sbjct  333  VDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISN  392

Query  411  YPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQG  470
             P FKNQLARLNLKYVLEE+DP++LA K+LVDPL ALEEP+ A   M+DG+DQC   ++G
Sbjct  393  LPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRG  450

Query  471  RNELLEFFAQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVED  530
            RN+LL+F A IIP+LPTW+G  ++SKPS +L  RL +SS+LDFSA+N  ++ D   ++ D
Sbjct  451  RNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMIND  510

Query  531  IARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPET  590
            I  +FSD D  +A+ +LK+KSGGNF +L+FTKQALSHPGM      G +PL VL+DLPE+
Sbjct  511  IIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPES  568

Query  591  LYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRM  650
            +Y+IY EIFEDKFG+GR R+W K +PLL+L+V AASGPY+ +TE QA+E F L+ ED+R 
Sbjct  569  IYEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRT  628

Query  651  LRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgss  710
            +RRSFVD++ VRHG+YRIE+SAL  WL DP R+ EQFY  +   + ALRQ+         
Sbjct  629  IRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHH-------  681

Query  711  sghsgsssdgttsAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKR  762
               S  +    +S  + S  TS  +T S H S+V   P    ++KPVGILK+
Sbjct  682  -QDSSETHSVGSSDGSSSNATSNVSTASSHLSYVVPPPVPKVNFKPVGILKK  732

>PYIR_13418
Length=747

 Score = 588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/578 (53%), Positives = 403/578 (70%), Gaps = 23/578 (4%)

Query  191  IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAK-  249
            IRRE+MNE+HVTRYDVLKE+ +LKG + QL  A  S          +++   +  + +  
Sbjct  186  IRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSD  245

Query  250  ----LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQ  305
                + R T+  TS AT+ER    RA  + + P   RAS RLTQLAPVADDALSTPL   
Sbjct  246  ELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPVADDALSTPLLQH  301

Query  306  QINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGK  365
            QI+EMFPL++ ++EL A A+   P SR WA+ R +EW+DSRFN G D LLA+VG+GG+GK
Sbjct  302  QIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGK  361

Query  366  SAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKY  425
            S   G +  +F  N++A H C FDRKSKS+PRNVLLS+V+Q++ N P FKNQLARLNLKY
Sbjct  362  STLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKY  421

Query  426  VLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQL  485
            VLEE DP++LA KVLVDPL ALEEP+ A   + DGIDQC   ++GRN+LL+F A IIP+L
Sbjct  422  VLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--SKGRNDLLDFLAVIIPEL  479

Query  486  PTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKS  545
            PTWVG  ++SKPS +L  +L ++S+LDFSA+N  ++ D   L+ DI  NFSD D  +A+ 
Sbjct  480  PTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQARE  539

Query  546  MLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQ  605
            +LK+KSGGNF +L+FTKQALSHPGM      G +PL VL+DLPE++Y+IY EIFEDKFG+
Sbjct  540  ILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGK  597

Query  606  GRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGS  665
            GR+R+W K +PLL+L+V AASGPY+ +TE QA+E F+L+ ED+R +RR+FVD++AV HG+
Sbjct  598  GRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGT  657

Query  666  YRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssdgttsAP  725
            YRIE+SAL  WL DP R+ EQFY  +   +  LRQ+    SS + S  S           
Sbjct  658  YRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQDSSDTHSAASSE---------  708

Query  726  TLSRTTSRGATKSHHRSHVKHEPRA-NPDYKPVGILKR  762
              S   S  +T S H S+V   P A   ++KPVGILK+
Sbjct  709  ASSNNVSNVSTASSHLSYVVPPPAAPKVNFKPVGILKK  746

 Score = 36.2 bits (82),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 44/126 (35%)

Query  28   ALDEDSLRLKQAQDDAPVRYDRSGTLSDTVN------VTDDVEDMFY-------------  68
            A DE++LR+ +   +   R+ R+ T++ +        ++DDVE+MFY             
Sbjct  30   ATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEMFYNGSANGNANPSAS  89

Query  69   -----------------------GRNNRSTASAASDVPQYRTTEQLRDTHLTLSALHEDA  105
                                   G  +R+T  +      YRTTEQ+R T+L    L ED 
Sbjct  90   ARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQMRGTNLM--PLQEDE  147

Query  106  ETPSAT  111
              P+A+
Sbjct  148  VLPAAS  153

>PYU1_G001733
Length=732

 Score = 580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/689 (47%), Positives = 440/689 (64%), Gaps = 58/689 (8%)

Query  30   DEDSLRLKQAQDDAPVRYDRSGTLSDTVN------VTDDVEDMFYGRNNRSTASAASDVP  83
            DED+LR+ +   +   RY R+ T++ +        ++DDVEDMFY      T S  SD  
Sbjct  32   DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNGGGGITRST-SDYT  90

Query  84   QYRTTEQLRD-------THLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPgn  136
              RTT  +RD       T L ++ ++   E    TN +           P N     P  
Sbjct  91   TGRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLM-----------PLNEDEVLP--  137

Query  137  fsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaIRREVM  196
                                 +A+ TT G+A   E +  R     ++ + +   IRRE+M
Sbjct  138  ---------------------AAMRTTTGAAGGSEADALRAELVEMKQEMQT--IRREMM  174

Query  197  NELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsss--ldplsaddRAKLVRQT  254
            NE+HVTRYDVLKE+ +LKG + QL AA  S           +     LS      + R T
Sbjct  175  NEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTT  234

Query  255  STKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLI  314
            +  TS AT++RLAA    V   P      + RLTQLAPVADDALSTPL   QI++MFPL+
Sbjct  235  AVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLV  292

Query  315  DFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQ  374
            DF+++L  HA+   P SR WA  R ++W+DSRFN G D LLA+VG+GG+GKS   G +  
Sbjct  293  DFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCD  352

Query  375  QFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPML  434
            +F  N++A H C+FDRKSKS+PRNVLLS+V+Q++ N P FKNQLARLNLKYVLEE DP++
Sbjct  353  RFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV  412

Query  435  LAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFlls  494
            LA KVLVDPL ALEEP+ A  ++VDGIDQC   ++ RN+LL+F A IIP+ PTW+G  ++
Sbjct  413  LARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLGIFIT  470

Query  495  skpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGN  554
            SKPS +L  +L ++S+LDFS +N  ++ D   L+ DI  NFSD D  +A+ +LK+KSGGN
Sbjct  471  SKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGN  530

Query  555  FAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKA  614
            F +L+FTKQALSHPGM    + G VPL VL+DLPE++Y+IY EIFEDKFG+G  R+W K 
Sbjct  531  FTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKV  588

Query  615  KPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALC  674
            +PLL L+V AASGPY+ +TEEQA+E F+L+ +D+RM+RR+F D++ VRHG+YR+E+SA+ 
Sbjct  589  QPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMY  648

Query  675  AWLSDPARSEEQFYFSIDDALQALRQMRR  703
             WL DP RS EQFY +I  ++  LR++ R
Sbjct  649  EWLVDPQRSGEQFYVNISASMDILRRLHR  677

>PYAP_17763
Length=794

 Score = 527 bits (1358),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 265/522 (51%), Positives = 369/522 (71%), Gaps = 14/522 (3%)

Query  191  IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAK-  249
            I+RE+MNE+H+TRYDVLKE+ +LKG + QL +    S      T +++   +    +A  
Sbjct  197  IKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAAMGIDVPPQANE  256

Query  250  --------LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTP  301
                    L R+T+T  S  T+ER+  +R +  + PP     S RLTQLAPV D ALSTP
Sbjct  257  LSPEEKEALSRKTTTVVSKVTKERITTTRED--QIPPVLRSTSSRLTQLAPVDDSALSTP  314

Query  302  LTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEG  361
            L  +QI++MFPLIDF++E+   +R    GSR W   RV+EWLDSRFN G+D++LA+VG+ 
Sbjct  315  LHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGADVVLAMVGDA  374

Query  362  GTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARL  421
            G+GK+    +V  ++   ++A H C+FDRK+KS+PRNVLLS+V+Q+  + P FK+QLARL
Sbjct  375  GSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLPMFKSQLARL  434

Query  422  NLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQI  481
            NLKYVLEE D   L+ KVL+DPLNALEEP+   F++ D IDQC  G  G N+L +F + I
Sbjct  435  NLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGV-GYNDLQDFLSAI  493

Query  482  IPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFV  541
            IP+ P W+GFL+SSKPS + A  +PVSSVLDFSA+N  ++ D   L+ DIA  F D+D  
Sbjct  494  IPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAAVFHDNDQA  553

Query  542  KAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFED  601
            +AK +LK KSGGN++YLEFTKQALS+PGM  AS  G VP+ VL+DLP++LY+IY EIFED
Sbjct  554  EAKQILKTKSGGNYSYLEFTKQALSNPGMEEAS--GFVPVDVLHDLPQSLYEIYEEIFED  611

Query  602  KFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAV  661
            KFG+GR RVW KA P+LQL+  AASGPY+ +TE+   +  + T +++RMLRR+F+D++++
Sbjct  612  KFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAFIDIISI  671

Query  662  RHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRR  703
            RHG+Y I SSA+  WL+D  R  EQ++  ++  ++ LR++ R
Sbjct  672  RHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  713

>PYAR_13571
Length=666

 Score = 519 bits (1336),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 316/737 (43%), Positives = 440/737 (60%), Gaps = 106/737 (14%)

Query  59   VTDDVEDMFYGR---NNRSTASAASD--VPQYRTTEQLRDTHLTLSALHEDAETPSATNN  113
            V +D ED FY R   NN +  S  SD  +P  R+T        T SA+  D +  S  + 
Sbjct  3    VPEDAEDTFYTRGRENNGTDISVRSDYQIPSARST--------TSSAMSYDDDNDSMYSG  54

Query  114  LSSSFSQFSVTTPSN-------YAASTPgnfsnhngqnnntnqsttfARG-FSAIPTTVG  165
             SS  S  + TTPSN        A              + +       +G F+ +PTT  
Sbjct  55   YSSDRS--TATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAA  112

Query  166  SavaeegelerlraevlevkeevkaIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQH  225
             A                       IRRE+MNE+H +RYDVLKE+ +LKG + QL     
Sbjct  113  PAYTPMPA-----------------IRREMMNEMHTSRYDVLKEVTMLKGTITQLIET--  153

Query  226  ssppsvsstdsssldplsaddRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARA-S  284
                                    + R+T+T  S +T+ER+  +R ++    PP  RA S
Sbjct  154  ------------------------MARRTTTVASKSTKERITTTRDDMV---PPLLRATS  186

Query  285  VRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLD  344
            VRLTQLAPV D ALSTPLT +QI+E+FPL+DF++E+   AR    G+R WA  RV+EWLD
Sbjct  187  VRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLD  246

Query  345  SRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMV  404
            SRFN GSD+LLA+VG+ GTGK+                 H C+F+RK KS+PRNVLLS+V
Sbjct  247  SRFNVGSDVLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVV  289

Query  405  HQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQC  464
            +Q+    P FK+QLARLNLKYVLEE D + LA KVLVDPL +LEEP+ A F+++DG+DQC
Sbjct  290  NQLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQC  349

Query  465  AAGAQGRNELLEFFAQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADV  524
               A G N+LL+F + ++P+ P+W+GFL+++KPS + A+++PV+S+LDFSA+N A+V D 
Sbjct  350  GV-ANGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDT  408

Query  525  APLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVL  584
            A L+ DI   F  +D   A  +LK KS GN++YLEFT+QA+S+PGM A   +G+VP+ VL
Sbjct  409  AVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVL  466

Query  585  NDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLT  644
            +DLP++LY+IY EIFEDKFG+GR R+W KA P+LQL+  AASGPY+ +TE+   +  +  
Sbjct  467  HDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYA  526

Query  645  AEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRR-  703
             +D+RMLRR+F+D++++RHG+Y I SSAL  WL+DP R  E ++  +   ++ LR++ R 
Sbjct  527  KDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRG  586

Query  704  -----------sgssgsssghsgsssdgttsAPTLSRTTSRGATKSHHRSHV----KHEP  748
                       + +S  ++  S S +   +S+ T S   S G  K+   S      +HEP
Sbjct  587  EKLQLPGTAHGTPASERATTTSRSPASPESSSSTASSDRSSGGGKTRVTSMTTPPKRHEP  646

Query  749  RANPDYKPVGILKRGTT  765
               P  KPVGILKR TT
Sbjct  647  NMAPREKPVGILKRTTT  663

>PYVX_23590
Length=689

 Score = 444 bits (1141),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 327/779 (42%), Positives = 429/779 (55%), Gaps = 169/779 (22%)

Query  30   DEDSLRL-KQAQDDAPVRYDRSGTLSDTVNVTDD-VEDMFYGRN----------------  71
            D++SLRL +Q  +DA +R+ R  TLS   +   D VE+MFYG                  
Sbjct  33   DDESLRLSRQVAEDA-LRFQRHTTLSSASSAMSDDVEEMFYGGGPGGHAGHGGHAGHGGA  91

Query  72   NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAA  131
            +RSTA +      YRTTEQLR T   L  L ED   P A                     
Sbjct  92   DRSTAGSVRTTDVYRTTEQLRST--GLEPLAEDRVLPPAVP-------------------  130

Query  132  STPgnfsnhngqnnntnqsttfARGFSAIPTTVGSavaeegelerlraevlevkeevkaI  191
                                     + ++P T G      G L  LRAE+ +V+ E +AI
Sbjct  131  -------------------------YGSVPHTSGPHADGPGGLAALRAELADVRAETQAI  165

Query  192  RREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKLV  251
            RREVMNELHV RYDVLKE+ +LKGAVAQL AA         S   S+    SA   A   
Sbjct  166  RREVMNELHVLRYDVLKEVTVLKGAVAQLLAALAPGGGDAGSRPGSAGSATSAATTAS--  223

Query  252  RQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMF  311
              +S + SP       A RA +   P            LAPV D ALS PL  +Q++E+F
Sbjct  224  -SSSAELSP-------ADRAAIGVAP-----------TLAPVDDAALSAPLRPEQLDELF  264

Query  312  PLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGT  371
            PL+D ++++AA AR   PG+R WA  RV+EWLDSRFN G D LL VVG  GTGKS FCG+
Sbjct  265  PLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGS  324

Query  372  VAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEAD  431
            V    +GN+LA H C+FDRK+KSTPR VLLS+V Q+V N PPFK QLARLNLKYVLEE D
Sbjct  325  VCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPD  384

Query  432  PMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQG--RNELLEFFAQIIPQLPTWV  489
              +LA KVL+DPL A EEP+ A  +++DG+DQC    +G  RNELLEF A ++PQLP+W+
Sbjct  385  VFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWL  444

Query  490  GFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQ  549
            G L+SSKP+ +LA +L  +S+LDFS +N  FV D   LV+DIA NF+D    +A+ +L+ 
Sbjct  445  GVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLET  504

Query  550  KSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRAR  609
            K+GGNFAYL+FT+QALS PG+     +G + L +L+DLPE+LY+IY EIFED        
Sbjct  505  KAGGNFAYLDFTRQALSSPGL----DDGELELDMLHDLPESLYEIYLEIFEDN-------  553

Query  610  VWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIE  669
                                                +D+R+++RSFVD++AVR G YRIE
Sbjct  554  ------------------------------------DDMRLVKRSFVDIIAVRGGCYRIE  577

Query  670  SSALCAWLSDPARSEEQFYFSIDDALQALRQMRRsgssgsssghsgsssd----------  719
            SSAL  WLSDPARS E F+F  D  +  LR++++  ++ +      + +           
Sbjct  578  SSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKAKQQSDEADAQGHERRRMSRR  637

Query  720  ---------------gttsAPTLSRTTSRGATKSHHRSHVKHEPRANPDYKPVGILKRG  763
                             + +P  +RT+SR ++        ++EP ANP  KPVGILKRG
Sbjct  638  ESARSTASNSSSSTSSRSHSPPPARTSSRVSS--------RYEPPANPS-KPVGILKRG  687

>CCI44111
Length=576

 Score = 325 bits (833),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 187/512 (37%), Positives = 293/512 (57%), Gaps = 8/512 (2%)

Query  191  IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHssppsvsstdsssldplsaddRAKL  250
            +R+E++  +  TRYD+LKE+  LKG VA ++    S   +  +  + +    SA      
Sbjct  70   VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGAD  129

Query  251  VRQTSTKTSPATRERLAASRANVQK--TPPPFARASVRLTQLAPVADDALSTPLTSQQIN  308
              +  +      R  + +  +++ +  +     R S  L  L  + +  LS PL+  +I+
Sbjct  130  DNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRES-GLPTLMTMDEANLSKPLSKDEID  188

Query  309  EMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAF  368
            EMFPLID + ++ ++A  L  G+R WAL  + +W+ S F  G++ +L +VGEGG GKS  
Sbjct  189  EMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTL  248

Query  369  CGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLE  428
             G V Q+F  N+ A H  QFDRK  S+ R+V+LS+V Q       +K QL RLNL+Y+L 
Sbjct  249  AGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILA  308

Query  429  EADPMLLAAKVLVDPLNAL-EEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPT  487
            E++P+++A K+L+DPL A+ E      F++ DGIDQC    Q  N+LLE  + I  + P+
Sbjct  309  ESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQS-NDLLELLSHITERFPS  367

Query  488  WVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSML  547
            W+GF+++SK     A RL  +SV+     N  F+ D   L+E++   F      +A  +L
Sbjct  368  WIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDIL  427

Query  548  KQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGR  607
             +KSGGN  YL+F  +ALSHP +    ++  + L VL++LPE++ +I   IF+DKFGQG 
Sbjct  428  MRKSGGNSLYLQFINRALSHPILHG--EQTFLSLDVLDELPESVDEIIFTIFDDKFGQGH  485

Query  608  ARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYR  667
             RVW  AKP+L+++V AA+GPY  V E Q ++ F L   + RM+ R+F D++      YR
Sbjct  486  QRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYR  545

Query  668  IESSALCAWLSDPARSEEQFYFSIDDALQALR  699
            I +S+L  WL    RS + F+ +     + LR
Sbjct  546  IINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 325 bits (833),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 188/524 (36%), Positives = 301/524 (57%), Gaps = 45/524 (9%)

Query  191  IRREVMNELHVTRYDVLKELALLKGAVAQL---------------TAAQHssppsvsstd  235
            +R+E++  +  TRYD++KE+  L+G V  +               T   H++    + ++
Sbjct  77   VRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFSE  136

Query  236  sssldplsad----dRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLA  291
            S+  D + +     +R+ +V   S K+   T ERL    ++   +               
Sbjct  137  SAEDDEIISRFITPERSTIVADCSYKSGFVT-ERLNTKDSSFSTS--------------V  181

Query  292  PVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGS  351
            P+ +  LS PL   + +EMFP ID  S+L ++A  L  G+R WAL RV+EW++S F + +
Sbjct  182  PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSEN  241

Query  352  DILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNY  411
            D +L ++GEGG+GKS   G + Q+F   + A H CQFDRKS+S+ R+V+LS+V Q     
Sbjct  242  DHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKN  301

Query  412  PPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAA---FMMVDGIDQCAAGA  468
            P +K QL  LNL+Y+L+E++P+++A K+L++PL A+  PV  +   F++ DGIDQC    
Sbjct  302  PLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVEN  359

Query  469  QGRNELLEFFAQIIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLV  528
            +  N+LL+  + I  + P+ +GF+++SK S     +    S++     N  F+ D   L+
Sbjct  360  ES-NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILM  418

Query  529  EDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLP  588
            E+   NF      +A  +L +KSGGN  YL+FT++ALSHP +    +   + L VL++LP
Sbjct  419  ENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHG--ERTFLSLDVLDELP  476

Query  589  ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDL  648
            +++ DI+  IFEDKFGQG  RVW   KP+L+ +V AA+G +  V E Q ++ F L  E+ 
Sbjct  477  DSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEW  536

Query  649  RMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSID  692
            RM++RSF D++      YRI +S+L AWL    RS+   +F ID
Sbjct  537  RMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRSQ---HFYID  577

>SPRG_06355
Length=713

 Score = 234 bits (597),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 149/458 (33%), Positives = 248/458 (54%), Gaps = 30/458 (7%)

Query  250  LVRQTSTKTSPATRE--RLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQI  307
            +VR++   +S  +RE  +L+   + + +      R S R     P+ D AL+ P  +  +
Sbjct  258  VVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTR----QPIKDQALTQPWENV-L  312

Query  308  NEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSA  367
            N+  P ++        A  + P +RTWA+ +  +W      T    +L VVG  G GKS 
Sbjct  313  NQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKST  368

Query  368  FCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVL  427
                +   +   ++A+H  ++D +  ++   +L+S+ HQI    P F+ QL RLNL Y++
Sbjct  369  LLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLI  426

Query  428  EEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPT  487
            +E DP++LA K+L++PL ++  P+++  +++D +D+ A+   G N L+   A +  + P+
Sbjct  427  QEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDAS-TPGTN-LISLLADVALEFPS  484

Query  488  WVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSML  547
            WV FLLSS+P   + K LP   VL F  E+  F AD    V+ +      DD      +L
Sbjct  485  WVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-KNILFLL  543

Query  548  KQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGR  607
            K KS G+F YL+F  QA        A     +  G++ +LP+TLY+IY ++FE+K+G+GR
Sbjct  544  KAKSQGSFLYLQFVDQAF-------AMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGR  596

Query  608  ARVWGKAKPLLQLVVGAASGPYSP-----VTEEQAREHFNLTAEDLRMLRRSFVDLVAVR  662
             RVW K +P+L+ +VGAA+  +       VTE   +  F L   DL ++ RSF D+VAV 
Sbjct  597  RRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVD  656

Query  663  H--GSYRIESSALCAWLSDPARSEEQFYFSIDDALQAL  698
               G YR++S  L  +L D +RS+E  + +++  +  L
Sbjct  657  EETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYL  694

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)

Query  191  IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQH  225
            IRR+VM ELH T+YD+LKE+ +L+GAV QL  A H
Sbjct  156  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  190

>SDRG_01763
Length=736

 Score = 227 bits (579),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 144/462 (31%), Positives = 246/462 (53%), Gaps = 30/462 (6%)

Query  250  LVRQTSTKTSPATRE--RLAASRANVQKTPPPFARASVRL----TQLAPVADDALSTPLT  303
            + R+++  +S  +RE  +L+   + + +     +R S +L    +   P+ D AL+ P  
Sbjct  273  VFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPWE  332

Query  304  SQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGT  363
            +  +N+  P ++        A  + P +RTWA+ +  +W      T    +L VVG  G 
Sbjct  333  NV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGA  387

Query  364  GKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNL  423
            GKS     +   +   ++A+H  ++D +    P  +L+S+ HQI    P ++ QL RLNL
Sbjct  388  GKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQLVRLNL  445

Query  424  KYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIP  483
             Y+++E DP++LA K+L++PL ++  P+++  +++D +D+  +   G N L+   A +  
Sbjct  446  PYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVS-TPGAN-LISLLADVAL  503

Query  484  QLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKA  543
            + P+WV FLLSS+    + K LP   VL F  E+  F AD    V+ +      DD    
Sbjct  504  EFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDD-KNI  562

Query  544  KSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKF  603
              +LK KS G+F YL+F  QA S            +  G++ +LP+TL++IY ++FE+K+
Sbjct  563  LFLLKAKSQGSFLYLQFVDQAFS-------MIHSEIDAGMILELPKTLHEIYDQVFEEKY  615

Query  604  GQGRARVWGKAKPLLQLVVGAASGPYSP-----VTEEQAREHFNLTAEDLRMLRRSFVDL  658
            G+GR RVW K + +L+ +VGAA+  +       VTE   +  F L   DL ++ RSF D+
Sbjct  616  GKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDI  675

Query  659  VAVRH--GSYRIESSALCAWLSDPARSEEQFYFSIDDALQAL  698
            V V    G YR++S  L  +L D ARS+E  + +++  +  L
Sbjct  676  VTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)

Query  191  IRREVMNELHVTRYDVLKELALLKGAVAQLTAAQH  225
            IRR+VM ELH T+YD+LKE+ +L+GAV QL  A H
Sbjct  169  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203

>SDRG_04575
Length=1003

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 103/212 (49%), Gaps = 12/212 (6%)

Query  281  ARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVE  340
            A+   RL Q+A      L       ++  +F    F ++++ + +G     R W L +++
Sbjct  399  AKYPQRLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLD  456

Query  341  EWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAH-CCQFDRKSKSTPRNV  399
            +W  +      D +  + G+ GTGKSA    + Q  R  + A H  C+ D +++S  R  
Sbjct  457  QWKQTH-----DQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRC  509

Query  400  LLSMVHQIVDNYPPFKNQLARLN-LKYVLEEADPMLLAAKVLVDPLNALEEPVQAAF-MM  457
            +LS+ +Q+    P + + L + + L+ V+  +  + L   +LV PL+A+ EP      ++
Sbjct  510  ILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVIL  569

Query  458  VDGIDQCAAGAQGRNELLEFFAQIIPQLPTWV  489
            +DG+D      +  N L+     ++ +LP+WV
Sbjct  570  LDGLDSLEDTQETDNCLVSALPGLLQKLPSWV  601

>H310_08292
Length=1007

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 92/210 (44%), Gaps = 10/210 (5%)

Query  282  RASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEE  341
            + +VR+ QL       L       ++  +F    F +E+A   +G     R W + ++ +
Sbjct  407  KYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQ  464

Query  342  WLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLL  401
            W  S   T       V G+ GTGK+A    + Q  +  + A H    D +    PR  +L
Sbjct  465  WKASASQT-----FWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCIL  518

Query  402  SMVHQIVDNYPPFKNQLARLN-LKYVLEEADPMLLAAKVLVDPLNALEEPVQAAF-MMVD  459
            S+ +Q+    P +   L +   L+ ++  +    L   +LV PLNA+ +P      +++D
Sbjct  519  SLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLD  578

Query  460  GIDQCAAGAQGRNELLEFFAQIIPQLPTWV  489
            G+D     A   N  +     ++ +LP+WV
Sbjct  579  GLDAFQDAAALDNCFVSSLVALVRKLPSWV  608

>SPRG_12621
Length=1003

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 82/161 (51%), Gaps = 10/161 (6%)

Query  332  RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAH-CCQFDR  390
            R W L ++++W  +      D +  V G+ GTGKSA    + Q  R  + A H  C+ D 
Sbjct  461  REWVLDQLDQWKQTH-----DQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDE  514

Query  391  KSKSTPRNVLLSMVHQIVDNYPPFKNQLARLN-LKYVLEEADPMLLAAKVLVDPLNALEE  449
            +++S  R  +LS+ +Q+    P + + L + + L+ V+  +  + L   +LV PL A+ E
Sbjct  515  QTQSH-RRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAE  573

Query  450  PVQAAF-MMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWV  489
            P      +++DG+D      +  N L+     ++ +LP+WV
Sbjct  574  PATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWV  614

>SDRG_07983
Length=991

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 95/221 (43%), Gaps = 29/221 (13%)

Query  281  ARASVRLTQLAPVADDALSTPLTSQQINEMFPLID---FTSELAAHARGLTPGSRTWALT  337
            AR   R  QL    D  +      QQ   +F L+    F S+++   +     +R W L 
Sbjct  391  ARYKTRYHQLLSALDGQIGLDHDGQQ-ARLFSLLSPFSFQSQISKLTQLFV--AREWVLA  447

Query  338  RVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPR  397
            + + W+ +    GS I + + G  G+GKSA    + Q  R  + A H    +     + R
Sbjct  448  KYDAWVQT--PNGSRIFV-MSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  503

Query  398  NVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPML----LAAKVLVDPLNALEEPVQA  453
              +LS+V+Q+    P + N +   N +  LEE  P+     L   +L+ PL+A+  P   
Sbjct  504  RCVLSLVYQLSTQLPEYANVI---NSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  560

Query  454  AFMMVDGIDQCAAGAQGRNELLEFFAQIIPQL---PTWVGF  491
              +++DGID    G         F A +   +   P+WV F
Sbjct  561  LVLLIDGIDCFEPG---------FVATLTAHMDLWPSWVRF  592

>SPRG_19030
Length=1000

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 95/221 (43%), Gaps = 29/221 (13%)

Query  281  ARASVRLTQLAPVADDALSTPLTSQQINEMFPLID---FTSELAAHARGLTPGSRTWALT  337
            AR   R  QL    +  +      QQ   +F L+    F S+++   +     +R W L 
Sbjct  399  ARYKTRYNQLLAALNGQIGLDHDGQQ-ARLFSLLSPFSFQSQISKLTQLFV--AREWVLA  455

Query  338  RVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPR  397
            + + W+ +    GS I + V G  G+GKSA    + Q  R  + A H    +     + R
Sbjct  456  KYDAWVQT--PNGSRIFV-VSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEEDQTQSAR  511

Query  398  NVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPML----LAAKVLVDPLNALEEPVQA  453
              +LS+V+Q+    P + N L   N +  LEE  P+     L   +L+ PL+A+  P   
Sbjct  512  RCVLSLVYQLSTQLPEYANVL---NSQEPLEEIVPVKSLVDLIHALLIAPLSAIAHPASI  568

Query  454  AFMMVDGIDQCAAGAQGRNELLEFFAQIIPQL---PTWVGF  491
              +++DGI+    G         F A +   +   P+WV F
Sbjct  569  LVLLIDGIECFEPG---------FVATLTAHMDLWPSWVRF  600

>PYVX_21513
Length=1446

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 76/177 (43%), Gaps = 23/177 (13%)

Query  332  RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
            R W   RV++W++   +     +  + G+ G+GK++    + Q F   + A H    +  
Sbjct  438  RDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTF-PEIAAFHFALQEDD  496

Query  392  SKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPM----LLAAKVLVDPLNAL  447
                 R  +LS+ +Q+    P +      L  +  LEE  P+     L   +LV+PLN +
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTI  553

Query  448  EEPVQAAFMMVDGIDQCAAGAQGR---------------NELLEFFAQIIPQLPTWV  489
            + P +   +++DG++   +GA                    L+     ++ +LP+WV
Sbjct  554  KRPAKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWV  610

>H257_11773
Length=1026

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/212 (24%), Positives = 90/212 (42%), Gaps = 11/212 (5%)

Query  281  ARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVE  340
             + +VRL QL       L       ++  +F    F +E++   +G     R W + ++ 
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  341  EWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVL  400
            EW  S   T       + G+ GTGK+A   +V Q  +  + A H    + +     R  +
Sbjct  479  EWKASSSQT-----FWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  401  LSMVHQIVDNYPPFKNQLARLN--LKYVLEEADPMLLAAKVLVDPLNALEEPVQAAF-MM  457
            LS+ +Q+    P +   L + +  L+ ++  +    L   +LV PLNA+ +P      ++
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  458  VDGIDQCAAGAQGRNELLEFFAQIIPQLPTWV  489
            +DG+D         N  +   A  +  LP WV
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWV  624

>H257_01934
Length=1022

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 54/218 (25%), Positives = 95/218 (44%), Gaps = 17/218 (8%)

Query  281  ARASVRLTQLAPVADDALSTPLTSQQINEMFPLID---FTSELAAHARGLTPGSRTWALT  337
            AR S R  QL    +  +      QQ   +F L+    F S+++   +G     R W L 
Sbjct  412  ARYSTRREQLIAALNGRVGLDQEGQQ-ARLFSLLSPFSFQSQISTATQGYC--GRAWVLH  468

Query  338  RVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPR  397
              +EW+ S  +    + L + G  G+GK+A    + Q  R  ++A H    + +     R
Sbjct  469  EFDEWVTSPPSNARRVFL-LTGVIGSGKTALAAHIIQN-RPEVVAFHLASHEGEQTQNGR  526

Query  398  NVLLSMVHQIVDNYPPFKNQLARLNLKYVLEE----ADPMLLAAKVLVDPLNALEEPVQA  453
              +L++V+Q+    P + N L   + K  LEE     +   L  ++L+ PL  +  P   
Sbjct  527  RCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLADLVQELLIAPLERIATPPST  584

Query  454  AFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGF  491
              +++DGI +C   A   + L+      + + P W+ F
Sbjct  585  MVILIDGI-ECFPCAD--DNLVAILTASLNRWPAWMRF  619

>PYAP_22230
Length=1116

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 64/141 (45%), Gaps = 11/141 (8%)

Query  332  RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
            R W L  + +W+++   +GS +   V G+ G+GK++    +  Q    + A H    D  
Sbjct  496  RAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSVAARMV-QLMPEIAAFHFALQDDD  553

Query  392  SKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPM----LLAAKVLVDPLNAL  447
                 R  +LS+ +Q+    P +      L     LEE  P+     L   +LV+PLNA+
Sbjct  554  QTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLNAI  610

Query  448  EEPV--QAAFMMVDGIDQCAA  466
              P   +   +++DG++   +
Sbjct  611  ARPKSDKPVVLLIDGLEHLVS  631

>PYIR_14107
Length=1176

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 81/417 (19%), Positives = 162/417 (39%), Gaps = 83/417 (20%)

Query  332  RTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRK  391
            R W   ++E W+ S   T    +  V G+ G+GK+A    + Q     + A H    + +
Sbjct  550  REWLFMQLENWIASPTATQ---VFWVTGQIGSGKTALAARMVQVI-PEIAAFHFALQEDE  605

Query  392  SKSTPRNVLLSMVHQIVDNYPPFKNQL-ARLNLKYVLEEADPMLLAAKVLVDPLNALEEP  450
                 R  +LS+ +Q+    P +   L +R  L+ ++  ++   L  ++LV+PLN +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  451  --VQAAFMMVDGI--------------------------------DQCAAGAQGRNELLE  476
               +   +++DG+                                D C +   G   L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  477  FFAQIIPQLPTWVGFllssk---pssklakrlPVSSVLD-FSAENDAFVADVAPLVEDI-  531
                ++ +LP WV  +L S+         +    S VLD   +E+     D+   VE++ 
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLDSLKSESQ---QDIKRYVENML  782

Query  532  --------------------ARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMA  571
                                A  FS+    +   ++ ++S G F Y     Q++      
Sbjct  783  GESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI------  836

Query  572  AASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSP  631
               +E  + +  L  LP  +   + + F+  F + + +     +P+L+++  +    + P
Sbjct  837  ---EEKRLAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLEVLCAS----FEP  887

Query  632  VTEEQAREHFNLTAEDLRMLRRSFVDLVAV-RHGSYRIESSALCAWLSDPARSEEQF  687
             +        N    D + +  SF  L+++   G+ R   S++C W+ DPA + + F
Sbjct  888  FSLWNIVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGKYF  944

>PYAR_14788
Length=795

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 61/139 (44%), Gaps = 10/139 (7%)

Query  357  VVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKN  416
            V G+ G GK++    + Q     + A H    +       R  +LS+ +Q+    P +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTI-PEIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  417  QLARLNLKYVLEEADPML----LAAKVLVDPLNALEEPV--QAAFMMVDGIDQCAAGAQG  470
                L     LEE  P+     L A +L+ PLNA+  P   +   +++DG++  A+   G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  471  RNELLEFFAQIIPQLPTWV  489
                +     +I +LP+WV
Sbjct  537  AGGGVSLLPSLIARLPSWV  555

>PYU1_G002110
Length=999

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 99/486 (20%), Positives = 188/486 (39%), Gaps = 79/486 (16%)

Query  250  LVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQ----  305
            +VRQ     S    + L  S   +   P   A +S+   + + +  D L T L  Q    
Sbjct  345  MVRQCEIPLSICRIQWLDMSDCLLYDDPSSIAASSINEVRYS-MRKDQLITALQGQLDHE  403

Query  306  ----QINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEG  361
                +++ +   + F  +++  A       R W + ++ +W+DS   T S +   V G+ 
Sbjct  404  GQQARLHSILAPVPFQQQISKLASRFV--GRKWLIAQLTKWIDS--PTASQMFW-VTGQI  458

Query  362  GTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARL  421
            G+GK+A    + Q     + A H    + +     R  +LS+ +Q+       K+  A L
Sbjct  459  GSGKTALAARLVQTI-PEIKAFHFAFEEDEQTQNARRCVLSLAYQLTTQ---LKDYAAFL  514

Query  422  NLKYVLEEADPML----LAAKVLVDPLNA---LEEPVQAAFMMVDGIDQCAAGAQGRNEL  474
              +  LEE  P+     L   +L+ PLN    L+       +++DG++  + G    + L
Sbjct  515  QAREPLEELVPVSTFNELVTHLLIKPLNEIAQLQSQNTPLVLLIDGLENLSDGKSDVSSL  574

Query  475  -----LEFFAQ--------IIPQLPTWVGFllsskpssklakrlPVSSVLDFSAENDAFV  521
                  + FAQ        ++ QLP WV      +          +++ L     N    
Sbjct  575  PVMTSRQSFAQCLVSALPSLVSQLPKWV------RVIVLSRNDPAINAKLQNFTPNIVLE  628

Query  522  ADVAPLVEDIARNFSDDDFVKAKS---------------MLKQKSGGNFAYLEFTKQALS  566
            A V    EDI + F +     + S               ++ ++S G F Y     Q+L 
Sbjct  629  AYVKENKEDI-KQFIEKSLCSSASTGLSSGKTLPPDQIDLIVERSEGLFLYAANVVQSLE  687

Query  567  HPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAS  626
                A      ++P+G    +   LYD +   F      G  +     +P+L+++  A  
Sbjct  688  EKWFAVGQ---SLPIG----MNGYLYDFFVSHF------GAKQYKRLIRPVLEVLCAA--  732

Query  627  GPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAV-RHGSYRIESSALCAWLSDPARSEE  685
              + P++         L   + + +  +F  L+++   GS R   S++  W+ +  +S +
Sbjct  733  --FEPLSLPTIASILKLQTNEQQEIATAFGSLLSIGADGSVRPFHSSVLNWVQE-LQSVD  789

Query  686  QFYFSI  691
             FY  +
Sbjct  790  PFYVDV  795

>PYIR_23360
Length=227

 Score = 33.5 bits (75),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  338  RVEEWL-DSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQF  376
            +V+EWL D R + G DI+LA+VG      S+F    AQQF
Sbjct  109  KVKEWLQDLRHHVGDDIVLAIVGNKCDVASSFNFAKAQQF  148

>PYVX_21776
Length=203

 Score = 33.1 bits (74),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 1/40 (3%)

Query  338  RVEEWL-DSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQF  376
            +++EWL D + + G DI+LAVVG      S+F    AQQF
Sbjct  106  KIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQF  145

>PITG_06580
Length=1214

 Score = 33.9 bits (76),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 10/114 (9%)

Query  352  DILLAVVGEGGTGKSAFCGTVAQQFR----------GNMLAAHCCQFDRKSKSTPRNVLL  401
            DI L +V    T  S+   +V Q             GN+L+A     D   K+ P NV +
Sbjct  445  DISLKIVNSSRTMSSSKFASVQQALERLMAKYTTLYGNLLSADVHSADDVGKTMPLNVFV  504

Query  402  SMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAF  455
               H  V +   F+++  R N        + + LA + L+ P+N     +  AF
Sbjct  505  YSFHVFVVSLLEFEDKFNRKNFSARYRVKNFIKLACRSLLQPVNYPRRLIIFAF  558

>PHYSO_545378
Length=224

 Score = 32.7 bits (73),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query  335  ALTRVEEWL-DSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQF  376
            +  +++EWL D + + G DI+LAVVG      S F  + AQQF
Sbjct  99   SFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQF  141

>PYU1_G012267
Length=217

 Score = 32.3 bits (72),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (3%)

Query  338  RVEEWL-DSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQF  376
            +++EWL D R +   DI+LAVVG      S+F    AQQF
Sbjct  104  KIKEWLQDLRHHVADDIVLAVVGNKCDVASSFNFAKAQQF  143

Lambda      K        H        a         alpha
   0.318    0.131    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 61692272991

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40