Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_3489011475352652627140.0
PHYCA_5561601475364947524310.0
PITG_184521475385649223760.0
PHYKE_83911475377850123750.0
PHYRA_508551475348946723730.0
HYAP_070951475361351322470.0
PHALS_064811475364446621280.0
PYAP_177619907562247720680.0
PYIR_134521475364549020500.0
PYAR_135699907549447620160.0
PYIW_199721475360949119640.0
PYVX_181701475351047118590.0
H257_084361475364250417160.0
H310_085901475364047117150.0
SPRG_141031475362847515960.0
SDRG_167201475362847515930.0
SPRG_0407412408750948710357e-135
SDRG_1440812408752848910323e-134
PHALS_08068109044974826492e-77
SDRG_038221356704944676483e-77
SDRG_150451241574944716449e-77
SDRG_03823114284974716441e-76
SDRG_111311368074944716405e-76
PYAR_17512109045335016364e-75
PYAP_21882109045024766274e-74
PHYSO_254571109044894786264e-74
PPTG_09787114284934726231e-73
PYIR_17506109045094846205e-73
SPRG_11769109044534676141e-72
PHYCA_504517114284934726161e-72
SDRG_12187109044624756113e-72
SPRG_05609114284964766143e-72
PHYKE_103271090612004886434e-72
PITG_14083114284934686073e-71
PPTG_18033109045004906064e-71
PHYRA_71927109044854796031e-70
PHYSO_550665114284914726031e-70
H257_09722114285184796023e-70
PHYRA_72037114284934725985e-70
CCA23647114284964575933e-69
PYAP_234351008029514726164e-69
H310_144471462305014735891e-68
H257_170371462304984525891e-68
PYIW_25301109045124835865e-68
CCI11048114284964575855e-68
HYAP_08763114284734565741e-66
H310_11259114285194885752e-66
PHALS_09136114284934725724e-66
PHYKE_6836114284934685681e-65
PITG_13427109044634675634e-65
PHYCA_7619109044624665563e-64
PYVX_21517109044824935052e-56
HYAP_04843109044304094862e-54
PYIR_23431114284684544665e-51
PYAR_177141008024444754637e-51
PYVX_16175114284464724226e-45
PYAP_226451707615654793845e-38
CCA22989124014944803674e-37
CCI10477124014944843641e-36
PYIR_20273124015054903605e-36
PYU1_G014259109042442313313e-34
SPRG_199431356703432713375e-34
HYAP_12621124015014773377e-33
PYVX_21248124015024343192e-30
PHYKE_9680124014984902952e-27
PHYRA_72215124014995122952e-27
PHALS_09942124014964822943e-27
PHYSO_556052124015004762926e-27
SPRG_09825124014924872845e-26
PITG_15359124014964802846e-26
SDRG_06945124014924872802e-25
PHYCA_123621124014954802793e-25
PYAR_20075170764694782686e-24
CCA16670151565204832554e-22
PHYRA_7388315665513722546e-22
H257_01186151564964782511e-21
CCI50816151568074832531e-21
PHYCA_50444515665483872492e-21
PPTG_0093815665505112474e-21
PYIW_24688114282592862364e-21
PHALS_1202815665793662475e-21
PYAR_16840151565365042465e-21
PHYRA_47253151564814922455e-21
PYU1_G011605151565244892441e-20
PYAP_19280151565124872422e-20
H310_00561151564974802412e-20
H310_02523124014944442384e-20
PPTG_09121151565204932376e-20
H257_16541124014944442332e-19
PYIW_251901648732061772202e-19
PYVX_20512151565284932313e-19
PHALS_10055151565164972305e-19
PITG_18935150674804782295e-19
PYIR_1413215665135092288e-19
PYIW_19795151565194872271e-18
SDRG_14446151564954752252e-18
PPTG_13000124013873352204e-18
PHYCA_555180151565214982226e-18
H310_0764115665483892226e-18
SPRG_1205415665585472209e-18
H257_0745015665673742191e-17
PYU1_G00569915665505302181e-17
PYIW_2025715665033602172e-17
SDRG_0506015665595182172e-17
HYAP_0414915665643992154e-17
PYVX_2349915665195212145e-17
PHYKE_980715665575252136e-17
CCI3999315665505232128e-17
PYAP_1914815665355242129e-17
PYAR_1666415665773962083e-16
CCA1403015665603942048e-16
PHYSO_48941815664714772038e-16
PHYKE_2864151564864902002e-15
PITG_0177815664704741861e-13
PYIR_21896151565184951807e-13
HYAP_08069650262552191739e-13
PITG_19065151564163321672e-11
PHYSO_562795151564153271663e-11
SPRG_04114151563763301475e-09
PPTG_247122910367621282e-08
HYAP_13613151564232251324e-07
PITG_19802156311851591241e-06
PYIW_2756812401128115900.011
PHYSO_507629634703100930.025
PYU1_G014369634703100920.034
SPRG_186431333348559820.048
SPRG_042311241579043820.052
PPTG_08060634725100860.21
PHALS_10960634702100840.34
PITG_00703634703100830.45
SPRG_17626132408148115780.53
PYAP_17256634705164820.63
PHYRA_8732873619486100810.68
CCI40989241655299810.69
PHYRA_72196634691100810.69
HYAP_080686502510064750.70
PHYSO_317690105671057163800.99
PYU1_G000378105671070172801.1
PYAP_15943241513930751.3
PHYCA_524942105671028171791.5
HYAP_03065634701128781.9
PYVX_21196634604144762.6
PYU1_G004385241656236753.7
PPTG_15916256859066744.5
PITG_02760241516530715.6
CCI50227539470775745.6
PYIR_159125937261746736.3
H257_04036125006104962736.4
PYVX_18330241655830737.3
PYU1_G010456564561745737.3
H310_07705241654668727.5
SPRG_08354241655068728.0
PYVX_1613284448390184728.1
SDRG_05159241655168728.5
PYAR_1582363470559728.6
PITG_025532233398112728.7
PHYKE_9463564560245729.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_348901

Length=527
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_348901                                                          1050       0.0   
PHYCA_556160                                                          941        0.0   
PITG_18452                                                            919        0.0   
PHYKE_8391                                                            919        0.0   
PHYRA_50855                                                           918        0.0   
HYAP_07095                                                            870        0.0   
PHALS_06481                                                           824        0.0   
PYAP_17761                                                            801        0.0   
PYIR_13452                                                            794        0.0   
PYAR_13569                                                            781        0.0   
PYIW_19972                                                            761        0.0   
PYVX_18170                                                            720        0.0   
H257_08436                                                            665        0.0   
H310_08590                                                            665        0.0   
SPRG_14103                                                            619        0.0   
SDRG_16720                                                            618        0.0   
SPRG_04074                                                            403        7e-135
SDRG_14408                                                            402        3e-134
PHALS_08068                                                           254        2e-77 
SDRG_03822                                                            254        3e-77 
SDRG_15045                                                            252        9e-77 
SDRG_03823                                                            252        1e-76 
SDRG_11131                                                            251        5e-76 
PYAR_17512                                                            249        4e-75 
PYAP_21882                                                            246        4e-74 
PHYSO_254571                                                          245        4e-74 
PPTG_09787                                                            244        1e-73 
PYIR_17506                                                            243        5e-73 
SPRG_11769                                                            241        1e-72 
PHYCA_504517                                                          241        1e-72 
SDRG_12187                                                            239        3e-72 
SPRG_05609                                                            241        3e-72 
PHYKE_10327                                                           252        4e-72 
PITG_14083                                                            238        3e-71 
PPTG_18033                                                            238        4e-71 
PHYRA_71927                                                           236        1e-70 
PHYSO_550665                                                          236        1e-70 
H257_09722                                                            236        3e-70 
PHYRA_72037                                                           234        5e-70 
CCA23647                                                              233        3e-69 
PYAP_23435                                                            241        4e-69 
H310_14447                                                            231        1e-68 
H257_17037                                                            231        1e-68 
PYIW_25301                                                            230        5e-68 
CCI11048                                                              229        5e-68 
HYAP_08763                                                            225        1e-66 
H310_11259                                                            226        2e-66 
PHALS_09136                                                           224        4e-66 
PHYKE_6836                                                            223        1e-65 
PITG_13427                                                            221        4e-65 
PHYCA_7619                                                            218        3e-64 
PYVX_21517                                                            199        2e-56 
HYAP_04843                                                            191        2e-54 
PYIR_23431                                                            184        5e-51 
PYAR_17714                                                            182        7e-51 
PYVX_16175                                                            167        6e-45 
PYAP_22645                                                            152        5e-38 
CCA22989                                                              145        4e-37 
CCI10477                                                              144        1e-36 
PYIR_20273                                                            143        5e-36 
PYU1_G014259                                                          132        3e-34 
SPRG_19943                                                            134        5e-34 
HYAP_12621                                                            134        7e-33 
PYVX_21248                                                            127        2e-30 
PHYKE_9680                                                            118        2e-27 
PHYRA_72215                                                           118        2e-27 
PHALS_09942                                                           117        3e-27 
PHYSO_556052                                                          117        6e-27 
SPRG_09825                                                            114        5e-26 
PITG_15359                                                            114        6e-26 
SDRG_06945                                                            112        2e-25 
PHYCA_123621                                                          112        3e-25 
PYAR_20075                                                            107        6e-24 
CCA16670                                                              102        4e-22 
PHYRA_73883                                                           102        6e-22 
H257_01186                                                            101        1e-21 
CCI50816                                                              102        1e-21 
PHYCA_504445                                                          100        2e-21 
PPTG_00938                                                            99.8       4e-21 
PYIW_24688                                                            95.5       4e-21 
PHALS_12028                                                           99.8       5e-21 
PYAR_16840                                                            99.4       5e-21 
PHYRA_47253                                                           99.0       5e-21 
PYU1_G011605                                                          98.6       1e-20 
PYAP_19280                                                            97.8       2e-20 
H310_00561                                                            97.4       2e-20 
H310_02523                                                            96.3       4e-20 
PPTG_09121                                                            95.9       6e-20 
H257_16541                                                            94.4       2e-19 
PYIW_25190                                                            89.4       2e-19 
PYVX_20512                                                            93.6       3e-19 
PHALS_10055                                                           93.2       5e-19 
PITG_18935                                                            92.8       5e-19 
PYIR_14132                                                            92.4       8e-19 
PYIW_19795                                                            92.0       1e-18 
SDRG_14446                                                            91.3       2e-18 
PPTG_13000                                                            89.4       4e-18 
PHYCA_555180                                                          90.1       6e-18 
H310_07641                                                            90.1       6e-18 
SPRG_12054                                                            89.4       9e-18 
H257_07450                                                            89.0       1e-17 
PYU1_G005699                                                          88.6       1e-17 
PYIW_20257                                                            88.2       2e-17 
SDRG_05060                                                            88.2       2e-17 
HYAP_04149                                                            87.4       4e-17 
PYVX_23499                                                            87.0       5e-17 
PHYKE_9807                                                            86.7       6e-17 
CCI39993                                                              86.3       8e-17 
PYAP_19148                                                            86.3       9e-17 
PYAR_16664                                                            84.7       3e-16 
CCA14030                                                              83.2       8e-16 
PHYSO_489418                                                          82.8       8e-16 
PHYKE_2864                                                            81.6       2e-15 
PITG_01778                                                            76.3       1e-13 
PYIR_21896                                                            73.9       7e-13 
HYAP_08069                                                            71.2       9e-13 
PITG_19065                                                            68.9       2e-11 
PHYSO_562795                                                          68.6       3e-11 
SPRG_04114                                                            61.2       5e-09 
PPTG_24712                                                            53.9       2e-08 
HYAP_13613                                                            55.5       4e-07 
PITG_19802                                                            52.4       1e-06 
PYIW_27568                                                            39.3       0.011 
PHYSO_507629                                                          40.4       0.025 
PYU1_G014369                                                          40.0       0.034 
SPRG_18643                                                            36.2       0.048 
SPRG_04231                                                            36.2       0.052 
PPTG_08060                                                            37.7       0.21  
PHALS_10960                                                           37.0       0.34  
PITG_00703                                                            36.6       0.45  
SPRG_17626                                                            34.7       0.53  
PYAP_17256                                                            36.2       0.63  
PHYRA_87328                                                           35.8       0.68  
CCI40989                                                              35.8       0.69  
PHYRA_72196                                                           35.8       0.69  
HYAP_08068                                                            33.5       0.70  
PHYSO_317690                                                          35.4       0.99  
PYU1_G000378                                                          35.4       1.1   
PYAP_15943                                                            33.5       1.3   
PHYCA_524942                                                          35.0       1.5   
HYAP_03065                                                            34.7       1.9   
PYVX_21196                                                            33.9       2.6   
PYU1_G004385                                                          33.5       3.7   
PPTG_15916                                                            33.1       4.5   
PITG_02760                                                            32.0       5.6   
CCI50227                                                              33.1       5.6   
PYIR_15912                                                            32.7       6.3   
H257_04036                                                            32.7       6.4   
PYVX_18330                                                            32.7       7.3   
PYU1_G010456                                                          32.7       7.3   
H310_07705                                                            32.3       7.5   
SPRG_08354                                                            32.3       8.0   
PYVX_16132                                                            32.3       8.1   
SDRG_05159                                                            32.3       8.5   
PYAR_15823                                                            32.3       8.6   
PITG_02553                                                            32.3       8.7   
PHYKE_9463                                                            32.3       9.2   

>PHYSO_348901
Length=526

 Score = 1050 bits (2714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/526 (100%), Positives = 526/526 (100%), Gaps = 0/526 (0%)

Query  1    MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60
            MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF
Sbjct  1    MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60

Query  61   GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120
            GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA
Sbjct  61   GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120

Query  121  DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT  180
            DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT
Sbjct  121  DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT  180

Query  181  KQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFL  240
            KQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFL
Sbjct  181  KQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFL  240

Query  241  KGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKW  300
            KGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKW
Sbjct  241  KGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKW  300

Query  301  TTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIG  360
            TTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIG
Sbjct  301  TTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIG  360

Query  361  DVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERY  420
            DVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERY
Sbjct  361  DVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERY  420

Query  421  GEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQA  480
            GEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQA
Sbjct  421  GEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQA  480

Query  481  MGLAMKLGFTYDQMVDTVGIHPttaetfttleitKSSggtttgggC  526
            MGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKSSGGTTTGGGC
Sbjct  481  MGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKSSGGTTTGGGC  526

>PHYCA_556160
Length=649

 Score = 941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/475 (93%), Positives = 461/475 (97%), Gaps = 0/475 (0%)

Query  28   SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87
            S  D  ET+YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN
Sbjct  151  STADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  210

Query  88   VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147
            VGCIPKKLMHQSSLIGE++HHD ANFGWN++S DG+A TF+WKQLV+NVDGYI+ INFKY
Sbjct  211  VGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKY  270

Query  148  KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  207
            KVELRSKYVKYENFLGSFV+ HTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA
Sbjct  271  KVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  330

Query  208  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
            ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMA+KI
Sbjct  331  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKI  390

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
            GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFDTVLNATGRDPDVAK
Sbjct  391  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAK  450

Query  328  LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
            L LDKA VKLNEK+GRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS
Sbjct  451  LNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  510

Query  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
            T QMDY+K+CTAVFTPIEYGCCG+SEEDSKER+GEDNIEVYH NFVPLEWSLS +TRTAA
Sbjct  511  TVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAA  570

Query  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP
Sbjct  571  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  625

>PITG_18452
Length=856

 Score = 919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/492 (91%), Positives = 468/492 (95%), Gaps = 0/492 (0%)

Query  26   TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
            T S   + E SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  151  TSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  210

Query  86   VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
            VNVGCIPKKLMHQSSLIGE++HHDSA+FGWN++S  GSA  F WKQLV NVDGYIRGINF
Sbjct  211  VNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINF  270

Query  146  KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
            KYKVELRSKYVKYENFLGSF+D HTLELWHPRKG+KQITTRDVVIAVGGRP+ELT PGGE
Sbjct  271  KYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGE  330

Query  206  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
            HAISSDDIFWMK KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN
Sbjct  331  HAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  390

Query  266  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
            KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT+EDGESCEEAFD+VLNATGRDPD+
Sbjct  391  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDI  450

Query  326  AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
            AKL LDKA VKLNEKTGRIWVK+EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN
Sbjct  451  AKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  510

Query  386  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
            N+T QMDYDK+CTAVFTPIEYGCCGLSEEDS +R+G+D IEVYH NFVPLEWSLS ETR 
Sbjct  511  NATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRA  570

Query  446  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPtta  505
            AAESCY+KVICD+ RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  571  AAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  630

Query  506  etfttleitKSS  517
            E+FTTLE+TKSS
Sbjct  631  ESFTTLEVTKSS  642

>PHYKE_8391
Length=778

 Score = 919 bits (2375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/501 (90%), Positives = 474/501 (95%), Gaps = 1/501 (0%)

Query  26   TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
            TP+   E ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC
Sbjct  279  TPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  338

Query  86   VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
            VNVGCIPKKLMHQSSLIGE MHHDSANFGWN+AS +G  +TF WKQLV+NVD YI+ INF
Sbjct  339  VNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINF  398

Query  146  KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
            KYKVELRSKYVKYENFLGSF+D HTLELWHPRKGTKQITTR VV+AVGGRPK+LTCPG E
Sbjct  399  KYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAE  458

Query  206  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
            +AISSDDIFWMKK  PGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN
Sbjct  459  YAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  518

Query  266  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
            KIGEYMEVQ+GIEFIRKTVP+SITKLENGQLLVKWTTED ESCEE FDTVLNATGRDPDV
Sbjct  519  KIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDV  578

Query  326  AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
            AKLGLDKA VKLNEKTGRIW KNEQTSTPNI+AIGDVIDAPELTPVAIQAGR LSRRLYN
Sbjct  579  AKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638

Query  386  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
            NST QMDYDK+CTAVFTPIEYGCCGLSEEDS ER+GEDN+EVYHKNFVPLEWSLS E+RT
Sbjct  639  NSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLS-ESRT  697

Query  446  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPtta  505
            ++ESCY+KVICD TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA
Sbjct  698  SSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  757

Query  506  etfttleitKSSggtttgggC  526
            E FTTLE+TKSSG TTTGGGC
Sbjct  758  EAFTTLEVTKSSGATTTGGGC  778

>PHYRA_50855
Length=489

 Score = 918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/467 (94%), Positives = 455/467 (97%), Gaps = 2/467 (0%)

Query  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
            SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  96   MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155
            MHQSSLIGE+MHHDSANFGWN+AS +GSA TF+WKQLV+NVD YI+ INFKYKVELRSKY
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKY  119

Query  156  VKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  215
            VKYENFLGSFVD HTLELWH RKGTKQITTRDVVIAVGGRPKEL+CPGGEHAISSDDIFW
Sbjct  120  VKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFW  179

Query  216  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQS  275
            MKKKEPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFDQDMANKIGEYMEVQS
Sbjct  180  MKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQS  239

Query  276  GIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARV  335
            GIEFIRKTVPQSIT LENGQLLVKWT EDGESCEEAFDTVLNATGRDPDVAKLGLDKA V
Sbjct  240  GIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGV  299

Query  336  KLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDK  395
            KLNEK+GRIWVKNEQTST NIYA+GDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDY+K
Sbjct  300  KLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEK  359

Query  396  ICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI  455
            +CTAVFTPIEYGCCGLSEEDSKER+GEDN+EVYH NFVPLEWSLS ETRT+AESCY+KVI
Sbjct  360  VCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVI  418

Query  456  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP
Sbjct  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  465

>HYAP_07095
Length=613

 Score = 870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/513 (83%), Positives = 468/513 (91%), Gaps = 0/513 (0%)

Query  14   NTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPS  73
            +T    ++++  TP  V E + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPS
Sbjct  101  DTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPS  160

Query  74   PQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLV  133
            P GTSWGLGGTCVNVGCIPKKLMHQSSLIGE++HHD A+FGWN+ S +G   TF WKQLV
Sbjct  161  PHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLV  220

Query  134  ANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVG  193
            +NV  YI+ I+FKYKVELRSK VKYEN LGSFVD HTL+LWHP+KGTK+ITTR VVIAVG
Sbjct  221  SNVSSYIKSISFKYKVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVG  280

Query  194  GRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253
            GRP++L C GGE A+SSDDIFWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRS
Sbjct  281  GRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS  340

Query  254  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFD  313
            ILLRGFDQDMA+KIGEYME+QSGIEFIRKTVPQSITKL++GQLLVKW TEDG+  EE FD
Sbjct  341  ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFD  400

Query  314  TVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAI  373
            TVLNATGRDPDVAKLGLD+A VKLNEKTGRIWV NEQT+TPN+YAIGDVIDAPELTPVAI
Sbjct  401  TVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAI  460

Query  374  QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
            QAGRLLSRRLYN  T QMDYDKICTAVFTPIEYGCCGLSEEDSKE YG+D++EVYHKNFV
Sbjct  461  QAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520

Query  434  PLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493
            PLEWSL+E+TR AAESCY+KV+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ
Sbjct  521  PLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  580

Query  494  MVDTVGIHPttaetfttleitKSSggtttgggC  526
            +VDTVGIHPTTAE FTTLE TKSSG +TTGGGC
Sbjct  581  LVDTVGIHPTTAEAFTTLETTKSSGDSTTGGGC  613

>PHALS_06481
Length=644

 Score = 824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/466 (84%), Positives = 430/466 (92%), Gaps = 0/466 (0%)

Query  37   YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
            +DYDLVVIGGG GGLACSKEAASFGQKVCVLDYVKPSPQGT+WGLGGTCVNVGCIPKKL+
Sbjct  155  FDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLI  214

Query  97   HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            HQSSLIGE++ HDSA FGW   +   +   F WKQLVANVDGYI+ INFKYKV+LRSK V
Sbjct  215  HQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNV  274

Query  157  KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216
            KYENFLGSFVD HT++L HPRKGTKQITTR+VVIAVG RP+ELTCPGGE+A+SSDDIFWM
Sbjct  275  KYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWM  334

Query  217  KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276
            K+KEPGKTLV+GASYVALECAGFLKGMGY+VKVMVRSILLR FDQ+MA+KIGEYMEVQSG
Sbjct  335  KEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSG  394

Query  277  IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336
            I+FIRKTVPQSI++LEN QLLVKW  E G++CEEAF+TVLNATGRDP+VA LGLDKA VK
Sbjct  395  IKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVK  454

Query  337  LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396
            LNEKTGRI VKNEQTST NIYAIGDV+DAPELTPVAIQ+GRLLS+RLYNNS+ QMDYDK+
Sbjct  455  LNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKV  514

Query  397  CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456
            CT VFTPIEYGCCGLSEE SK RYGEDNIE+YH NFVPLEWSLS ETRTA+ SCY+KV+C
Sbjct  515  CTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVC  574

Query  457  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            DK+RDKFV+GFHYLGPNAGEV QAMGLAM+L FTYDQMV+TVGIHP
Sbjct  575  DKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHP  620

>PYAP_17761
Length=622

 Score = 801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/477 (79%), Positives = 428/477 (90%), Gaps = 8/477 (2%)

Query  26   TPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  85
            TP AVDE++T YDYDLVVIGGGSGGLACSKEAA +G+KVCVLDYVKPSP GT+WGLGGTC
Sbjct  130  TPVAVDESKT-YDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTC  188

Query  86   VNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINF  145
            VNVGCIPKKLMHQS+LIGELMH D+  FGWN+         F+W QLV +V+ YI+GINF
Sbjct  189  VNVGCIPKKLMHQSALIGELMHKDAGAFGWNMGE-----QKFTWTQLVESVNNYIKGINF  243

Query  146  KYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  205
            KYKVELR K VKYENFLGSFVD HT+ELWH +KGTK ITTR VV+AVGGRP++L+CPGGE
Sbjct  244  KYKVELRDKKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGE  303

Query  206  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  265
            HAISSDDIFW +K EPGKTLVVGASYVALECAGFLKGMGY+VKVMVRSILLRGFD+DMAN
Sbjct  304  HAISSDDIFW-RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMAN  362

Query  266  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
            +IG++M+ +S IEFIR  VP+SI KLENGQLLVKW + DGE+ EE FD+VLNATGRDPDV
Sbjct  363  RIGDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDV  422

Query  326  AKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
            +KL LDKA V+LN KTGRI V NEQTSTPN++AIGDVIDAPELTPVAIQAGRLL+RRLYN
Sbjct  423  SKLNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYN  482

Query  386  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
            N T  MDYDK+CTAVFTPIEYGCCGLSEE +K++YGEDN+E+YH++F+PLEWSLS++ R 
Sbjct  483  NETTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQD-RV  541

Query  446  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            AA +CY+KVICDKTRDK+VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHP
Sbjct  542  AANTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHP  598

>PYIR_13452
Length=645

 Score = 794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/490 (80%), Positives = 432/490 (88%), Gaps = 7/490 (1%)

Query  37   YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
            YDYDL+VIGGGSGGLACSKEA+ +G+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLM
Sbjct  163  YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222

Query  97   HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            HQSSLIGE +H D+  FGW +        TF W Q++ +V+ YI+ INFKYKVELR K V
Sbjct  223  HQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVELRDKKV  277

Query  157  KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216
            KYEN LGSFVDAHTLELWHP+KGTK +TTRDVVIAVGGRPK L+C GG+ AISSDDIFW 
Sbjct  278  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-  336

Query  217  KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276
            +K+ PGKTLVVGASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMANKIGE+ME +S 
Sbjct  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESK  396

Query  277  IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336
            IEFIR  VPQSITKLE+GQLLVKW + DGE+CEEAFDTVLNATGRDPDVAKLGLDK  VK
Sbjct  397  IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456

Query  337  LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396
            LN KTGRI V NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLL+RRLYNN TA MDYDK+
Sbjct  457  LNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKV  516

Query  397  CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456
            CTAVFTPIEYGCCGLSEE S E+YGE+N+E+YH+NF PLEWSLS + R AA SCY+KVIC
Sbjct  517  CTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVIC  575

Query  457  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaetfttleitKS  516
            D  R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLE+TKS
Sbjct  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKS  635

Query  517  SggtttgggC  526
            SG +   GGC
Sbjct  636  SGESAASGGC  645

>PYAR_13569
Length=494

 Score = 781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/476 (79%), Positives = 417/476 (88%), Gaps = 8/476 (2%)

Query  27   PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCV  86
            P  VD+ E +YDYDLVVIGGGSGGLACSKEAA  G+KV VLDYVKPSP GT+WGLGGTCV
Sbjct  3    PMDVDD-EATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCV  61

Query  87   NVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFK  146
            NVGCIPKKLMHQS+L+GELMH D+  FGW        A +F+W QLVA+V+ YI+GINFK
Sbjct  62   NVGCIPKKLMHQSALLGELMHKDAPAFGWTTG-----AQSFTWTQLVASVNNYIKGINFK  116

Query  147  YKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEH  206
            YKVELR K VKYENFLGSFVDAHT+ELWH +K  K +TTR VVIAVGGRP+ LTCPGGEH
Sbjct  117  YKVELRDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEH  176

Query  207  AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANK  266
            AISSDDIFW +K EPGKTLVVGASYVALECAGFLKGMGYDVK+MVRSILLRGFDQDMAN+
Sbjct  177  AISSDDIFW-RKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANR  235

Query  267  IGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVA  326
            IG++M+ +S IEFIR  VP+SI K ENG+LLVKW + DG+  EE FDTVLNATGRDPDV 
Sbjct  236  IGDFMQDESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVT  295

Query  327  KLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
            KL LDKA V+LN K+GRI   NEQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYNN
Sbjct  296  KLNLDKAGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN  355

Query  387  STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
             T  MDYDKICTAVFTPIEYGCCGLSEED+K +YGE+N+E+YH++F+PLEWSLSEE R A
Sbjct  356  ETTLMDYDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEE-RVA  414

Query  447  AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            A +CY+KVICDKTRDK VVGFHYLGPNAGEVTQAMGLAMK+GFTYDQMV+ VGIHP
Sbjct  415  AATCYVKVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHP  470

>PYIW_19972
Length=609

 Score = 761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/491 (78%), Positives = 430/491 (88%), Gaps = 7/491 (1%)

Query  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
            +YDYDL+VIGGGSGGLACSKEAA +G+KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKL
Sbjct  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185

Query  96   MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155
            MHQSSLIGE +H D+A FGW++         F W Q++ +V+ YI+ INFKYKVELR K 
Sbjct  186  MHQSSLIGETIHKDAAAFGWSVGE-----QKFDWAQMLKSVNSYIKSINFKYKVELRDKK  240

Query  156  VKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  215
            VKYEN LGSFVDAHTLELWHP+KGTK +TTRDVVIAVGGRPK L+C GGE AISSDDIFW
Sbjct  241  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW  300

Query  216  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQS  275
             +K+ PGKTLV+GASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMA+KIGE+MEV+S
Sbjct  301  -RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVES  359

Query  276  GIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARV  335
             IEFIR  VPQSITKLE+GQLLVKW + DG+ CEEAFDTVLNATGRDPDVAKL LD   V
Sbjct  360  KIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGV  419

Query  336  KLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDK  395
            +LN KTGRI V NEQTS PNI+AIGDVIDAPELTPVAIQAGR+L+RRLYNN TA MDYDK
Sbjct  420  QLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDK  479

Query  396  ICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI  455
            +CTAVFTPIEYGCCGLSEE S E++GED +E+YH+NF PLEWSLS + R AA SCY+KVI
Sbjct  480  VCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVKVI  538

Query  456  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPttaetfttleitK  515
            CD TR+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYD MV+ VGIHPTTAE FTTLE+TK
Sbjct  539  CDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTK  598

Query  516  SSggtttgggC  526
            SSG +   GGC
Sbjct  599  SSGESAAAGGC  609

>PYVX_18170
Length=510

 Score = 720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/471 (78%), Positives = 411/471 (87%), Gaps = 5/471 (1%)

Query  56   EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGW  115
            EA+ FGQKV VLDYVKPSPQGT WGLGGTCVNVGCIPKKLMHQS+LIGE+MH D+A FGW
Sbjct  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104

Query  116  NIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWH  175
               +A      F W QL ++V  YI+ +NFKYKV+LR K VKYENFLG+FVD HT+EL +
Sbjct  105  QFENA----PKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSN  160

Query  176  PRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALE  235
            PRK +K +TTR VV+AVGGRP+ L CPGGE +I+SDDIFW +K  PGKTLVVGASYVALE
Sbjct  161  PRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFW-RKTAPGKTLVVGASYVALE  219

Query  236  CAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  295
            CAGFLKG GYDVKVMVRSILLRGFDQDMAN+IGEYMEV++GIEFIR+TVP SITKLE+G+
Sbjct  220  CAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGK  279

Query  296  LLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPN  355
            LLVKWT  DG + EEAFDTVLNATGR+PDV KL LDKA VKLN KTGRI V NEQTSTPN
Sbjct  280  LLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPN  339

Query  356  IYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEED  415
            I+AIGDVIDAPELTPVAIQAGRLL+RRLYNN T  MDY+K+CTAVFTPIEYGCCGLSEE+
Sbjct  340  IFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEE  399

Query  416  SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAG  475
            S ER+GEDNIEVYH+NF PLEW+LS++TR +  +CYLKVICDKTRD FVVGFHYLGPNAG
Sbjct  400  SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459

Query  476  EVTQAMGLAMKLGFTYDQMVDTVGIHPttaetfttleitKSSggtttgggC  526
            EVTQA+GLAMKLGFTY+QMV  VGIHPTTAETFTTLE+TKSSG +  GG C
Sbjct  460  EVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAGGNC  510

>H257_08436
Length=642

 Score = 665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/504 (65%), Positives = 389/504 (77%), Gaps = 18/504 (4%)

Query  1    MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60
            +A  R   Q +      +  IH   T     +A+  YD+DLVVIGGGSGGLACSKEA+  
Sbjct  131  LAFFRARTQSAPSAPASSASIHANDT----SDADVKYDWDLVVIGGGSGGLACSKEASKL  186

Query  61   GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120
            GQKV VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQSS+IGE++H D+  FGW++++A
Sbjct  187  GQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGEILHKDADQFGWSVSNA  246

Query  121  DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWH--PRK  178
                 TF W +LV++V  YI G+NFKY+V+LR K VKYEN LG+F DAHTL L +   +K
Sbjct  247  -----TFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFKDAHTLTLTNDAKKK  301

Query  179  GTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAG  238
            G   +T R  VIAVGGRPK L+CPG EHA+SSDDIF  K   PGKTLVVGASYVALECAG
Sbjct  302  GPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF-SKPDAPGKTLVVGASYVALECAG  360

Query  239  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  298
            FLKG G+DV +MVRSILLRGFDQD+A +IGEYME +SGI FI+++VP SI KLENGQ  V
Sbjct  361  FLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVPTSIVKLENGQFQV  420

Query  299  KWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYA  358
              TT      ++ +DT+LNATGR PDV KL LD A V LN K+GRI V NEQTSTPNIYA
Sbjct  421  THTTG-----QDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIHVVNEQTSTPNIYA  475

Query  359  IGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKE  418
            +GDVIDAPELTPVAIQAG+LLSRRL+ N T  MDY KICTAVFTP+EYGCCGLSEED+  
Sbjct  476  LGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVEYGCCGLSEEDAIA  535

Query  419  RYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
              G +N+EVYH+NF PLEWSLS + R  A+ CY K+I D T+ K V+GFHYLGPNAGEVT
Sbjct  536  SAGRENVEVYHQNFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVLGFHYLGPNAGEVT  594

Query  479  QAMGLAMKLGFTYDQMVDTVGIHP  502
            QA+G+A+KL  TYD  ++TVGIHP
Sbjct  595  QAIGIAIKLNATYDDFINTVGIHP  618

>H310_08590
Length=640

 Score = 665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 377/471 (80%), Gaps = 14/471 (3%)

Query  34   ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
            ET YD+DLVVIGGGSGGLACSKEA+  GQKV VLDYVKPSP G++WGLGGTCVNVGCIPK
Sbjct  158  ETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  217

Query  94   KLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153
            KLMHQSS+IGEL+H D+  FGW +++A     +F W +LV++V  YI G+NFKY+++LR 
Sbjct  218  KLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDLRD  272

Query  154  KYVKYENFLGSFVDAHTLELWH--PRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSD  211
            K VKYEN LG+F DAHTL L +   +KG   +T R  VIAVGGRPK L+CPG EHAISSD
Sbjct  273  KKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSD  332

Query  212  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYM  271
            DIF  K + PGKTLVVGASYVALECAGFLKG G+DV +MVRSILLRGFDQD+A +IGEYM
Sbjct  333  DIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYM  391

Query  272  EVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLD  331
            E +SGI FI+++VP SI KL NGQL V  T  +G      +DTVLNATGR PDV  L L 
Sbjct  392  ENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLP  446

Query  332  KARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQM  391
             A V LN K+GRI V NEQTSTP+IYAIGDVIDAPELTPVAIQAG+LL+RRL+ N TA M
Sbjct  447  AAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALM  506

Query  392  DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCY  451
            DY KICTAVFTP+EYGCCGLSEED+    G DNI+VYH+NF PLEWSLS E R  A+ CY
Sbjct  507  DYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RPLAKECY  565

Query  452  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             K+I D T+ K VVGFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHP
Sbjct  566  AKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHP  616

>SPRG_14103
Length=628

 Score = 619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 371/475 (78%), Gaps = 15/475 (3%)

Query  30   VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
            VD+  T YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKPSPQG++WGLGGTCVNVG
Sbjct  143  VDDGAT-YDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVG  201

Query  90   CIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKV  149
            CIPKKLMHQS+++GEL+H D+  FGW + +A     TF W +LV +V  YI G+NFKY+V
Sbjct  202  CIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLVTSVQDYIHGLNFKYRV  256

Query  150  ELRSKYVKYENFLGSFVDAHTLELWHPRKG--TKQITTRDVVIAVGGRPKELTCPGGEHA  207
            +LR K VKYENFLG+F DAHTL L +P KG   K +T R  +IAVGGRPK L CPG + A
Sbjct  257  DLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLA  316

Query  208  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
            ISSDDIF  +   PGKTLVVGASYVALECAGFLK  G+DV VMVRSILLRGFD DMA +I
Sbjct  317  ISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARI  375

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
            G YME ++ I+FI+  VP SI +L NGQL V  T  +G      +DTVLNATGR+PDV+ 
Sbjct  376  GTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSG  430

Query  328  LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
            L L  A V LN KTGRI V +EQTS P+IYA+GDVID PELTPVAIQAGRLL++RL++NS
Sbjct  431  LNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNS  490

Query  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
               M YDK+CTAVFTPIEYGCCGLSE+ + E  G DN+ VYH++F PLEWSLS + R  A
Sbjct  491  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHD-RALA  549

Query  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            + CY K+I D+T++  VVGFHYLGPNAGEVTQA+G+AMKL  +YD  V TVGIHP
Sbjct  550  KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHP  604

>SDRG_16720
Length=628

 Score = 618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 371/475 (78%), Gaps = 15/475 (3%)

Query  30   VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
            VD+  T YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKPSPQG++WGLGGTCVNVG
Sbjct  143  VDDGAT-YDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVG  201

Query  90   CIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKV  149
            CIPKKLMHQS+++GEL+H D+  FGW + +A     TF W +L+ +V  YI G+NFKY+V
Sbjct  202  CIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRV  256

Query  150  ELRSKYVKYENFLGSFVDAHTLELWHPRKG--TKQITTRDVVIAVGGRPKELTCPGGEHA  207
            +LR K VKYENFLG+F DAHTL L +P KG   K +T R  +IAVGGRPK L CPG + A
Sbjct  257  DLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLA  316

Query  208  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267
            ISSDDIF  +   PGKTLVVGASYVALECAGFLKG G+DV VMVRSILLRGFD DMA +I
Sbjct  317  ISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARI  375

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
            G YME ++ I FI+  VP SI +L NGQL V  T  +G      +DTVLNATGR PDV+ 
Sbjct  376  GTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSG  430

Query  328  LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
            L L  A V LN KTGRI V +EQTSTP+IYA+GDVID PELTPVAIQAGRLLS+RL++NS
Sbjct  431  LNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490

Query  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
               M YDK+CTAVFTPIEYGCCGLSE+ + E  G DN+ VYH++F PLEWSLS + R  A
Sbjct  491  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALA  549

Query  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            + CY K+I D+T++  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHP
Sbjct  550  KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHP  604

>SPRG_04074
Length=509

 Score = 403 bits (1035),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 308/487 (63%), Gaps = 29/487 (6%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  2    SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  61

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +MH S ++G  + HD+A+ GW +          +W+ LV  V  +++ +NF Y+V LRS 
Sbjct  62   IMHYSGILGAGL-HDAAHLGWQVP----EKVEHNWETLVEAVQAHVKKLNFSYRVGLRSN  116

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPK-ELTCPG-GEHAISSDD  212
             V+Y N L  F D HTL        T+ +T   ++IA GGRP      PG  E+AI+SDD
Sbjct  117  KVQYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDD  176

Query  213  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYME  272
            +F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + M 
Sbjct  177  LFSLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-  234

Query  273  VQSGIEFIRKTVPQSITKLE-NGQLLVKWT-TEDGESCEEAFDTVLNATGRDPDVAKLGL  330
            V  G++F   T+P SI K E  GQL V +  +E  E+  EAFDTVL A GR  D   +GL
Sbjct  235  VAQGMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGL  294

Query  331  DKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-NST  388
            +KA VK     G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T
Sbjct  295  EKAGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYT  353

Query  389  AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAE  448
              M+YD I T VFTP+EYG  GLSEE++  RYG+D+I VY   F  LEW      R  AE
Sbjct  354  KTMNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVH--RKKAE  411

Query  449  S-------------CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
            S             C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T +   
Sbjct  412  SAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFD  471

Query  496  DTVGIHP  502
            + +GIHP
Sbjct  472  NVIGIHP  478

>SDRG_14408
Length=528

 Score = 402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 234/489 (48%), Positives = 310/489 (63%), Gaps = 33/489 (7%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+  GT WGLGGTCVNVGC+PKK
Sbjct  21   SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  80

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +MH S ++G  + HD+A+ GW +          +W+ LV  V  +++ +NF Y+V LRS 
Sbjct  81   IMHYSGILGAGL-HDAAHLGWQLP----EKVEHNWETLVETVQAHVKKLNFSYRVGLRSN  135

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR---PKELTCPG-GEHAISS  210
             V+Y N L  F D HTL        T+ +T   ++IA GGR   PKE+  PG GE+AI+S
Sbjct  136  KVQYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEI--PGVGEYAITS  193

Query  211  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  270
            DD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A KI + 
Sbjct  194  DDLFSLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDI  252

Query  271  MEVQSGIEFIRKTVPQSITKLE-NGQLLVKW-TTEDGESCEEAFDTVLNATGRDPDVAKL  328
            M V  G++F   T+P SI K +  GQL V +  +E  E+  E FDTVL A GR  D   +
Sbjct  253  M-VAQGMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNI  311

Query  329  GLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLSRRLYN-N  386
            GL+K  VK     G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N
Sbjct  312  GLEKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPN  370

Query  387  STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
             T  M+YD I T VFTP+EYG  GLSEE++  RYG+D++ VY   F  LEW      R  
Sbjct  371  YTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVH--RQK  428

Query  447  AES-------------CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493
            AES             C  K++C K+ ++ V+GFH++GPNAGEVTQ   +A+ +G T + 
Sbjct  429  AESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKED  488

Query  494  MVDTVGIHP  502
              + +GIHP
Sbjct  489  FDNVIGIHP  497

>PHALS_08068
Length=497

 Score = 254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 167/482 (35%), Positives = 256/482 (53%), Gaps = 36/482 (7%)

Query  34   ETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
            +T YDY  +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+P
Sbjct  21   QTEYDY--LVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVP  69

Query  93   KKLMHQSSLIGELMHHDSANFGWNIASADGSAS---TFSWKQLVANVDGYIRGINFKYKV  149
            KKLM+ ++ +   +HHD   +G+  A+  G  S    F+W +L A  D Y+  +N  Y+ 
Sbjct  70   KKLMYIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYET  129

Query  150  ELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAIS  209
             L +  V        F +   +E+       K++  + ++IAVGGRP     PG E  I 
Sbjct  130  NLANSKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRPLIPDIPGKELCID  184

Query  210  SDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIG  268
            SD  F ++   P K  +VGA Y+A+E AG L  +G    V  R   +LR FD  +   + 
Sbjct  185  SDGFFELETL-PTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLE  243

Query  269  EYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKL  328
            E M    G+     +    + +  +G   +  T     S    FD V+ ATGR P  + L
Sbjct  244  EAM-ANDGVHLRPNSTVARVKEAADGTKTLVLTN---GSEHRGFDVVICATGRVPLTSTL  299

Query  329  GLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-  386
             L+KA +  ++  G I V   ++T+  N+YA+GDV + P LTPVAI AGR LS RL+   
Sbjct  300  NLEKAGITTDD-NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGM  358

Query  387  STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
              A++ Y+ I T +F+    G  GL+EE ++++YG++NI+VY   FV + + L  ET  A
Sbjct  359  KDAKLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEA  418

Query  447  A------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  500
                       +K++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + I
Sbjct  419  TGVPKEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAI  477

Query  501  HP  502
            HP
Sbjct  478  HP  479

>SDRG_03822
Length=494

 Score = 254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 164/467 (35%), Positives = 243/467 (52%), Gaps = 18/467 (4%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YD +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  99   SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
            ++L  E++H   A     +   D     F W  + A  D Y++ +N  Y   +    V  
Sbjct  61   AALHAEMLHSARAYAFKGV--QDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  159  ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
                  FVD HT+E+   R   K I     +IAVGG P     PG EHAISSD  F + +
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAKHI-----LIAVGGVPAMPPLPGIEHAISSDGFFAL-E  172

Query  219  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  277
             +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + +   ME  +G+
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGV  231

Query  278  EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
             F+R++   SI K E+G L ++ T          F+TVL A GR P    LGL+   + L
Sbjct  232  RFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  338  NEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQMDYDK  395
            +          E T+ PN++A+GDV     ELTPVAI AGR L+ RL+ N   A ++Y +
Sbjct  292  SPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQ  351

Query  396  ICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI  455
            I T VF+    G  GL+E  +  +YG  N+  +  +F  + +++S E      +  +K++
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA--MKLV  409

Query  456  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  410  CIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>SDRG_15045
Length=494

 Score = 252 bits (644),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 164/471 (35%), Positives = 250/471 (53%), Gaps = 20/471 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T+YDY  +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK
Sbjct  2    TTYDY--IVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKK  56

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++L  E++H   A + +   S D     F W  + A  D Y+  +N  Y   +   
Sbjct  57   IMFNAALHAEMLHSARA-YAFKGVS-DIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLED  114

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V        FVD HT+E+       ++ T + ++IAVGG P     PG EHAISSD  F
Sbjct  115  KVDLVMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFF  169

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             + + +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME 
Sbjct  170  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-  227

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
             +G++F+R++   +I K  +G L ++ T          F+TVL A GR P    LGL+  
Sbjct  228  HAGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETT  287

Query  334  RVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQM  391
             + L+ +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N   A +
Sbjct  288  DIALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  347

Query  392  DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCY  451
            +Y +I T VF+    G  GL+E  + E+YG  N+  +  +F  + +++  E      +  
Sbjct  348  NYSQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--  405

Query  452  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  406  MKLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>SDRG_03823
Length=497

 Score = 252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 169/471 (36%), Positives = 252/471 (54%), Gaps = 18/471 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T+  YD +VIGGGSGG + ++ AA++G KV V++           G+GGTCVNVGC+PKK
Sbjct  3    TTTTYDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKK  59

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  +++  E++H   A    NI   D    +F W  L    D Y+  +N  Y+  L + 
Sbjct  60   VMFNAAMHAEMLHSAHAYTFKNI--QDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNN  117

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             +        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F
Sbjct  118  KIPLIYGAAKFVDNHTIEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  172

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             + + +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + +   ME 
Sbjct  173  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-  230

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
             +G+ F+R++   SI K E+G L ++ T          F+TVL A GR P    LGL+  
Sbjct  231  HAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETT  290

Query  334  RVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQM  391
             + L+          E T+ PN++A+GDV     ELTPVAI AGR L+ RL+ N   A +
Sbjct  291  DIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  350

Query  392  DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCY  451
            +Y +I T VF+    G  GL+E  + E+YG  N++VY   F  + +++SE+     +   
Sbjct  351  NYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEK--QKTA  408

Query  452  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +K++C    ++ V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  409  MKLMCIG-EEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  458

>SDRG_11131
Length=494

 Score = 251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 164/471 (35%), Positives = 248/471 (53%), Gaps = 20/471 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T+YDY  +V+G GSGG++ +  A ++G KV V++  +   +    GLGGTCVNVGC+PKK
Sbjct  2    TTYDY--IVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKK  56

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++L  E++H   A + +   S D     F W  + A  D Y+  +N  Y   +   
Sbjct  57   IMFNAALHAEMLHSARA-YAFKGVS-DIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLED  114

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD  F
Sbjct  115  KVDLVMGAAKFVDNHTIEVNGER-----YTAKHILIAVGGVPALPPIPGIEHAISSDGFF  169

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             + + +P K  VVGA Y+A+E AG    +  +  V  R + +LR FD  + + +   ME 
Sbjct  170  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-  227

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
             +G++F+R++   +I K  +G L ++ T          F+TVL A GR P    LGL+  
Sbjct  228  HAGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETT  287

Query  334  RVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS-TAQM  391
             + L+ +        E T+ PN+YAIGDV     ELTPVAI AGR L+ RL+ N   A +
Sbjct  288  DIALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  347

Query  392  DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCY  451
            +Y +I T VF+    G  GL+E  +  +YG  N+  +  +F  + +++  E      +  
Sbjct  348  NYSQIPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA--  405

Query  452  LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +K++C    +  VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  406  MKLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>PYAR_17512
Length=533

 Score = 249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 169/501 (34%), Positives = 264/501 (53%), Gaps = 54/501 (11%)

Query  38   DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
            +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  97   HQSSLIGELMHHDSANFGWNIASADG---SASTFSWKQLVANVDGYIRGINFKYKVELRS  153
            + ++ +G L+H D  ++G+      G     + F W +L    D Y+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  154  KYVKYENFLGSFVDAHTLEL---WHPRKGT------------------KQITTRDVVIAV  192
              V+      +F     +E+     P K                    K+I+ ++V+IAV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  193  GGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR  252
            GG+P     PG EH I SD  F +++  P K  VVGA Y+A+E AG L G+G D  +  R
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELEEM-PKKVAVVGAGYIAVELAGVLHGLGSDTTIFCR  262

Query  253  SI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENG--QLLVKWTTEDGESCE  309
               +LRGFD+ + + + + M+ + G++    ++   +TK  +G   L+++  TE      
Sbjct  263  KDGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADGTKTLVLQDGTE-----H  316

Query  310  EAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTP--NIYAIGDVIDAPE  367
              FDTV+ A GR P    L L+ A V+ + + G I +   Q +T   NI+A+GDV   P 
Sbjct  317  AGFDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVCGTPA  375

Query  368  LTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIE  426
            LTPVAI AGR LS RL+     A+M Y+ I T VF+    G  GL+E++++ ++G+D ++
Sbjct  376  LTPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVK  435

Query  427  VYHKNFVPLEWSLSEETRTAAES-----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  481
            VY   FV + + +  E     +        +K++C    +K VVG H +G  A E+ Q  
Sbjct  436  VYSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGF  494

Query  482  GLAMKLGFTYDQMVDTVGIHP  502
            G+A+K+G T       V IHP
Sbjct  495  GVAVKMGATKADFDSCVAIHP  515

>PYAP_21882
Length=502

 Score = 246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 253/476 (53%), Gaps = 33/476 (7%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQ-KVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  98   QSSLIGELMHHDSANFGWNIASADGSA--STFSWKQLVANVDGYIRGINFKYKVELRSKY  155
             ++ +G  +H D  ++G+     +  A  + F WK+L    D Y+  +N  Y   L +  
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNSK  141

Query  156  VKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  215
            V       +F     +E+       K+I  ++V+IAVGG+P     PG EH I SD  F 
Sbjct  142  VDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  196

Query  216  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQ  274
            + +++P K  VVGA Y+A+E AG L G+G D  +  R   +LRGFD+ +   + + M  +
Sbjct  197  L-EEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAM-AK  254

Query  275  SGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKAR  334
             G+     +    + K  +G   +     DG S    FD+V+ A GR P    L L+ A 
Sbjct  255  EGVNLRPHSSVTKVIKAADGTKTL--VLADG-SEHSGFDSVIYAAGRVPLTESLNLEAAG  311

Query  335  VKLNEKTGRIWVKNEQTSTP--NIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQM  391
            ++ ++  G I +   Q +T   NI+A+GDV   P LTPVAI AGR L+ RL+     A+ 
Sbjct  312  IETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDAKA  370

Query  392  DYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEE-----TRTA  446
             Y+ I T VF+    G  GL+E+ ++ ++G+D I+VY   FV + + +  E      +  
Sbjct  371  SYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQKP  430

Query  447  AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                 +K++C + +D+ VVG H +G  A E+ Q  G+A+K+G T       V IHP
Sbjct  431  KPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHP  485

>PHYSO_254571
Length=489

 Score = 245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 247/478 (52%), Gaps = 34/478 (7%)

Query  38   DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  97   HQSSLIGELMHHDSANFGW---NIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153
              ++ +   +HHD  ++G+         G  + F W +L A  D Y+  +N  Y+  L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  154  KYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  213
              V        F D   +E+       K+I  ++V+IAVGG+P     PG E  I SD  
Sbjct  126  SKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDIPGKELCIDSDGF  180

Query  214  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  272
            F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD D+     E   
Sbjct  181  FELETL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDAM  238

Query  273  VQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDK  332
             + G+     +    + K ++G   +     DG S    +D V+ A GR P  + L LDK
Sbjct  239  AKDGVHLRPHSNIARVEKADDGTKTL--VLADG-SEYSGYDVVIYAAGRVPLTSNLQLDK  295

Query  333  ARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQ  390
            A V   +K G I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+     A+
Sbjct  296  AGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDAK  354

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA---  447
            + Y+ I T VF+    G  GL+EE ++ +YG+D I+VY   FV + + L  E   A    
Sbjct  355  VSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEATGEP  414

Query  448  ---ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                   +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + V IHP
Sbjct  415  KDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHP  471

>PPTG_09787
Length=493

 Score = 244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 171/472 (36%), Positives = 254/472 (54%), Gaps = 19/472 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T   YD +VIGGGSGG+A ++ AA+FG KV V++  +   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATFGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKK  59

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++   E ++ +  ++  N AS D     F W  +    D YI+ +N  Y+  L + 
Sbjct  60   VMFNTAAHVEHLNRNK-DYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNA  118

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V +   +   V    +E+       +  T + V++A GG P     PG EH I SD  F
Sbjct  119  KVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFF  173

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-  231

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
            ++G++F+R +    + K ENG+L    T    E     FDT++ A GR+P    LGL++ 
Sbjct  232  KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEI  291

Query  334  RVKLNEKTGRIWV-KNEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLSRRLYNNST-AQ  390
             VKL+E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+     A 
Sbjct  292  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
            ++Y +I T +F+    G  G +E ++  +YGE+NI+VY   FV L  S+++  R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAM  410

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  + +K   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  411  KLVTVGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PYIR_17506
Length=509

 Score = 243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 174/484 (36%), Positives = 254/484 (52%), Gaps = 50/484 (10%)

Query  39   YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  98   QSSLIGELMHHDSANFGWNIASADGSA----STFSWKQLVANVDGYIRGINFKYKVELRS  153
             ++ +   +H D+  +G+   S DGS       F W +L    D YI  +N  Y+  L +
Sbjct  90   LAANMNHTLHRDAFYYGFE--SKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGN  147

Query  154  KYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  213
              V       +F     +E+       K I+ R+V+IAVGG+P     PG EH I SD  
Sbjct  148  SKVDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGF  202

Query  214  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ-------DMAN  265
            F +++  P K  VVGA Y+A+E AG L G+G D  +  R   +LR FD+       D   
Sbjct  203  FELEEL-PNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAMA  261

Query  266  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
            K G  +  QS +  I KT       L+  + LV     DG S    FDTV+ A GR P  
Sbjct  262  KDGIVVRPQSNVARIEKT-------LDGKKTLV---LADG-SEHAGFDTVIYAAGRIPLT  310

Query  326  AKLGLDKARVKLNEKTGRIWVKNEQTSTP-NIYAIGDVIDAPELTPVAIQAGRLLSRRLY  384
            + L +  A ++  +K G I V   QT++  N++A+GDV     LTPVAI AGR LS RL+
Sbjct  311  SNLNISAAGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLF  369

Query  385  NN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                 A++ Y+ I T VF+    G  GL+E++++E+YG+  I+ Y   FV + + L  E 
Sbjct  370  GGMEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNEL  429

Query  444  RTAAES-----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  498
                 +       +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V
Sbjct  430  DAEGNTKPKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCV  488

Query  499  GIHP  502
             IHP
Sbjct  489  AIHP  492

>SPRG_11769
Length=453

 Score = 241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 166/467 (36%), Positives = 250/467 (54%), Gaps = 35/467 (7%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  99   SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
            ++ +   M HD+  +G+         +T  W  L    D Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAV----PNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDF  111

Query  159  ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
             + L SF           R+G +++      +AVGG+P     PG EH ISSD  F + +
Sbjct  112  AHGLCSFGS-------DGRRGDERL------VAVGGQPVMPDIPGIEHCISSDGFFELDE  158

Query  219  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGI  277
            + P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +      + GI
Sbjct  159  R-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGI  216

Query  278  EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
                 +    + K++     +  TT  G+     FD VL ATGR P    LGL+   ++L
Sbjct  217  TLQPHSTVARVDKVDPATGTLSLTTTAGDY-HTGFDCVLVATGRTPMTKHLGLEHRGIEL  275

Query  338  NEKTGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDK  395
            +   G I V   Q TS P ++A+GDV++   LTPVAI AGR L+ RL+     A+ DY  
Sbjct  276  SPN-GFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTS  334

Query  396  ICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI  455
            I + VF+    G  GL+E+++++ Y ED I+VY   FV + +SL E       +  +K+I
Sbjct  335  IPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTA-MKLI  393

Query  456  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            C    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHP
Sbjct  394  CVGPTEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHP  439

>PHYCA_504517
Length=493

 Score = 241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 168/472 (36%), Positives = 254/472 (54%), Gaps = 19/472 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T   YD +VIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKK  59

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++   E ++ +  ++  N A  +     F W  +    D YI+ +N  Y+  L + 
Sbjct  60   VMFNTAAHVEHLNRNK-DYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNA  118

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V +   +   V    +++     G K  T + V++A GG P     PG E+ I SD  F
Sbjct  119  NVDHVQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFF  173

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KLEQ-QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
            ++G++F+R      + K +NG+L    T    E     FDT+L A GR+P    LGL++ 
Sbjct  232  KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEV  291

Query  334  RVKLNEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQ  390
             VKL+E  G I V   E TS P +YAIGD  +   ELTPVAI AGR LS RL+     A 
Sbjct  292  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
            ++Y +I T +F+    G  G +E ++ E+YGE+N++VY   FV L  S+++  R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAM  410

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  + +K   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  411  KLVTVGEK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>SDRG_12187
Length=462

 Score = 239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 171/475 (36%), Positives = 251/475 (53%), Gaps = 42/475 (9%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVV+GGGSGG+A ++ AA++G+KV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  99   SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
            ++ +   M HD+  +G+         +T  W  L    D Y+  +N  Y   L+   V +
Sbjct  56   AADLAHSMRHDAPAYGFPAV----PNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDF  111

Query  159  ENFLGSF-------VDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSD  211
               L SF       +DA  L+              +V++AVGG+P     PG EH ISSD
Sbjct  112  AQGLCSFGSDGRVQIDATPLD----------AEATNVLVAVGGQPVMPDIPGIEHCISSD  161

Query  212  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEY  270
              F + ++ P +  VVGA Y+A+E AG L+G+G D  +  R   +LR FD DM   +   
Sbjct  162  GFFELDER-PARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQAVLHD  219

Query  271  MEVQSGIEF-IRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLG  329
               + GI      T+ +       G L V  TT  GE     FD VL ATGR P    LG
Sbjct  220  AFQRDGITLQPHSTIARVDKDPTTGSLSV--TTTAGEH-HSGFDCVLVATGRTPMTKDLG  276

Query  330  LDKARVKLNEKTGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-S  387
            L+   ++L+   G I V   Q TS P ++A+GDV+D   LTPVAI AGR L+ RL+    
Sbjct  277  LEHRGIQLSPN-GFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLH  335

Query  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
             A+ DY  I + VF+    G  GL+E+++++ Y +D ++VY   FV + +SL E      
Sbjct  336  DAKADYTNIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKP  395

Query  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             +  +K+IC    +K +VG H +G  A E+ Q  G+A+K+G     +   + IHP
Sbjct  396  TTA-MKLICVGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHP  448

>SPRG_05609
Length=496

 Score = 241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 172/476 (36%), Positives = 254/476 (53%), Gaps = 26/476 (5%)

Query  33   AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
            A T YDY  +VIGGGSGG + ++ AA++G KV +++           G+GGTCVNVGC+P
Sbjct  2    ATTVYDY--IVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVP  56

Query  93   KKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
            KK+M  ++L  E++H   A    NI   D    +F W  L    D Y+  +N  Y+  L 
Sbjct  57   KKIMFNAALHAEMLHSAHAYTFKNI--QDVEYGSFDWAALKKKRDAYVARLNGIYERNLG  114

Query  153  SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  212
            +  +        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD 
Sbjct  115  NNQIPLVYGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDG  169

Query  213  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYM  271
             F + + +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   M
Sbjct  170  FFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEM  228

Query  272  EVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEA---FDTVLNATGRDPDVAKL  328
            E  +G+ F+R++   SI K  +G       + DG    ++   F+TVL A GR P    L
Sbjct  229  E-HAGVHFVRESGITSIEKAVDGY---ADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDL  284

Query  329  GLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS  387
            GL+   + L+          E TS PN+YA+GDV     ELTPVAI AGR L+ RL+ N 
Sbjct  285  GLETTDIALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNE  344

Query  388  -TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
              A ++Y +I T VF+    G  GL+E  +  +YG +N++VY  +F  + +++SE+    
Sbjct  345  PNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDK-  403

Query  447  AESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             +   +K+IC    ++ VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  404  -QKTAMKLIC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  457

>PHYKE_10327
Length=1200

 Score = 252 bits (643),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 173/488 (35%), Positives = 263/488 (54%), Gaps = 36/488 (7%)

Query  28   SAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCV  86
            SA    +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCV
Sbjct  18   SASRALQTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCV  66

Query  87   NVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSAST---FSWKQLVANVDGYIRGI  143
            NVGC+PKKLM  ++ +G  +HHD  ++G+  A++ G  S    F W +L    D Y+  +
Sbjct  67   NVGCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRL  126

Query  144  NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  203
            N  Y+  L +  V+      +F D   + +       K++  ++V+IAVGG+P     PG
Sbjct  127  NGIYERNLANSKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPG  181

Query  204  GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQD  262
             E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD  
Sbjct  182  KELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGI  240

Query  263  MANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRD  322
            +   + + M+ + G+   R +    + +  +G   +     DG S    +D V+ A GR 
Sbjct  241  VRTTLEDAMK-KDGVHLQRHSNIARVNQAADGTKTL--VLADG-SEHSGYDVVIYAAGRV  296

Query  323  PDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  381
            P  + L LDKA +   +K G I V K ++TS   + A+GDV   P LTPVAI AGR LS 
Sbjct  297  PLTSTLKLDKAGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSD  355

Query  382  RLYNN-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL-  439
            RL+     A++ Y+ I T VF+    G  GL+EE ++++YG+D+I+VY   FV + + L 
Sbjct  356  RLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLI  415

Query  440  SEETRTAAE-----SCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  494
            +E   T  E        +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T    
Sbjct  416  NEMDETTGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADF  474

Query  495  VDTVGIHP  502
             + + IHP
Sbjct  475  DNCMAIHP  482

>PITG_14083
Length=493

 Score = 238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 166/468 (35%), Positives = 250/468 (53%), Gaps = 19/468 (4%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YD +VIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGR---EFDGMGLGGTCVNFGCVPKKVMFN  63

Query  99   SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
            ++   E ++ +  ++  N AS D     F W  +    D YI+ +N  Y+  L +  V +
Sbjct  64   AAAHVEHLNRNK-DYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  159  ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
               +   V    +E+       +  T + V++A GG P     PG EH I SD  F +++
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLEQ  177

Query  219  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  277
             +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  278  EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
             F+R +    + K +NG+L    T +  E     FD+++ A GR P    LGL++  VKL
Sbjct  236  NFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL  295

Query  338  NEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYD  394
             E  G I V   E TS   +YAIGD  +   ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  AE-GGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  395  KICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKV  454
            +I T +F+    G  G +E ++  +YGE+N++VY   FV L  S+++  R    +  L  
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLVT  414

Query  455  ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            + DK   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  415  VGDK---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PPTG_18033
Length=500

 Score = 238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 171/490 (35%), Positives = 255/490 (52%), Gaps = 40/490 (8%)

Query  28   SAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCV  86
            SA    +T YDY  +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCV
Sbjct  18   SASRAPQTEYDY--LVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCV  66

Query  87   NVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD---GSASTFSWKQLVANVDGYIRGI  143
            NVGC+PKKLM  ++ +   + HD  ++G+   +     G  + F W +L A  D Y+  +
Sbjct  67   NVGCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRL  126

Query  144  NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  203
            N  Y+  L +  V+       F +   +E+       K++  ++V+IAVGG+P     PG
Sbjct  127  NGIYERNLANSKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDIPG  181

Query  204  GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQD  262
             E  I SD  F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD D
Sbjct  182  KELCIDSDGFFELEIL-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-D  239

Query  263  MANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRD  322
            +     E   V+ G+     +    + +  +G   V  T  DG S    +D V+ A GR 
Sbjct  240  IVRTTLEDAMVKDGVHLRPHSNVARVEQAADGTKTVVLT--DG-SEYNGYDVVMYAAGRV  296

Query  323  PDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  381
            P  + L LDKA V  +E  G I V   ++TS   + A+GDV   P LTPVAI AGR LS 
Sbjct  297  PLTSNLQLDKAGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSD  355

Query  382  RLY---NNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWS  438
            RL+   NNS  ++ Y+ I T VF+    G  GL+E+ ++ +YG+D ++VY   FV + + 
Sbjct  356  RLFGGLNNS--KVSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYG  413

Query  439  LSEETRTAA------ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
            L  E   +           +K++C    +K VVG H +G  A E+ Q  G+A+K+G T  
Sbjct  414  LINEVDESTGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKA  472

Query  493  QMVDTVGIHP  502
               + + IHP
Sbjct  473  DFDNCIAIHP  482

>PHYRA_71927
Length=485

 Score = 236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 163/479 (34%), Positives = 248/479 (52%), Gaps = 36/479 (8%)

Query  38   DYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96
            +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  97   HQSSLIGELMHHDSANFGWNIASADG---SASTFSWKQLVANVDGYIRGINFKYKVELRS  153
              ++ +   + HD  ++G+   +  G     + F W +L A  D Y+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  154  KYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  213
              V+  +    F +   +E+       K++  ++V++AVGG+P     PG E  I SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  214  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYME  272
            F ++   P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD  +   + + M 
Sbjct  177  FELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM-  234

Query  273  VQSGIEFIRKTVPQS-ITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLD  331
             + G+       P S +T++E      K       S    +D V+ A GR P  + L LD
Sbjct  235  AKDGVHL----RPHSNVTRVEQVADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSNLQLD  290

Query  332  KARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STA  389
             A +   +K G I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+     A
Sbjct  291  NADIA-TDKHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDA  349

Query  390  QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA--  447
            ++ Y+ I T VF+    G  GL+EE ++ +YG+DN +VY   FV + + L  E   A   
Sbjct  350  KVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDEATGE  409

Query  448  ----ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                    +K++C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  410  PKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  467

>PHYSO_550665
Length=491

 Score = 236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 168/472 (36%), Positives = 248/472 (53%), Gaps = 19/472 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T   YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKK  59

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++   E +  +  ++  N A+ D     F W  +    D YI+ +N  Y+  L + 
Sbjct  60   VMFNAAAHVEHLARNK-DYSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNA  118

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V +   +   V    +E+       K  T + V++A GG P     PG EH I SD  F
Sbjct  119  QVDHVQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFF  173

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             + +++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KL-EQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-  231

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
            ++G++F+R      + K  +G+L    T    E     FD +L A GR+P    LGL++ 
Sbjct  232  KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGLEEV  291

Query  334  RVKLNEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQ  390
             VKL+E  G I V   E TS P +YAIGD  I   ELTPVAI AGR LS RL+     A 
Sbjct  292  GVKLSE-GGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
            ++Y +I T +F+    G  G +E ++  +YGE+N++ Y   FV L  S+++  R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAM  410

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  411  KLVTVGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>H257_09722
Length=518

 Score = 236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 262/479 (55%), Gaps = 31/479 (6%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            TSYDY  +V+GGGSGG++ ++ AAS+G  V V++  +   QG + GLGGTCVNVGC+PKK
Sbjct  26   TSYDY--IVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKK  80

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M+ ++   E++H   A     +   D    +F W  +    D Y+  ++  Y+  L   
Sbjct  81   VMYNAAFHAEILHSAKAYAFKGV--QDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKD  138

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             +   +   SFVD HT+ +          T   +++AVGG P+  + PG EHAISSD  F
Sbjct  139  NITLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFF  193

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEV  273
             + + +P K  V+GA Y+A+E AG    +  +  V  R   +LR FD  + + + + M  
Sbjct  194  GL-ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-  251

Query  274  QSGIEFIRKTVPQSITKLENGQLLVK--WTTEDGESCEE----AFDTVLNATGRDPDVAK  327
            +SG++F+  +  QSI K  +G L ++   TTEDG S        FD ++ A GR P  + 
Sbjct  252  RSGVQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSG  311

Query  328  LGLDKARVKLNEKTGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYN  385
              ++   +  NEK G I V   E TS P +YAIGDV +   ELTPVAI AGR L+ RL+ 
Sbjct  312  F-MEHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFG  369

Query  386  NST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWS-LSEET  443
                A + Y +I T VF+    G  G +E D+  ++G  N++VY  +FV L +S L+ E 
Sbjct  370  GEPDACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPEN  429

Query  444  RTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +       +K+IC   +++ VVG H  G  A E+ Q  G+A+K+G     + + V IHP
Sbjct  430  K---PKTAMKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHP  484

>PHYRA_72037
Length=493

 Score = 234 bits (598),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 250/472 (53%), Gaps = 19/472 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T   YD VVIGGGSGG+A ++ AA++G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDVVYDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++   E +H +  ++    A+ D +   F W  +    D YI  +N  Y+  L + 
Sbjct  60   VMFNAAAHVEHLHRNE-DYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNA  118

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V +   + + V    +E+       K  T + V++A GG P     PG EH   SD  F
Sbjct  119  KVDHVQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFF  173

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             +++ +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + + ME 
Sbjct  174  RLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-  231

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
            ++G++F+R T    + K ++G+L    T +  E     FD +L A GR+P    LGL+K 
Sbjct  232  KAGVKFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKV  291

Query  334  RVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQ  390
             VKL +  G I V   E TS P +YAIGD      ELTPVAI AGR LS RL+     A 
Sbjct  292  GVKLAD-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDAC  350

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
            ++Y +I T +F+    G  G +E ++  ++GE+N++VY   FV L  S+++  R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAM  410

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  + ++   + VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  411  KLVTVGEQ---ETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>CCA23647
Length=496

 Score = 233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 155/457 (34%), Positives = 240/457 (53%), Gaps = 21/457 (5%)

Query  55   KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFG  114
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E +        
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  115  WNIASADGSASTFS-----WKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAH  169
               AS   ++ +FS     W ++    D YI  +N  Y   L +  +     +   +   
Sbjct  79   RPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIAKD  138

Query  170  TLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGA  229
             +++            + ++IAVGG P   + PG EHAI SD  F ++  +P K  VVGA
Sbjct  139  RVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLET-QPKKVAVVGA  193

Query  230  SYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSI  288
             Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+ F+RK+  + I
Sbjct  194  GYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEKI  252

Query  289  TKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-K  347
             K E+ +L +     D       FD ++ A GR P    LGL+   V+LNE TG I V  
Sbjct  253  VKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNE-TGHIIVDA  311

Query  348  NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYDKICTAVFTPIE  405
             E TS P +YA+GDV     ELTPVAI AGR L+ RL+NN   A + Y +I T VF+   
Sbjct  312  QENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPP  371

Query  406  YGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVV  465
             G  G +E ++  +YGE+N++ Y   FV L +S++E+     ++C +K++C  +++  VV
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-VV  429

Query  466  GFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            G H  G  A E+ Q  G+AMK+G T     + V IHP
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHP  466

>PYAP_23435
Length=951

 Score = 241 bits (616),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 169/472 (36%), Positives = 249/472 (53%), Gaps = 19/472 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T   YD VVIGGGSGG+A ++ AA++G KV +++  +        GLGGTCVN GC+PKK
Sbjct  467  TDMVYDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKK  523

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  ++   E +  +  ++  N A        F W  +    D YI  +N  Y+  + + 
Sbjct  524  VMFNAAAHVEHLARN-GDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNA  582

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             +     + + V ++ +E+       K  T + V++AVGG P     PG EHAI SD  F
Sbjct  583  GIDLVQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFF  637

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             ++  +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME 
Sbjct  638  KLES-QPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-  695

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
            + G+ F+R++  + I K  +G+L +    +  +   E FD VL A GR+P    LGLDKA
Sbjct  696  KHGVNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKA  755

Query  334  RVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQ  390
             VKLN+  G I V   E TS P +YAIGD      ELTPVAI AGR L+ RL+ N   A 
Sbjct  756  GVKLNDG-GFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDAC  814

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
            + Y +I T VF+    G  G +E ++  ++G D ++VY   FV L  S+++       + 
Sbjct  815  LHYHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTAM  874

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  + D   D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  875  KLVCVGD---DEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHP  923

>H310_14447
Length=501

 Score = 231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 257/473 (54%), Gaps = 23/473 (5%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            TSYDY  +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK
Sbjct  7    TSYDY--IVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKK  61

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M+ + +  E++H  + ++ +     +    +F W  + A  D Y+  ++  Y+  L  +
Sbjct  62   IMYNAGVHAEILH-SAKDYSFK-DVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEE  119

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             + +      FVD HT+E+       ++ T   ++IAVGG P+    PG EHA+SSD  F
Sbjct  120  NIDHVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFF  174

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             +   +P K  VVGA Y+A+E AG    +  D  V  R + +LR FD  + + + + M  
Sbjct  175  DLPT-QPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-A  232

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEE--AFDTVLNATGRDPDVAKLGLD  331
            ++G+ F+     +SI K  +G L V    + GE+  E   FD +++A GR P    +GLD
Sbjct  233  KAGVAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLD  290

Query  332  KARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-A  389
            K  V+L++    +    E T+   +YAIGDV     ELTPVAI AGR L+ RL+   T A
Sbjct  291  KTHVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNA  350

Query  390  QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
             + Y +I T VF+    G  GL+E D+  +YG DN+ VY   F  + ++L+  +    ++
Sbjct  351  CIHYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQT  410

Query  450  CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              +K++C    +  V+G H  G  A E+ Q  G+A+KLG       + V IHP
Sbjct  411  A-MKLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHP  461

>H257_17037
Length=498

 Score = 231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 151/452 (33%), Positives = 239/452 (53%), Gaps = 17/452 (4%)

Query  54   SKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANF  113
            +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ +    E++H  + ++
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILH-SAKDY  78

Query  114  GWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLEL  173
             +     +    +F W  + A  D Y+  +   Y+  L  + + +     +FVD HT+E+
Sbjct  79   SFK-EVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEV  137

Query  174  WHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVA  233
               R      T   ++IAVGG P+  T PG EHAISSD  F +   +P K  VVGA Y+A
Sbjct  138  NGLR-----FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPT-QPKKVAVVGAGYIA  191

Query  234  LECAGFLKGMGYDVKVMVRS-ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLE  292
            +E AG    +  D  V  R   +LR FD  + + + + M  +SG+ F+ ++  QSI K  
Sbjct  192  VELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKEA  250

Query  293  NGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTS  352
            +G L +  T  D  +    F+ +++A GR P    +GLDK  V+L+     +    E T+
Sbjct  251  DGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTT  310

Query  353  TPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFTPIEYGCCG  410
             P +YAIGD  I   ELTPVAI AGR L+ RL+ + + A + Y +I T +F+    G  G
Sbjct  311  VPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIG  370

Query  411  LSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYL  470
            L+E ++  +YG+ N+  Y  +F  L +SL +      ++  +K++C    +  VVG H  
Sbjct  371  LTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTA-MKLVCIGVEET-VVGAHVA  428

Query  471  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            G  A E+ Q  G+A+K+G       + V IHP
Sbjct  429  GLGADEMIQGFGVAIKMGAYKSDFDNIVAIHP  460

>PYIW_25301
Length=512

 Score = 230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 164/483 (34%), Positives = 247/483 (51%), Gaps = 48/483 (10%)

Query  39   YDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  98   QSSLIGELMHHDSANFGWNIASA--DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155
             ++ +  ++H D+ ++G+        G    F W +L    D YI  +N  Y+  L +  
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  156  VKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFW  215
            V        F     +E+       K+I  ++++IAVGG+P     PG E  I SD  F 
Sbjct  151  VDLLTGTAVFNAHGNVEM-----DGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFE  205

Query  216  MKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQ-------DMANKI  267
            +++  P K  VVGA Y+A+E AG L G+G +  +  R   +LR FD+       D   K 
Sbjct  206  LEQL-PKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAKD  264

Query  268  GEYMEVQSGIEFIRKTVPQSITK-LENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVA  326
            G  +  QS +  + +T     T  L+NG            S    FDTV+ A GR P  +
Sbjct  265  GIVVRPQSNVARVEQTADGKKTLFLQNG------------SEHAGFDTVIYAAGRVPLTS  312

Query  327  KLGLDKARVKLNEKTGRIWVKNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
            +L L  A +   +K G I V   Q TS  N++A+GDV     LTPVAI AGR LS RL+ 
Sbjct  313  ELNLSAAGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFG  371

Query  386  N-STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETR  444
              + A++ YD I T VF+    G  GL+E +++E++G+  I+ Y   FV + + L  +  
Sbjct  372  GMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVD  431

Query  445  TAAES-----CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  499
                +       +K++C   +D+ VVG H +G  A E+ Q  G+A+K+G T     + V 
Sbjct  432  ADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVA  490

Query  500  IHP  502
            IHP
Sbjct  491  IHP  493

>CCI11048
Length=496

 Score = 229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 154/457 (34%), Positives = 240/457 (53%), Gaps = 21/457 (5%)

Query  55   KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFG  114
            + AA++G KV +++  +   +    G GGTCVN GC+PKK+M+ ++   E +   S    
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  115  WNIASADGSASTFS-----WKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAH  169
                S + ++ +FS     W ++    D YI  +N  Y   L +  +     +   +   
Sbjct  79   RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIAKD  138

Query  170  TLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGA  229
             +++            + ++IAVGG P   + PG EHAI SD  F ++  +P K  VVGA
Sbjct  139  RVQV----NQDSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLET-QPKKVAVVGA  193

Query  230  SYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSI  288
             Y+A+E AG    +  D  V  R   +LR FD  + + + E ME + G+ F+RK+  + I
Sbjct  194  GYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEME-KDGVNFVRKSHLEKI  252

Query  289  TKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-K  347
            TK ++ +L +     +       FD ++ A GR P    LGL++  V LNE TG I V  
Sbjct  253  TKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALNE-TGHIIVDA  311

Query  348  NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYDKICTAVFTPIE  405
             E TS P +YA+GDV     ELTPVAI AGR L+ RL+NN   A + Y +I T VF+   
Sbjct  312  QENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPP  371

Query  406  YGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVV  465
             G  G +E ++  +YGE+N++ Y   FV L +S++E+     ++  +K++C  +++  VV
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCVGSKET-VV  429

Query  466  GFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            G H  G  A E+ Q  G+AMK+G T     + V IHP
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHP  466

>HYAP_08763
Length=473

 Score = 225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 151/456 (33%), Positives = 239/456 (52%), Gaps = 21/456 (5%)

Query  51   LACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDS  110
            +A ++ AA++G KV V++  +   Q    GLGGTCVN GC+PKK+M  ++    + H + 
Sbjct  1    MASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTA--AHVEHLNR  55

Query  111  ANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHT  170
            A   ++I +A+ +   F W ++    D YI  +   Y+  L +  V +   +  FV  + 
Sbjct  56   AK-DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNK  114

Query  171  LELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGAS  230
            +++       +  T + V+IA GG P +   PG  H I SDD F +++ +P K  VVGA 
Sbjct  115  VQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQ-QPQKVAVVGAG  168

Query  231  YVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT  289
            Y+A+E AG    +  D  +  R   +LR F+  + + + E ME ++G+ F+R      + 
Sbjct  169  YIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVE  227

Query  290  KLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KN  348
            K  +G+L +     + E     FDT+L A GR P    LGL+   VKL E  G I V   
Sbjct  228  KQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKLAEG-GFIQVDAQ  286

Query  349  EQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQMDYDKICTAVFTPIEY  406
            E TS P +YAIGD  +   ELTPVAI AGR L+ RL+     A ++Y +I + +F+    
Sbjct  287  ENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPI  346

Query  407  GCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVG  466
            G  G +E ++  +YGE+N++VY   FV L  S+++       +  L  + ++   + VVG
Sbjct  347  GTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGEQ---ETVVG  403

Query  467  FHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  404  VHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  439

>H310_11259
Length=519

 Score = 226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 167/488 (34%), Positives = 260/488 (53%), Gaps = 27/488 (6%)

Query  25   STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGT  84
            S P  +    ++  YD +V+GGGSGG+A ++ AAS+G KV V++  +        GLGGT
Sbjct  15   SFPQLLRRPMSTTSYDYIVLGGGSGGIASARRAASYGAKVLVVERGR---TLGGAGLGGT  71

Query  85   CVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADG-SASTFSWKQLVANVDGYIRGI  143
            CVNVGC+PKK+M+ ++ + E+MH       +      G    +F W  + +  D Y+  +
Sbjct  72   CVNVGCVPKKVMYNAAFLAEIMHSAKT---YTFKGVQGVEFGSFDWPAMKSKRDAYVTRL  128

Query  144  NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  203
            +  Y+  L    +   + + +FVD HT+ +     G K  T   +++AVGG P+  + PG
Sbjct  129  HGIYERNLAKDGISLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPG  183

Query  204  GEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQD  262
             E AISSD  F + + +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  
Sbjct  184  IELAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPL  242

Query  263  MANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTT--EDGESCEEAF---DTVLN  317
            + + + + M  ++G+ F+ ++   SI K  NG L ++ T   E+G +  + F   D V+ 
Sbjct  243  VRDHVNKEMR-RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVV  301

Query  318  ATGRDPDVAKLGLDKARVKLNEKTGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQA  375
            A GR P     G D+  +  + K G I V   E T+ P +YAIGD      ELTPVAI A
Sbjct  302  AIGRTPRTTDCGFDRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAA  360

Query  376  GRLLSRRLYNNST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVP  434
            GR L+ RL+     A ++Y +I T VF+    G  G +E D+  +YG  N++VY  +FV 
Sbjct  361  GRRLADRLFGGEPDACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVN  420

Query  435  LEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  494
            L ++L         S  +KV+C   +++ VVG H  G  A E+ Q  G+A+K+G     +
Sbjct  421  LFYTLLPPKDM--PSTAMKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDL  477

Query  495  VDTVGIHP  502
             + + IHP
Sbjct  478  DNVIAIHP  485

>PHALS_09136
Length=493

 Score = 224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 246/472 (52%), Gaps = 19/472 (4%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T   YD +VIGGGSGG+A ++ AA+ G KV V   V+   +    GLGGTCVN GC+PKK
Sbjct  3    TDMVYDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKK  59

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
            +M  +++  E ++ +  ++  N  + D     F W  +    D YI+ +N  Y+  L + 
Sbjct  60   VMFNTAVHVEHLNRNK-DYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIYERNLSNA  118

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIF  214
             V     +   V    +++          T + V++A GG P     PG EH I SD  F
Sbjct  119  QVDVIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFF  173

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEV  273
             + +++P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME 
Sbjct  174  KL-EQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-  231

Query  274  QSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  333
            ++G+EF+R      I K  + +L    T    E     FDT+L A GR P    LGL++ 
Sbjct  232  KAGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEI  291

Query  334  RVKLNEKTGRIWV-KNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNNST-AQ  390
             VKL +  G I V   E T+ P +YAIGDV +   ELTPVAI AGR L+ RL+     A 
Sbjct  292  GVKLADG-GYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDAC  350

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
            ++Y +I T +F+    G  G +E ++  R+G++NI++Y   FV L  ++++  R    + 
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAM  410

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  + +   ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  411  KLVTVGE---EETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PHYKE_6836
Length=493

 Score = 223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 159/468 (34%), Positives = 247/468 (53%), Gaps = 19/468 (4%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YD VVIGGGSGG+A ++ AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFN  63

Query  99   SSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKY  158
            +++  E +  +  ++  N A  D     F W  +    D YI  +N  Y+  L+++ V +
Sbjct  64   TAMHVEHLARNR-DYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  122

Query  159  ENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKK  218
               +   V    +++       +  T +++++A GG P     PG EH I SD  F +++
Sbjct  123  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLEQ  177

Query  219  KEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGI  277
             +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++G+
Sbjct  178  -QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  278  EFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL  337
            +F+R +    + K  +G+L    T +  E     FDT+L A GR P    LGL++  VKL
Sbjct  236  KFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEINVKL  295

Query  338  NEKTGRIWVK-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNST-AQMDYD  394
            ++  G I V   E TS   +YAIGD      ELTPVAI AGR LS RL+     A ++Y 
Sbjct  296  SQD-GFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  395  KICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKV  454
            +I T +F+    G CG +E ++ E++G++NI+ Y   FV L  S+++  R    +  L  
Sbjct  355  QIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAMKLVC  414

Query  455  ICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            + ++     V         A E+ Q  G+AMK+  T     + V IHP
Sbjct  415  VGEEEVVVGVHVAGE---GADEMIQGFGVAMKMNATKADFDNIVAIHP  459

>PITG_13427
Length=463

 Score = 221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 158/467 (34%), Positives = 240/467 (51%), Gaps = 37/467 (8%)

Query  51   LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHD  109
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   + HD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  110  SANFGWNIASADG---SASTFSWKQLVANVDGYIRGINFKY-KVELRSKYVKYENFLGSF  165
              ++G+   +  G     + F W +L A  D Y+  +N  Y +  L +  V+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  166  VDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTL  225
             +   +E+     G K++  ++V+IAVGG+P     PG E  I SD  F ++   P K  
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETL-PKKVA  165

Query  226  VVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTV  284
            VVGA Y+A+E AG L  +G D  +  R   +LR FD D+     E    + G+       
Sbjct  166  VVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD-DIVRTTLEDAMAKEGVHL----R  220

Query  285  PQS-ITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGR  343
            P S + ++E G    K       S    +D V+ A GR P  + L LDKA +  +E  G 
Sbjct  221  PHSNVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTDEH-GF  279

Query  344  IWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVF  401
            I V   ++TS   + A+GDV   P LTPVAI AGR LS RL+   + A++ Y+ I T VF
Sbjct  280  IPVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVF  339

Query  402  TPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA------ESCYLKVI  455
            +    G  GL+EE ++ +YG+D I+VY   FV + + L  E   +           +K++
Sbjct  340  SHPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLV  399

Query  456  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            C    +K VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  400  CAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  445

>PHYCA_7619
Length=462

 Score = 218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 157/466 (34%), Positives = 235/466 (50%), Gaps = 36/466 (8%)

Query  51   LACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHD  109
            +A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +HHD
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  110  SANFGWN---IASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFV  166
              ++G+         G  + F W +L A  D Y+  +N  Y+  L +  V        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  167  DAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLV  226
                +E+       K+I   +V+IAVGG+P     PG E  I SD  F ++   P K  V
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETL-PKKVAV  165

Query  227  VGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
            VGA Y+A+E AG L  +G +  +  R   +LR FD  +   + + ME + G+       P
Sbjct  166  VGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAME-KDGVHL----CP  220

Query  286  QS-ITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRI  344
             S + ++E      +       S    ++ V+ A GR P    L LDKA V   +  G I
Sbjct  221  HSNVVRVEQAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVT-TDNHGFI  279

Query  345  WVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTAVFT  402
             V   +QTS  N++A+GD    P LTPVAI AGR LS RL+     A++ Y+ I T VF+
Sbjct  280  QVDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFS  339

Query  403  PIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL----SEETRTAAE--SCYLKVIC  456
                G  GL+E  ++ +YG+D I+VY   FV + + L     EET    +     +K++C
Sbjct  340  HPPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC  399

Query  457  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               +D+ VVG H +G  A E+ Q  G+A+K+G T     D + IHP
Sbjct  400  -AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHP  444

>PYVX_21517
Length=482

 Score = 199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 147/493 (30%), Positives = 242/493 (49%), Gaps = 78/493 (16%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
            T+ ++DL+VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PK
Sbjct  24   TAREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPK  74

Query  94   KLMHQSSLIGELMHHDSANFGWNIASADGSA----STFSWKQLVANVDGYIRGINFKYKV  149
            K+M+  + +   +H D+ ++G+  A++ G +      F W++L    D Y+  +N  Y+ 
Sbjct  75   KIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYER  134

Query  150  ELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCP----GGE  205
             L +  V+       F     +E+        ++  + V++AVGG+P     P    G E
Sbjct  135  NLANSKVELLTGTARFNVDGKIEV-----DGVEVRAKKVLLAVGGKPLIPDIPVAATGKE  189

Query  206  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMA  264
              I SD  F +++  P K  VVGA Y+A+E AG L  +G D  +  R   +LR FD   +
Sbjct  190  LCIDSDGFFELEQL-PRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNS  248

Query  265  NKIGEYMEVQSGIEFIRKTVPQSITK----------LENGQLLVKWT----TEDGESCEE  310
                +++   S  E +R T+  ++ +          +E  +L    T      DG S   
Sbjct  249  ----QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADG-STHT  303

Query  311  AFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKN-EQTSTPNIYAIGDVIDAPELT  369
             F++V+ A GR P    LGLD A V  +E+ G I V   +QT+ P+I A+GD      LT
Sbjct  304  GFESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALT  362

Query  370  PVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
            P++                    Y+ + T VF+    G  GL+E+ ++ ++G++ I++Y 
Sbjct  363  PIS--------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYK  402

Query  430  KNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  489
              FV + + +  E           ++C    +K +VG H +G  A E+ Q  G+A+K+G 
Sbjct  403  STFVNMYYGVVNE-----------LVCAGPDEK-IVGLHVIGMGADEMLQGFGVAVKMGA  450

Query  490  TYDQMVDTVGIHP  502
            T   +   V IHP
Sbjct  451  TKADLDSCVAIHP  463

>HYAP_04843
Length=430

 Score = 191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 135/409 (33%), Positives = 206/409 (50%), Gaps = 24/409 (6%)

Query  106  MHHDSANFGWNIASADGSAST---FSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFL  162
            + HD  ++G+      GS      F W +L    D Y+R +N  Y+  L S  V++    
Sbjct  5    LQHDVVHYGFEKEGTGGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGS  64

Query  163  GSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPG  222
              F     +E+       K++  ++V+IAVGG+P     PG E  I SD  F +    P 
Sbjct  65   ARFNKQGNVEV-----DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTL-PK  118

Query  223  KTLVVGASYVALECAGFLKGMGYDVKVMVRSI-LLRGFDQDMANKIGEYMEVQSGIEFIR  281
            K  V+GA Y+A+E AG L  +G +  +  R   +LR FD  +   + + M +  G+    
Sbjct  119  KVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID-GLHLRP  177

Query  282  KTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKT  341
             +    + +  +G   +  T  DG S    FD V+ A GR P   KL LD A V  N K 
Sbjct  178  NSNVARVEQAADGTNTLVLT--DG-SAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KH  233

Query  342  GRIWVKN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-STAQMDYDKICTA  399
            G I V   ++TS   ++A+GDV   P LTPVA+ AGR LS RL+ N   A++ Y+ I T 
Sbjct  234  GYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTV  293

Query  400  VFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA------ESCYLK  453
            VF+    G  GL+E+ ++ +YG+D+I+VY  +FV + + L  E   A           +K
Sbjct  294  VFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIK  353

Query  454  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            ++C   ++K VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  354  LVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  401

>PYIR_23431
Length=468

 Score = 184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 215/454 (47%), Gaps = 48/454 (11%)

Query  55   KEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFG  114
            + AA++G KV V++  +   +    GLGGTCVN GC+PKK+M  +S     + H + N  
Sbjct  23   RRAATYGAKVLVVERGR---KYDGMGLGGTCVNYGCVPKKVMFNAS---AHVEHLNRNAD  76

Query  115  WNIASADGSAS----TFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHT  170
            ++I + +GS       F W  +    D YI  +N  Y+  L +  V     +   V  + 
Sbjct  77   YSITT-NGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQ  135

Query  171  LELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGAS  230
            +E+          T + +++AVGG+P     PG EH I SD  F ++  +P K  VVGA 
Sbjct  136  IEV-----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEA-QPKKVAVVGAG  189

Query  231  YVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSIT  289
            Y+A+E AG    +  D  +  R   +LR FD  + + I E  E ++GI F+R +  + I 
Sbjct  190  YIAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERID  248

Query  290  KLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE  349
            K  +G L +    +  E     FDT+L A GR+P    LGL++  VKL +    +    E
Sbjct  249  KQADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQE  308

Query  350  QTSTPNIYAIGD-VIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGC  408
             TS P IYAIGD  I   ELTP                         I T VF+    G 
Sbjct  309  NTSVPGIYAIGDATITGWELTP-------------------------IPTVVFSHPPLGT  343

Query  409  CGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFH  468
             G +E  + E++G +N++VY   FV L +++++       +  L        D+ VVG H
Sbjct  344  IGYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTAMKL---VTVGEDEVVVGVH  400

Query  469  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  401  VAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  434

>PYAR_17714
Length=444

 Score = 182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 233/475 (49%), Gaps = 68/475 (14%)

Query  34   ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
            ET YDY  +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PK
Sbjct  4    ETVYDY--IVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPK  58

Query  94   KLMHQSSLIGELMHHDSANFGWNIAS-ADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
            K+M  ++     + H + N  ++I S A+     F W  + A  D YI  +N  Y+  + 
Sbjct  59   KVMWNAA---SHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIG  115

Query  153  SKYVKYENFLGSFV--DAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISS  210
            +  +     + S    DA T++       T     + +++AVGG P     PG EHAI S
Sbjct  116  NAKIDLIEGIASLTAKDAVTVD-----GKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDS  170

Query  211  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGE  269
            DD F +K  +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + +  
Sbjct  171  DDFFKLKT-QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNA  229

Query  270  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLG  329
             M+ + G+ F+R++   +I K  +G+L V+ T +  ++    FD VL A GR+P    LG
Sbjct  230  EMD-KHGVHFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLG  288

Query  330  LDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNS  387
            L+   VKL++  G I V K E TS   +YAIGD      ELTP                 
Sbjct  289  LESVGVKLSD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTP-----------------  330

Query  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
                                       ++ E++G D+++VY   FV L +++++    + 
Sbjct  331  --------------------------PEAVEKFGADHVKVYTSTFVNLLYAMADPDHKSK  364

Query  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             +  +K++C    ++ VVG H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  365  TA--MKLVCVGENEQ-VVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHP  416

>PYVX_16175
Length=446

 Score = 167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 141/472 (30%), Positives = 218/472 (46%), Gaps = 62/472 (13%)

Query  34   ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
            ET+YDY ++  G G   +A ++ AAS G KV +++  + +      GLGGTCVN GC+PK
Sbjct  4    ETTYDYVVLGGGSGG--VASARRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPK  58

Query  94   KLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153
            K+M  ++   E ++         +         F W  +    D YI  +N  Y+  L +
Sbjct  59   KVMFNAAAHVEHLNRAGDYSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGN  118

Query  154  KYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  213
              +     +   V  + LE+       K  T +++++A GG P     PG EHAI SD  
Sbjct  119  AKIDVVQGVARVVARNQLEV-----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGF  173

Query  214  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYME  272
            F +++ +P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + +   ME
Sbjct  174  FKLEQ-QPRKVAVVGAGYIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME  232

Query  273  VQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDK  332
             ++G++F+R++    I KLE+G+L +    +        FDTVL A GR+P  A LGL+ 
Sbjct  233  -KNGVQFVRRSHITRIDKLEDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEA  291

Query  333  ARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNNSTAQ  390
              V L++K G I V   E TS   +YAIGD      ELTP                    
Sbjct  292  IGVDLDDK-GFIKVDAQENTSAAGVYAIGDATTTGWELTP--------------------  330

Query  391  MDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC  450
                                    D+  +YG +N++VY   FV L  ++++       + 
Sbjct  331  -----------------------PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAM  367

Query  451  YLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             L  +  +   + VVG H  G  A E+ Q  G+A+KLG T     + V IHP
Sbjct  368  KLVTVGAQ---ETVVGVHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHP  416

>PYAP_22645
Length=1565

 Score = 152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 146/479 (30%), Positives = 219/479 (46%), Gaps = 42/479 (9%)

Query  36    SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
             S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  1097  SSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKA  1148

Query  96    MHQSSLIGELMHHDSANFGWNIASA----DGSASTFSWKQLVANVDGYIRGINFKYKVEL  151
             +  ++ +     HD + +G  ++      DG     S ++ V  + G I G+  K KV  
Sbjct  1149  LLHATHMYHAAQHDFSKYGIEVSDVKMNFDGMMK--SKEKAVKTLTGGIEGLFKKNKV--  1204

Query  152   RSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----  207
                YVK     G  V A+ + +     G + +  ++++IA G     L     ++A    
Sbjct  1205  --TYVKG---FGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKI  1259

Query  208   ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANK  266
             + S     +KK  P   +V+G   + LE     K +G  V V+     +  G DQ++  +
Sbjct  1260  VDSTGALELKKV-PEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKE  1318

Query  267   IGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDV  325
               + ++ Q G++F   T V  S    +   L V+       S  EA DTVL ATGR P  
Sbjct  1319  FTKLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFT  1376

Query  326   AKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY  384
               LGL++  ++  +K GRI V N  +T  PNI+AIGDVI  P L   A + G      + 
Sbjct  1377  KGLGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIA  1435

Query  385   NNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETR  444
                   ++YD I   ++T  E    G +EE  KE       E    N        +   R
Sbjct  1436  GLH-GHVNYDAIPGVIYTYPEVASVGKTEEQLKE-------EGVAYNVGKFPMMANSRAR  1487

Query  445   TAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               AES  ++KVI DKT D+ ++G H +  NAGE+     L M+ G   + +  T   HP
Sbjct  1488  AVAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHP  1545

>CCA22989
Length=494

 Score = 145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 136/480 (28%), Positives = 218/480 (45%), Gaps = 40/480 (8%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQK-VCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  93
            +S +YDL+VIGGG GG   + +AA  G K VC+        +GT   LGGTC+NVGCIP 
Sbjct  23   SSTEYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPS  73

Query  94   KLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRS  153
            K +  SS +     HD    G      + S    ++ +++   +  ++ +    +   + 
Sbjct  74   KALLHSSHMFHTAQHDFKAIGI-----EASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKK  128

Query  154  KYVKYENFLGSFV--DAHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCP--GGEHAI  208
              V Y    G+ V  D  ++      KG + I  ++++IA G     L  CP    +  I
Sbjct  129  NKVAYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI  188

Query  209  SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
                   + K  P + +VVGA  + LE     + +G +V V+   + +  G D ++  + 
Sbjct  189  VDSTGALVLKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREF  248

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEA---FDTVLNATGRDPD  324
             + ++ Q G +F   T    +T  +  +  V  T ED +   E     D VL ATGR P 
Sbjct  249  AKTLQKQ-GFKFKFAT---KVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPF  304

Query  325  VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
               LGL+   ++  +K GRI V N  +T  PNIYAIGDVI  P L   A + G + +  +
Sbjct  305  TQNLGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEI  362

Query  384  YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                   ++Y+ I   ++T  E  C G +EE  KE       E    N        +   
Sbjct  363  MLGKQGHVNYNAIPGVIYTFPEVACVGRTEEQLKE-------EGVSYNVGKFPMIANSRA  415

Query  444  RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            R   E+  ++KV+  K  D+ ++G H +  NAGE+     L ++ G + + +  T   HP
Sbjct  416  RAVGETDGFVKVLAQKDNDR-ILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHP  474

>CCI10477
Length=494

 Score = 144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 141/484 (29%), Positives = 220/484 (45%), Gaps = 50/484 (10%)

Query  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
            S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  24   SSEYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKA  75

Query  96   MHQSSLIGELMHHDSANFGWNIASADGS------ASTFSWKQLVANVDGYIRGINFKYKV  149
            +  SS +     HD  + G  ++    +      A   S K L + ++G  +    K KV
Sbjct  76   LLHSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFK----KNKV  131

Query  150  ELRSKYVKYENFLGSFVDAH--TLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCP--GG  204
                 Y+K     G  V  +  ++ L    KG + IT ++++IA G     L  CP    
Sbjct  132  ----AYIKGH---GKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNE  184

Query  205  EHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDM  263
            +  I       + K  P + +VVGA  + LE     + +G +V V+   + +  G D ++
Sbjct  185  KGKIVDSTGALVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMEL  244

Query  264  ANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF---DTVLNATG  320
              +  + ++ Q G++F   T   S TK+      V  T ED +   E     D VL ATG
Sbjct  245  GREFAKTLQKQ-GLKFKFATRVTS-TKVNGDN--VTITMEDAKGGNETSMECDVVLVATG  300

Query  321  RDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLL  379
            R P    LGL+   ++  +K GRI V +  +T+ P+IYAIGDVI  P L   A + G + 
Sbjct  301  RRPFTNGLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IA  358

Query  380  SRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL  439
            +  +       ++Y+ I   ++T  E  C G +EE  KE       E    N        
Sbjct  359  AVEIMLGKHGHVNYNAIPGVIYTHPEVACVGKTEEQLKE-------EGISYNVGKFPMIA  411

Query  440  SEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  498
            +   R   E+  ++KV+  K  D+ ++G H +  NAGE+     L ++ G   + +  T 
Sbjct  412  NSRARAVGETDGFVKVLAQKDNDR-ILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTC  470

Query  499  GIHP  502
              HP
Sbjct  471  HAHP  474

>PYIR_20273
Length=505

 Score = 143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 135/490 (28%), Positives = 212/490 (43%), Gaps = 42/490 (9%)

Query  28   SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87
            SA   +  S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+N
Sbjct  23   SARAFSSASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLN  74

Query  88   VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147
            VGCIP K +  S+ +     HD A +G  +     S  + ++ +++ + +  ++ +    
Sbjct  75   VGCIPSKALLHSTHLYHSAQHDFAKYGIEV-----SEVSMNFGKMMKSKEKAVKTLTGGI  129

Query  148  KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR-----PKELTCP  202
            +   +   V Y    G  V  + + +     G + +T ++++IA G       P  +   
Sbjct  130  EQLFKKNKVTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNA  189

Query  203  GGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLR---GF  259
             G+   S+  +    KK P   +VVGA  + LE     K +G   KV V   L R   G 
Sbjct  190  AGKIVDSTGALEL--KKVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGL  245

Query  260  DQDMANKIGEYMEVQS-GIEFIRKTVPQSIT----KLENGQLLVKWTTEDGESCEEAFDT  314
            D ++  +  + ++ Q  G EF  K     +      L             G +     D 
Sbjct  246  DLELGKEFTKLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDA  305

Query  315  VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  373
            VL ATGR P    LGL+   ++  +K GRI V +  +T  PNI+AIGDVI  P L   A 
Sbjct  306  VLVATGRRPYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAE  364

Query  374  QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
            + G   +  +       ++Y+ I   ++T  E    G +EE  KE       E    N  
Sbjct  365  EEGIACAETIAGKH-GHVNYNAIPGVIYTFPEVASVGKTEEQLKE-------EGVTYNVG  416

Query  434  PLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
                  +   R   E+   +KVI DK  DK ++G H +  NAGE+     L M+ G + +
Sbjct  417  KFPMLANSRARAVGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSE  475

Query  493  QMVDTVGIHP  502
             +  T   HP
Sbjct  476  DIARTCHAHP  485

>PYU1_G014259
Length=244

 Score = 132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 124/231 (54%), Gaps = 20/231 (9%)

Query  25   STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF-GQKVCVLDYVKPSPQGTSWGLGG  83
            ST S   + +  YDY  +VIG GSGG+A S+ AAS+   +V V++  +         LGG
Sbjct  23   STRSLSSQQQDEYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGG  71

Query  84   TCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD--GSASTFSWKQLVANVDGYIR  141
            TCVNVGC+PKK+M+ ++ +  ++H D+ ++G+        G   +F W +L    D Y+ 
Sbjct  72   TCVNVGCVPKKIMYLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVL  131

Query  142  GINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTC  201
             +N  Y+  L +  V       +F     +E+       K++  ++++IAVGG+P     
Sbjct  132  RLNGIYERNLANSKVDLLQGTAAFNAQGNVEV-----DGKEVKAKNILIAVGGKPLIPDI  186

Query  202  PGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR  252
            PG EH I SD  F ++   P K  VVGA Y+A+E AG L G+G D  +  R
Sbjct  187  PGKEHCIDSDGFFELEVL-PKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>SPRG_19943
Length=343

 Score = 134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 136/271 (50%), Gaps = 18/271 (7%)

Query  33   AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
            A +   YD +V+G GSGG++ +  A ++G KV V++           GLGGTCVNVGC+P
Sbjct  15   ARSMATYDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVP  71

Query  93   KKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELR  152
            KK+M  ++L  E++H   A     +   D     F W  + A  D Y++ +N  Y   + 
Sbjct  72   KKIMFNAALHAEMLHSARAYAFKGV--QDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGML  129

Query  153  SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDD  212
               V        FVD HT+E+   R      T + ++IAVGG P     PG EHAISSD 
Sbjct  130  EDKVDLVMGAAKFVDNHTVEVNGDR-----YTAKHILIAVGGVPAMPPLPGIEHAISSDG  184

Query  213  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFDQDMANKIGEYM  271
             F + + +P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   M
Sbjct  185  FFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEM  243

Query  272  E------VQSGIEFIRKTVPQSITKLENGQL  296
            E      VQ+ ++ +   V +++  +    L
Sbjct  244  EHAGKEKVQTAMKLVCIGVEETVVGVHVAGL  274

 Score = 35.4 bits (80),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 6/68 (9%)

Query  435  LEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  494
            +E +  E+ +TA     +K++C    +  VVG H  G  A E+ Q  G+A+K+G      
Sbjct  243  MEHAGKEKVQTA-----MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDF  296

Query  495  VDTVGIHP  502
             + V IHP
Sbjct  297  DNIVAIHP  304

>HYAP_12621
Length=501

 Score = 134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 131/477 (27%), Positives = 211/477 (44%), Gaps = 41/477 (9%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  98   QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
             S+ +     H+  ++G      D    T ++ Q++   +  +R +    +       V 
Sbjct  86   HSTHLLHTAQHEFKSYGI-----DAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  158  YENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSD  211
            Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  212  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEY  270
             +   +   P   +VVGA  + LE     K +G  V V+        G D+    +  + 
Sbjct  201  ALALTRV--PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKL  258

Query  271  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPDVAK  327
            ++ Q G+EF   T    +T  E    +V  TTE    G+      DTVL ATGR    A 
Sbjct  259  LKKQ-GLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAG  314

Query  328  LGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
            LGL++  ++  +K GRI V +  QT  P ++AIGDVI    L   A + G      +   
Sbjct  315  LGLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGK  373

Query  387  STAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA  446
                ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   RT 
Sbjct  374  H-GHVNYGAIPNVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMA--NSRARTV  425

Query  447  AES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  426  AEADGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  481

>PYVX_21248
Length=502

 Score = 127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 125/434 (29%), Positives = 198/434 (46%), Gaps = 33/434 (8%)

Query  81   LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNI--ASADGSASTFSWKQLVANVDG  138
            LGGTC+NVGCIP K +  S+ +     HD A +G  +    A+      + ++ V  + G
Sbjct  70   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMKAKEKAVTTLTG  129

Query  139  YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGRPK  197
             I  +  K KV     Y+K     G  V  + + +  +  KG + +T ++++IA G  P 
Sbjct  130  GIESLFKKNKV----TYIKGH---GKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPA  182

Query  198  EL---TCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  254
             L        +  I          K P   +VVGA  + LE     K +G   KV V   
Sbjct  183  PLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEF  240

Query  255  LLR---GFDQDMANKIGEYMEVQSGIEFIRKT-VPQSITKLENGQLLVKWTTEDGESCEE  310
            L R   G D +++ +  + ++ Q G+EF   T V  S  K +N  L V+ +   G +   
Sbjct  241  LDRACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEPSA-GGSAASI  298

Query  311  AFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELT  369
              DTVL ATGR P    LGL++  ++  +K GR+ V +  +T  PNIYA GDVI    L 
Sbjct  299  ECDTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIKGAMLA  357

Query  370  PVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
              A + G +    + +     ++YD I   ++T  E    G +EE+ K        E   
Sbjct  358  HKAEEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEELKN-------EGVT  409

Query  430  KNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLG  488
             N        +   RT AE+  ++K++ DK  D+ ++G H +  NAGE+     L ++ G
Sbjct  410  YNVGKFPMMANSRARTIAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYG  468

Query  489  FTYDQMVDTVGIHP  502
             + + +  T   HP
Sbjct  469  ASSEDIARTCHAHP  482

>PHYKE_9680
Length=498

 Score = 118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 132/490 (27%), Positives = 223/490 (46%), Gaps = 41/490 (8%)

Query  25   STPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGT  84
            + P       +S +YD+VVIGGG GG   + +AA  G K   ++        +   LGGT
Sbjct  18   AAPMTARTFSSSSEYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGT  69

Query  85   CVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGIN  144
            C+NVGCIP K +  S+ +     HD  ++G      D      ++ Q++   +  ++ + 
Sbjct  70   CLNVGCIPSKALLHSTHLLHTAQHDFKSYGI-----DAPGVKANFPQMMKAKEKAVKTLT  124

Query  145  FKYKVELRSKYVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKE  198
               ++  +   V Y    G       + +     KG + +  ++++IA G       P  
Sbjct  125  GGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPLPPVP  184

Query  199  LTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLR  257
            +    G+   S+  +    K+ P   +VVGA  + LE     K +G  V V+  +     
Sbjct  185  VDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACP  242

Query  258  GFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF---DT  314
            G D++   +  + ++ Q G++F   T    +T  E    +VK TTE  +  +EA    DT
Sbjct  243  GMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASIECDT  298

Query  315  VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  373
            VL ATGR    A LGL++  ++  +K GR+ V +  +T  P I+AIGDVI    L   A 
Sbjct  299  VLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLAHKAE  357

Query  374  QAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFV  433
            + G      +       ++Y  I   ++T  E+   G +EE+ K    E N+  +     
Sbjct  358  EEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----  411

Query  434  PLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
            P+    +   RT AE+   +KV+ DK  DK ++G H +  NAGE+     +A++ G + +
Sbjct  412  PMMA--NSRARTVAEADGLVKVLSDKKTDK-MLGVHIIASNAGEMIAEGVIALEYGASSE  468

Query  493  QMVDTVGIHP  502
             +  T   HP
Sbjct  469  DIARTCHAHP  478

>PHYRA_72215
Length=499

 Score = 118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 147/512 (29%), Positives = 229/512 (45%), Gaps = 55/512 (11%)

Query  6    LSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVC  65
            LS + SAL +        P T  A   A  S DYD+VVIGGG GG   + +AA  G K  
Sbjct  8    LSRRSSALRSA------SPLTARAFSSA--SSDYDVVVIGGGPGGYVAAIKAAQLGFKTA  59

Query  66   VLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSAS  125
             ++        +   LGGTC+NVGCIP K +  S+ +     HD  ++G +   A G  +
Sbjct  60   CVE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGID---APGVTA  108

Query  126  TF-----SWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT  180
             F     + ++ V  + G I  +  K KV     Y K                 +  KG 
Sbjct  109  NFPQMMKAKEKAVTTLTGGIESLFKKNKVTYIKGYGKVS------AQGEVSVALNDNKGN  162

Query  181  KQITTRDVVIAVGGRPKELTCPGGEHA----ISSDDIFWMKKKEPGKTLVVGASYVALEC  236
            + +  ++++IA G     L     ++A    I S     + +  P   +VVGA  + LE 
Sbjct  163  ETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALALTRV-PEHLVVVGAGVIGLEL  221

Query  237  AGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  295
                K +G  V V+  +     G D++   +  + ++ Q G++F   T    +T  E   
Sbjct  222  GSVYKRLGSKVTVVEFQDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTASEVNG  277

Query  296  LLVKWTTEDGESCEEAF---DTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QT  351
             +VK TTE  +    A    DTVL ATGR    A LGL++  ++  +K GRI V +  +T
Sbjct  278  DVVKLTTEAAKGGNAATIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDAFRT  336

Query  352  STPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGL  411
              P I+AIGDVI    L   A + G      +       ++Y  I   ++T  E+   G 
Sbjct  337  QVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGK  395

Query  412  SEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYL  470
            +EE+ K    E N+  +     P+    +   RT AE+   +KV+ DK  DK ++G H +
Sbjct  396  TEEELKAEGIEYNVGKF-----PMMA--NSRARTVAEADGLVKVLADKKTDK-MLGVHII  447

Query  471  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              NAGE+     +A++ G + + +  T   HP
Sbjct  448  ASNAGEMISEGVIALEYGASSEDIARTCHAHP  479

>PHALS_09942
Length=496

 Score = 117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 136/482 (28%), Positives = 215/482 (45%), Gaps = 45/482 (9%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            +S +YD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSEYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
             +  S+ +     H+  N+G      D    T ++ Q++   D  ++ +    +   +  
Sbjct  78   ALLHSTHLLHTAQHEFKNYGI-----DAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKN  132

Query  155  YVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAI  208
             V Y    G       + +  H  KG + +  ++++IA G       P  +    G+   
Sbjct  133  KVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIVD  192

Query  209  SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSIL---LRGFDQDMAN  265
            S+  +    K+ P   +VVGA  + LE     K +G   KV V   L     G D+    
Sbjct  193  STGALEL--KRIPDHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDDACTGMDKGSVK  248

Query  266  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRD  322
               + ++ Q G+EF   T    +T  E    +VK TTE    G++     DTVL ATGR 
Sbjct  249  DFIKLLKKQ-GLEFKFGT---KVTASEINGDVVKLTTEPSQGGDAASIECDTVLVATGRR  304

Query  323  PDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  381
               A LGL++  ++  +K GRI V    +T  P I+AIGDVI    L   A + G +   
Sbjct  305  AFTAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IACA  362

Query  382  RLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSE  441
             +       ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    + 
Sbjct  363  EIIAGKHGHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NS  415

Query  442  ETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGI  500
              RT  ES   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   
Sbjct  416  RARTVGESDGMVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHA  474

Query  501  HP  502
            HP
Sbjct  475  HP  476

>PHYSO_556052
Length=500

 Score = 117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 134/476 (28%), Positives = 214/476 (45%), Gaps = 39/476 (8%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  98   QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
             S+ +     HD  ++G      D      ++ Q++   +  ++ +    +   +   V 
Sbjct  85   HSTHLLHTAQHDFKSYGI-----DAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKVT  139

Query  158  YENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISSDD  212
            Y    G       + +  +  KG + +  ++++IA G     L   P    A   I S  
Sbjct  140  YIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTG  199

Query  213  IFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYM  271
               +K+  P   +VVGA  + LE     K +G  V V+  +     G D++   +  + +
Sbjct  200  ALSLKRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKLL  258

Query  272  EVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPDVAKL  328
            + Q G+EF   T    +T  E    +VK TTE    G++     DTVL ATGR    A L
Sbjct  259  KKQ-GLEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGL  314

Query  329  GLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387
            GL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +    
Sbjct  315  GLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGKH  373

Query  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
               ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   RT A
Sbjct  374  -GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NSRARTVA  425

Query  448  ES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            ES   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  426  ESDGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHP  480

>SPRG_09825
Length=492

 Score = 114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 137/487 (28%), Positives = 220/487 (45%), Gaps = 55/487 (11%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K
Sbjct  22   TGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSK  73

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
             +  ++       HD  N G  +   DG    F+  +L+A+ D  ++ +    +   +  
Sbjct  74   ALLSATHKYHAAQHDFKNVGIEV---DGLRIDFA--KLMASKDKSVKILTGGIEGLFKKN  128

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISS  210
             V Y    G  V  + + +     G K ++T++++IA G     L   P    A   I S
Sbjct  129  KVDYIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDS  188

Query  211  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  270
                 +K+  P   +V+G   + LE       +G  + V+           + A+KI   
Sbjct  189  TGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPT  236

Query  271  MEVQSGIEFIRKTVPQSITKLENGQLL---------VKWTTE---DGESCEEAFDTVLNA  318
            M+ ++G EF +K + +     + GQ +         V  T E    GE+     DTVL A
Sbjct  237  MDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  295

Query  319  TGRDPDVAKLGLDKARVKLNEKTGRIWV--KNEQTSTPNIYAIGDVIDAPELTPVAIQAG  376
            TGR P    LGL++  ++  +K GRI V   N +T+  NI+AIGD I+   L   A + G
Sbjct  296  TGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  354

Query  377  RLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLE  436
                  +       ++Y+ I   V+T  E    G +EE+ K      N+  Y+    P+ 
Sbjct  355  ISCVESIAGGH-GHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPMM  408

Query  437  WSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
               +   RT  E+  ++K++  K  DK ++G H +  NAGE+     L ++ G + + + 
Sbjct  409  A--NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIG  465

Query  496  DTVGIHP  502
             T   HP
Sbjct  466  RTCHAHP  472

>PITG_15359
Length=496

 Score = 114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 217/480 (45%), Gaps = 41/480 (9%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTF--SWKQLVANVDGYIRGINFKYKVELR  152
             +  S+ +     HD  ++G +      +      S ++ V  + G I  +  K KV   
Sbjct  78   ALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKV---  134

Query  153  SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----I  208
              Y+K    + +          +  KG + +  ++++IA G     L     ++A    I
Sbjct  135  -TYIKGHGKISA--QGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  191

Query  209  SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
             S     +K+  P   +VVGA  + LE     K +G  V V+        G D++   + 
Sbjct  192  DSTGALELKRV-PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEF  250

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPD  324
             + ++ Q G++F   T    +T  E    +VK TTE    G++     DTVL ATGR   
Sbjct  251  TKLLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAF  306

Query  325  VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
             + LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +
Sbjct  307  TSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  365

Query  384  YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                   ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   
Sbjct  366  AGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NSRA  417

Query  444  RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            RT AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  418  RTIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  476

>SDRG_06945
Length=492

 Score = 112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 135/487 (28%), Positives = 219/487 (45%), Gaps = 55/487 (11%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            T  DYDLVV+GGG GG   + +AA  G K   ++      +GT   LGGTC+NVGCIP K
Sbjct  22   TGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACVE-----SRGT---LGGTCLNVGCIPSK  73

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
             +  ++       HD  N G  +   DG    F+  +L+A+ D  ++ +    +   +  
Sbjct  74   ALLSATHKYHAAQHDFKNVGIEV---DGLRIDFA--KLMASKDKSVKILTGGIEGLFKKN  128

Query  155  YVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKEL-TCPGGEHA---ISS  210
             + Y    G  V  + + +     G K ++T++++IA G     L   P    A   I S
Sbjct  129  KIDYIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDS  188

Query  211  DDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEY  270
                 +K+  P   +V+G   + LE       +G  + V+           + A+KI   
Sbjct  189  TGALSLKRI-PEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPT  236

Query  271  MEVQSGIEFIRKTVPQSITKLENGQLL---------VKWTTE---DGESCEEAFDTVLNA  318
            M+ ++G EF +K + +     + GQ +         V  T E    GE+     DTVL A
Sbjct  237  MDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVA  295

Query  319  TGRDPDVAKLGLDKARVKLNEKTGRIWV--KNEQTSTPNIYAIGDVIDAPELTPVAIQAG  376
            TGR P    LGL++  ++  +K GRI V   N +T+  NI+AIGD I+   L   A + G
Sbjct  296  TGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEG  354

Query  377  RLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLE  436
                  +       ++Y+ I   V+T  E    G +EE+ K      N+  +     P+ 
Sbjct  355  ISCVESIAGGH-GHVNYNAIPGVVYTFPEVASVGKTEEELKAAGVAYNVGKF-----PMM  408

Query  437  WSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
               +   RT  E+  ++K++  K  DK ++G H +  NAGE+     L ++ G + + + 
Sbjct  409  A--NSRARTVGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIG  465

Query  496  DTVGIHP  502
             T   HP
Sbjct  466  RTCHAHP  472

>PHYCA_123621
Length=495

 Score = 112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 134/480 (28%), Positives = 214/480 (45%), Gaps = 41/480 (9%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            ++ DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  25   STNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  76

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTF--SWKQLVANVDGYIRGINFKYKVELR  152
             +  S+ +     HD  ++G +      +      + ++ V  + G I  +  K KV   
Sbjct  77   ALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKV---  133

Query  153  SKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----I  208
              Y+K   F             +  KG + +  ++++IA G     L     ++A    I
Sbjct  134  -TYIK--GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  190

Query  209  SSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKI  267
             S     + +  P   +VVGA  + LE     K +G  V V+        G D+    + 
Sbjct  191  DSTGALSLTRV-PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEF  249

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE---DGESCEEAFDTVLNATGRDPD  324
             + ++ Q G++F   T    +T  E    +VK TTE    G++     DTVL ATGR   
Sbjct  250  TKLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAF  305

Query  325  VAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL  383
             A LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +
Sbjct  306  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  364

Query  384  YNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEET  443
                   ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   
Sbjct  365  AGKH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGVEYNVGKF-----PMMA--NSRA  416

Query  444  RTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            RT AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  417  RTVAEADGLVKVLADKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  475

>PYAR_20075
Length=469

 Score = 107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 126/478 (26%), Positives = 201/478 (42%), Gaps = 71/478 (15%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  98   QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
             S+ +     HD   +G  ++          +  ++ + +  ++ +    +   +   V 
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSDVQ-----MDFGGMMKSKEKAVKTLTAGIESLFKKNKVT  136

Query  158  YENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMK  217
            Y    G  V A+                 +V +A+          G E  + S     +K
Sbjct  137  YIKGFGKIVAAN-----------------EVAVALNDN------NGNETIVDSTGALALK  173

Query  218  KKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGI  277
            K  P   +V+G   + LE     K +G  V V+           + A+++   ++++ G 
Sbjct  174  KA-PEHLVVIGGGVIGLELGSVYKRLGSKVTVV-----------EYADRVCPGLDLELGK  221

Query  278  EFIRKTVPQSI-----TKLENGQL---LVKWTTE---DGESCEEAFDTVLNATGRDPDVA  326
            EF +    Q +     TK+   Q+    V  T E    GE+     DTVL ATGR P   
Sbjct  222  EFAKLLKKQGLDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTN  281

Query  327  KLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
             LGL++  ++  +K GRI V    +T  P+IYAIGDVI  P L   A + G      +  
Sbjct  282  GLGLEQMGIQ-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAG  340

Query  386  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
                 ++Y+ I   ++T  E    G +EE  KE       E    N        +   R 
Sbjct  341  LH-GHVNYNAIPGVIYTHPEVASVGKTEEQLKE-------EGIAYNVGKFPMMANSRARA  392

Query  446  AAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              E   ++KV+ DKT DK ++G H +  NAGE+     L ++ G   + +  T   HP
Sbjct  393  VGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHP  449

>CCA16670
Length=520

 Score = 102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 116/483 (24%), Positives = 202/483 (42%), Gaps = 47/483 (10%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +++         +   +++ +   ++R        + +S  + 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDFLR-------TQFKSARID  134

Query  158  YENFLGSFVDAHTLELWHP-----RKGTKQITTRDVVIAVGGRPKE-LTCP-GGEHAISS  210
            Y +    F D H + +         K TK++     ++A G RP      P  G+    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  211  DDIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKI  267
            D I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
               M    G  F+   + +S+ K   G   V    + G+      D +L   GR  +   
Sbjct  255  THEMR-NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDG  308

Query  328  LGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
            L L+ A +  N + G + V  + QT  P+I+A+GD I AP L   +++ GRL S  ++N 
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  387  STA-------QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL  439
            + A       Q+        ++T  E    G +E++      + N E+    +  L    
Sbjct  368  NEANDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSL--KMNYEIGVAKYSELAKG-  424

Query  440  SEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  499
              +   A+    LK++ D    K   G H +G  A E+     +A+ +G T     D V 
Sbjct  425  --QMSGASADGMLKILFDPISLKL-YGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVF  481

Query  500  IHP  502
             +P
Sbjct  482  NYP  484

>PHYRA_73883
Length=551

 Score = 102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 102/372 (27%), Positives = 165/372 (44%), Gaps = 42/372 (11%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +
Sbjct  39   ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTV  90

Query  92   PKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANV-------DGYIRGIN  144
            P K   +++L      H +   G       G +  F  + ++  V           R   
Sbjct  91   PSKTFREAALHLTGYRHKAFYNGQA-----GPSKRFGVEDILQRVRKVEDAETDITRHQL  145

Query  145  FKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG-  203
             +  V+L +   ++     + V   + E +      K+ T+ D+   V    K L C G 
Sbjct  146  MRNGVQLINGTARFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGT  205

Query  204  -----------GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
                       GE    SD + W K K  P + +VVGA  V +E A  +  + G DV V+
Sbjct  206  RPARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVI  265

Query  251  V-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCE  309
              R  +L   D++++  +  Y   Q+G  F+ +   +S+ K +NG++ V    E G++  
Sbjct  266  DGRKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHL--ESGKTV-  321

Query  310  EAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPEL  368
               D +L   GR  +V  L L+   +   +K GRI V N  QT+ P+IYA GD+I  P L
Sbjct  322  -VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGL  379

Query  369  TPVAIQAGRLLS  380
               +++ GRL S
Sbjct  380  ASTSMEQGRLAS  391

>H257_01186
Length=496

 Score = 101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 119/478 (25%), Positives = 204/478 (43%), Gaps = 43/478 (9%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  98   QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            ++ L +    HH      +       S    +   ++  V+  +       + +L++ +V
Sbjct  80   EAVLHLSGFNHHGFYGKSY-------SRERITLSDILHRVNVVVSSEMDVIRAQLKAAHV  132

Query  157  KYENFLGSFVDAHTLELWHPRKGTKQITTR--DVVIAVGGRPKE--LTCPGGEHAISSDD  212
            +       F +A+ + + +     + +  R    +IA G  P    +    GE  + SD 
Sbjct  133  QIIPGKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDG  192

Query  213  IFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGE  269
            I    K E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +  
Sbjct  193  ILEASKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKM  252

Query  270  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF-DTVLNATGRDPDVAKL  328
             M    G  F+     QS+T++  G  +      D  S + +F + +L   GR  +   L
Sbjct  253  EMR-HKGARFLLGETIQSVTRVAKGVRV------DFASGKSSFAEALLYCVGRQANTDAL  305

Query  329  GLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS-  387
             L+   +  N++      K  QTS P+IYA GD I AP L   +++ GRL +  ++++  
Sbjct  306  NLEGVGLAKNKRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHED  365

Query  388  --TAQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFVPLEWSLSEETR  444
              T+Q+D       ++T  E    G +E+  +KE     N  V    +  L   +    +
Sbjct  366  QPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKE---GRNYAVGMAKYSELAKGMMAGGQ  422

Query  445  TAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              A    LK++ D      V+G H +G  A E+     +AM +        D V  +P
Sbjct  423  KGA----LKILFDPDTQS-VLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYP  475

>CCI50816
Length=807

 Score = 102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 119/483 (25%), Positives = 202/483 (42%), Gaps = 47/483 (10%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDL+VIG G     C+ +AA  G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +       S    +   ++  V+  I+      +V+ +S  V 
Sbjct  82   AVLHLSGYRHHGFYGKSY-------SMKNVTIDDILYRVNRVIQSEVDLLRVQFKSARVD  134

Query  158  YENFLGSFVDAHTLELWHP-----RKGTKQITTRDVVIAVGGRPKE-LTCP-GGEHAISS  210
            Y +    F D H + +         K TK++     ++A G RP      P  G+    S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  211  DDIF-WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKI  267
            D I  W  ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L   D ++ + +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327
               M    G  F+     +S+ K   G L+     + G+      D +L   GR  +   
Sbjct  255  THEMR-NHGARFLLGETIESVDKSSRGVLV---GLKSGKKVHG--DALLYVVGRQANTDG  308

Query  328  LGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN  386
            L L+ A +  N + G + V  + QT  P+I+A+GD I AP L   +++ GRL S  ++N 
Sbjct  309  LNLEAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNE  367

Query  387  ST-------AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSL  439
                     +Q+        ++T  E    G +E+    +  + N E+    +  L    
Sbjct  368  DESNDDSIPSQLKTGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYSELAKG-  424

Query  440  SEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVG  499
              +   A+    LK++ D    K + G H +G  A E+     +A+ +G T     D V 
Sbjct  425  --QMSGASADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVF  481

Query  500  IHP  502
             +P
Sbjct  482  NYP  484

>PHYCA_504445
Length=548

 Score = 100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 103/387 (27%), Positives = 173/387 (45%), Gaps = 50/387 (13%)

Query  29   AVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNV  88
            A+ E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            +GG CV+ 
Sbjct  36   ALRELRASEHFDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------KRDMMGGVCVHT  87

Query  89   GCIPKKLMHQSSLIGELMHHD---------SANFG-----WNIASADGSASTFSWKQLVA  134
            G +P K   +++L      H          S  FG       +   + + +  +  QL+ 
Sbjct  88   GTVPSKTFREAALHLTGYRHKAFYNGHGGPSKRFGVEDILQRVRKVEDAETDITRHQLMR  147

Query  135  NVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLEL-----WHPRKGT-KQITTRD-  187
            N    I G          ++++   N + + +   + E       H      K++ T D 
Sbjct  148  NGVQLINGT---------ARFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADK  198

Query  188  VVIAVGGRP-KELTCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-  243
             ++ VG RP +    P  GE    SD + W K K  P + ++VGA  V +E A  +  + 
Sbjct  199  FLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIP  258

Query  244  GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTT  302
            G DV V+  R  +L   D++++  +  Y   Q+G  F+     +S+ K   G++ V    
Sbjct  259  GTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHL--  315

Query  303  EDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGD  361
            E G++     D +L   GR  +V  L L+   ++  +K GRI V N  QT+ P+IYA GD
Sbjct  316  ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHIYAAGD  372

Query  362  VIDAPELTPVAIQAGRLLSRRLYNNST  388
            +I  P L   +++ GRL S  +  + T
Sbjct  373  IIGFPGLASTSMEQGRLASVHMRTSKT  399

>PPTG_00938
Length=550

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 128/511 (25%), Positives = 212/511 (41%), Gaps = 63/511 (12%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G +
Sbjct  41   ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTV  92

Query  92   PKKLMHQSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYI-RGINFKYKV  149
            P K   +++L +    H    N     +   G        + V N +  I R    +  V
Sbjct  93   PSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVENAETDITRHQLLRNGV  152

Query  150  ELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPG------  203
            +L +   ++     + V   + E +      K+ ++ D+   V    K L C G      
Sbjct  153  QLINGTARFLPGSKNMVAVLSNESYETATDAKRHSSADICKRVLTADKFLVCVGTRPARR  212

Query  204  ------GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSI  254
                  GE    SD++ W K K  P + ++VGA  V +E A  +  + G DV V+  R  
Sbjct  213  PDIPFDGETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQE  272

Query  255  LLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDT  314
            +L   D+ ++  +  Y   Q+G  F+     +S+ K   G++ V    E G++     D 
Sbjct  273  ILNMADKQVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEVFVHL--ESGKTV--VGDG  327

Query  315  VLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAI  373
            +L   GR  +V  L L+   +   +K GRI V N  QT+ P+IYA GD+I  P L   ++
Sbjct  328  LLYTVGRQGNVEGLNLEAVGLS-PDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSM  386

Query  374  QAGRLLSRRL----------YNNSTAQMDYDKICT----------AVFTPIEYGCCGLSE  413
            + GRL S  +           ++     D D++ T           ++T  E    G +E
Sbjct  387  EQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNE  446

Query  414  ED-SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI-CDKTRDKFVVGFHYLG  471
            +  +KE       +V ++  V     L+          +LK+I C  T   F  G H +G
Sbjct  447  QQLTKE-------QVPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHAIG  497

Query  472  PNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              A E+     + M  G T +   + V  +P
Sbjct  498  EGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  528

>PYIW_24688
Length=259

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 88/286 (31%), Positives = 137/286 (48%), Gaps = 35/286 (12%)

Query  33   AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIP  92
            A+T YDY  + IGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCV+ GC+P
Sbjct  3    ADTVYDY--ISIGGGSGGMASARRAATFGAKVLV---VERGRKYGGAGLGGTCVHYGCVP  57

Query  93   KKLMHQSSLIGELMHHDSANFGWNIASADG-SASTFSWKQLVANVDGYIRGINFKYKVEL  151
            KK+M  ++   E ++  +A++      A       F W  +    D YI  +N  Y+  L
Sbjct  58   KKIMFNAATHVEHLNR-AADYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNL  116

Query  152  RSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSD  211
             +  V     +   V  + +E+          T + +++AVGG+P               
Sbjct  117  GNAQVDLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------  156

Query  212  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVR-SILLRGFD---QDMANKI  267
            D F+  + +P K  VVGA Y+A+E AG    +  D  +  R   +LR FD   +D+ N+ 
Sbjct  157  DGFFKLEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEE  216

Query  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFD  313
            GE    ++GI F+R +  + I K  +G L +       E     FD
Sbjct  217  GE----KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFD  258

>PHALS_12028
Length=579

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 167/366 (46%), Gaps = 38/366 (10%)

Query  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
            S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G IP K 
Sbjct  33   SEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSKT  84

Query  96   MHQSSLIGELMHHD---------SANFG-----WNIASADGSASTFSWKQLVANVDGYIR  141
              +++L      H          S  FG       +   + + +  +  QL+ N    ++
Sbjct  85   FREAALHLTGYRHKAFYNGQGGPSKRFGVEDILQRVKKVESAETDITRHQLLRN---GVQ  141

Query  142  GINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRD-VVIAVGGRP-KEL  199
             IN   +    SK++       S+  A   +        K++ T D  ++ VG RP +  
Sbjct  142  LINGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARRA  201

Query  200  TCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSIL  255
              P  GE    SD + W K K  P + +VVGA  + +E A  +  + G DV V+  R  +
Sbjct  202  DIPFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEI  261

Query  256  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTV  315
            L   D +++  +   M  Q+G  F+   V +S+ K   G++ V    E G++     D +
Sbjct  262  LNMADNEVSEALCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHL--ESGKTV--VGDGL  316

Query  316  LNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQ  374
            L   GR  +V  L L+   + + +K G+I V N  QT+ P+IYA GD+I  P L   +++
Sbjct  317  LYTVGRQGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSME  375

Query  375  AGRLLS  380
             GRL S
Sbjct  376  QGRLAS  381

>PYAR_16840
Length=536

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 120/504 (24%), Positives = 211/504 (42%), Gaps = 69/504 (14%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLV-ANVDGYIRGINFKYKVELRSKYV  156
            + L +    HH      +++ +       +  K++V + VD          K +L++  +
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARI  140

Query  157  KYENFLGSFVDAHTLELW-------HPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEHA  207
             Y   L  F + H + +               ++     +IA G RP    L    G+  
Sbjct  141  DYLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVI  200

Query  208  ISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-----VRSILLRGFD  260
            + SD I     +E P   +VVGA  + +E A  L  + G+ V V+     VR++L     
Sbjct  201  LDSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---S  257

Query  261  QDMA------------------NKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTT  302
            +DM+                  ++I   ++ +  ++  R  + ++I K+E     VK   
Sbjct  258  RDMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFL  317

Query  303  EDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDV  362
              G+    + D +L   GR      L L+   +  N++      K  QT  P+IYA+GD 
Sbjct  318  TSGKVT--SGDALLYTVGRQASTDGLNLEAVGLGRNKRGLLTVNKAYQTEKPHIYAVGDC  375

Query  363  IDAPELTPVAIQAGRLLSRRLYNNS---TAQMDYDKICTAVFTPIEYGCCGLSEED-SKE  418
            I AP L   +++ GRL +  ++      T+Q++       ++T  E    G +E+  + E
Sbjct  376  IGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE  435

Query  419  RYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
            +    N E+    +      L++   +      LK++ D    + V G H +G  A E+ 
Sbjct  436  KV---NYEIGLAKY----SELAKGQMSGGAFGMLKILFDPDTLR-VHGVHAIGEGATEII  487

Query  479  QAMGLAMKLGFTYDQMVDTVGIHP  502
                +A+ +G +     D V  +P
Sbjct  488  HIGQVAIAMGCSLTYFRDAVFNYP  511

>PHYRA_47253
Length=481

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 122/492 (25%), Positives = 211/492 (43%), Gaps = 58/492 (12%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  53   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  112

Query  158  YENFLGSFVDAHTLELWH-----PRKGTKQITTRD---------VVIAVGGRPKE--LTC  201
            +E+        H + +        +KG    +T D          +IA G RP    L  
Sbjct  113  FES-------EHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVP  165

Query  202  PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRG  258
              G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V+  R  +L  
Sbjct  166  IDGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSF  225

Query  259  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNA  318
             D+++ + +   M+  +G  F+   + ++I K+E     VK   + G+    + D +L  
Sbjct  226  CDREIISNLTYEMQ-SNGARFL---LGETIKKVETADNRVKVFFDSGKVL--SADALLYT  279

Query  319  TGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGR  377
             GR      L L+   +  N + G I V KN QT  P+IYA GD I AP L   +++ GR
Sbjct  280  VGRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  338

Query  378  LLSRRLYNNS-----TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGED--NIEVYHK  430
            L S  ++        T+Q++       ++T  E    G +E    ++  +D  N E+   
Sbjct  339  LASCHMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVNYEIGVA  394

Query  431  NFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  490
             +  L      +   A     LK++ D    K V G H +G  A E+     +AM +  +
Sbjct  395  KYSELAKG---QMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCS  450

Query  491  YDQMVDTVGIHP  502
                 D V  +P
Sbjct  451  LTYFRDAVFNYP  462

>PYU1_G011605
Length=524

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 122/489 (25%), Positives = 204/489 (42%), Gaps = 53/489 (11%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            DYDLVVIG G     C+ E+A  G++V ++D      + TS  +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD------KKTS--VGGVCVHTGTIPSKTFR  91

Query  98   QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLV-ANVDGYIRGINFKYKVELRSKY  155
            ++ L +    HH      +++ +       +  K++V + VD          K +L++  
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVD--------VIKAQLKAAR  143

Query  156  VKYENFLGSFVDAHTLELWH-PRKGTKQ-----------ITTRDVVIAVGGRPKE-LTCP  202
            V+Y      F + H + +   P  G  Q           +     +IA G RP      P
Sbjct  144  VEYIPGFARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVP  203

Query  203  -GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRG  258
              G+    SD I     ++ P   +VVGA  + +E A  L  + G+ V V+  R  +L  
Sbjct  204  IDGKVIFDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSF  263

Query  259  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNA  318
             D ++ + +   M    G  F+       + K  NG   V      G+    + D +L  
Sbjct  264  CDNEIISNLTYEMR-SKGARFLLGETINRVEKTGNG---VTVYLNSGKVT--SADAMLYT  317

Query  319  TGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRL  378
             GR      L L+   +  N +      K+ QT  P+IYA+GD I AP L   +++ GRL
Sbjct  318  VGRQASTDGLNLEAVNLSRNPRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRL  377

Query  379  LSRRLYNNS----TAQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFV  433
             +  +++      T+Q++       ++T  E    G +E+  +KE     N E+    + 
Sbjct  378  AACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGV---NFEIGIAKYS  434

Query  434  PLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  493
             L      +   +     LK++ D T  K   G H +G  A E+     +A+ +G +   
Sbjct  435  ELAKG---QMSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAIAMGCSVTY  490

Query  494  MVDTVGIHP  502
              D V  +P
Sbjct  491  FRDAVFNYP  499

>PYAP_19280
Length=512

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 122/487 (25%), Positives = 211/487 (43%), Gaps = 52/487 (11%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V V+D      +G+S  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLV-ANVDGYIRGINFKYKVELRSKYV  156
            + L +    HH      +++ +       +  K++V + VD          K +L++  V
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVD--------VIKAQLKAARV  133

Query  157  KYENFLGSFVDAHTLELWHPRKGT-------KQITTR----DVVIAVGGRPKE--LTCPG  203
             Y      F + H + +      T        ++ TR      +IA G RP    L    
Sbjct  134  DYIPGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPID  193

Query  204  GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFD  260
            G+    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D
Sbjct  194  GKVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCD  253

Query  261  QDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATG  320
             ++ + +   M V+ G  F+   + +SI K+E     VK     G+      D +L   G
Sbjct  254  NEVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKVTSA--DALLYTVG  307

Query  321  RDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
            R  +   L ++   +  N++      K+ QT   +IYA+GD I AP L   +++ GRL +
Sbjct  308  RQANTDGLNIEAVGLSRNQRGLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAA  367

Query  381  RRLYNN----STAQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFVPL  435
              +++     +T+Q++       ++T  E    G +E+  + E+    N E+    +  L
Sbjct  368  CHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAEKV---NYEIGIAKYSEL  424

Query  436  EWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
                  +    + +  LK++ D    K   G H +G  A E+     +A+ +G +     
Sbjct  425  AKG---QMGGGSHNGILKILFDPDTLKL-HGVHAIGEGATEIIHIGQVAIAMGCSLTYFR  480

Query  496  DTVGIHP  502
            D V  +P
Sbjct  481  DAVFNYP  487

>H310_00561
Length=497

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 118/480 (25%), Positives = 205/480 (43%), Gaps = 47/480 (10%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            +YDL+VIG G  GL C+ E+A  G+ V ++D         S  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  98   QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            ++ L +    HH      +       S    + + ++  V+  +       + +L++ +V
Sbjct  81   EAVLHLSGFNHHGFYGKSY-------SRERITLRDILHRVNVVVSSEMDVIRAQLKAAHV  133

Query  157  KYENFLGSFVDAHTLELWHPRKGTKQITTR--DVVIAVGGRPKE--LTCPGGEHAISSDD  212
            +       F +A+ + +     G++    R    +IA G  P    +    GE  + SD 
Sbjct  134  QIIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDG  193

Query  213  IFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGE  269
            I    K E P   +VVGA  + +E A  L  + G  V V+  R  +L   D ++ + +  
Sbjct  194  ILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALKM  253

Query  270  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAF-DTVLNATGRDPDVAKL  328
             M    G  F+     QS+ ++  G         D  S + +F + +L   GR  +   L
Sbjct  254  EMR-HKGARFLLGETIQSVKRVRKG------VRVDFASGKSSFAEALLYCVGRQANTDTL  306

Query  329  GLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLY---  384
             L+   +  N K G + V  + QT+ P+I+A GD I AP L   +++ GRL +  ++   
Sbjct  307  NLEGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHE  365

Query  385  NNSTAQMDYDKICTAVFTPIEYGCCGLSEED-SKE-RYGEDNIEVYHKNFVPLEWSLSEE  442
            +  T+Q+D       ++T  E    G +E+  +KE R     +  Y +        L++ 
Sbjct  366  DQPTSQLDSGNYPYGIYTIPEISMVGKTEQQLTKEGRNYAVGVAKYSE--------LAKG  417

Query  443  TRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                 +   LK++ D      V+G H +G  A E+     +AM +        D V  +P
Sbjct  418  MMAGGQKGALKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYP  476

>H310_02523
Length=494

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 123/444 (28%), Positives = 195/444 (44%), Gaps = 53/444 (12%)

Query  81   LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNI--ASADGSASTFSWKQLVANVDG  138
            LGGTC+NVGCIP K +   + +     HD  + G  +   S D +    S ++ V  + G
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGIKVDNVSIDFNQLMKSKEKTVKILTG  121

Query  139  YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR---  195
             I G+  K KV+    YVK     G  V    L +     G + + T++++IA G     
Sbjct  122  GIEGLFKKNKVD----YVKG---FGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTP  174

Query  196  --PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253
              P  +   GG+   S+  +    K+ P   +VVG   + LE       +G  + V+   
Sbjct  175  LPPVPVDNEGGKIVDSTGALSL--KRIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV---  229

Query  254  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLL---------VKWTTE-  303
                    + A+KI   M+ +   EF +    Q +T  + GQ +         V  T E 
Sbjct  230  --------EYADKICPTMDHELTKEFQKLLTKQGMT-FKLGQKVTASKVDGDTVTLTVEP  280

Query  304  --DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVK--NEQTSTPNIYAI  359
               G++     D VL ATGR P  A LGL+   ++  ++ GRI V   N QT+   IYAI
Sbjct  281  AAGGDATTIEADCVLVATGRRPYTAGLGLEDMGIQ-TDRFGRIKVNLSNFQTNVDGIYAI  339

Query  360  GDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKER  419
            GDVI+   L   A + G  +   +       ++YD I   ++T  E    G +EE+ K  
Sbjct  340  GDVIEGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEEELKAA  398

Query  420  YGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
                N+  Y+    P+    +   R   E+  ++KV+  K  DK ++G H +  NAGE+ 
Sbjct  399  ----NV-AYNVGKFPMMA--NSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMI  450

Query  479  QAMGLAMKLGFTYDQMVDTVGIHP  502
                L ++ G + + +  T   HP
Sbjct  451  SEGVLGIEYGASAEDIGRTCHAHP  474

>PPTG_09121
Length=520

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 118/493 (24%), Positives = 204/493 (41%), Gaps = 57/493 (12%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  84   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFAR  143

Query  158  YENFLGSFVDAHTLELWHPRKGTK-----------------QITTRDVVIAVGGRPKE--  198
            +EN        H + +       K                 +I     +IA G RP    
Sbjct  144  FEN-------EHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNP  196

Query  199  LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSIL  255
            L    G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+  R  +
Sbjct  197  LIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDI  256

Query  256  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTV  315
            L   D ++ + +   M+  +G  F+   + +++ K+E     VK     G+      D +
Sbjct  257  LSFCDSEIISNLTYEMQ-SNGARFL---LGETVKKVETTDKRVKVFFNSGKVLSA--DAL  310

Query  316  LNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQ  374
            L   GR      L L+   +  N + G I V KN QT  P+IYA GD I AP L   +++
Sbjct  311  LYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSME  369

Query  375  AGRLLSRRLYN-----NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYH  429
             GRL S  ++N      +T+Q++       ++T  E    G +E    ++  +D +  Y 
Sbjct  370  QGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTE----QQLTKDCVN-YE  424

Query  430  KNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  489
                        +   A     LK++ D    K V G H +G  A E+     +AM +  
Sbjct  425  IGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDC  483

Query  490  TYDQMVDTVGIHP  502
            +     D V  +P
Sbjct  484  SLTYFRDAVFNYP  496

>H257_16541
Length=494

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 124/444 (28%), Positives = 193/444 (43%), Gaps = 53/444 (12%)

Query  81   LGGTCVNVGCIPKK-LMHQSSLIGELMHH-DSANFGWNIASADGSASTFSWKQLVANVDG  138
            LGGTC+NVGCIP K L+H + L     H+  S     +  S D      S  + V  + G
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGIKVDNVSIDFDQLMKSKDKTVKILTG  121

Query  139  YIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR---  195
             I G+  K KV+    Y       G  V    + +     G + + T++++IA G     
Sbjct  122  GIEGLFKKNKVDYIKGY-------GKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTP  174

Query  196  --PKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  253
              P  +   GG+  I S     +K+  P   +VVG   + LE       +G  + V+   
Sbjct  175  LPPVPVDNEGGK-IIDSTGALALKRV-PKHLVVVGGGVIGLEMGSVYGRLGSKITVV---  229

Query  254  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQL---------LVKWTTE-  303
                    + A+KI   M+ +   EF +    Q +T  + GQ          +V  T E 
Sbjct  230  --------EYADKICPTMDHEVTKEFQKLLTKQGMT-FKLGQKVTASKVDGDVVTLTVEP  280

Query  304  --DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVK--NEQTSTPNIYAI  359
               GE+     D VL ATGR P  A LGL++  ++  +K GRI V   N QT+   I+AI
Sbjct  281  AAGGEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAI  339

Query  360  GDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKER  419
            GDVI+   L   A + G  +   +       ++YD I   ++T  E    G +EE+ K  
Sbjct  340  GDVIEGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEEELKTA  398

Query  420  YGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVT  478
                N+  Y+    P+    +   R   E+  ++KV+  K  DK ++G H +  NAGE+ 
Sbjct  399  ----NV-AYNVGKFPMMA--NSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMI  450

Query  479  QAMGLAMKLGFTYDQMVDTVGIHP  502
                L ++ G + + +  T   HP
Sbjct  451  SEGVLGIEYGASAEDIGRTCHAHP  474

>PYIW_25190
Length=206

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 89/177 (50%), Gaps = 5/177 (3%)

Query  328  LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLSRRLYNN  386
            LGL+   VKLN+    +    E TS   IYAIGD  I   ELTPVAI AGR L+ RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  387  ST-AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
               A + Y +I T VF+    G  G +E  + E++G  N++ Y   FV L  ++++    
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  446  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
               +  L        D+ VVG H  G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  122  GKTAMKL---VTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHP  175

>PYVX_20512
Length=528

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 121/493 (25%), Positives = 202/493 (41%), Gaps = 56/493 (11%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            DYDLVVIG G     C+ E+A  G++V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  98   QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            ++ L +    HH      +++ +       +  +++VA+    I       K +L++  V
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKNITIDDILYRVQRVVASEVDVI-------KAQLKAARV  141

Query  157  KYENFLGSFVDAHTLELWHPRKGT----------------KQITTRDVVIAVGGRPKE--  198
             Y     SF   H L +      +                 ++     +IA G RP    
Sbjct  142  DYIAGTASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNP  201

Query  199  LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSIL  255
            L    G+    SD I   +  + P   +VVGA  + +E A  +  + G+ V V+  R  +
Sbjct  202  LVPVDGKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDI  261

Query  256  LRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTV  315
            L   D ++ + +   M  + G  F+     +SI K E G   VK     G+      D +
Sbjct  262  LSFCDTEIISNLMYEMRSK-GARFLLGETIKSIEKSERG---VKVFFNSGKVATA--DAL  315

Query  316  LNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQA  375
            L   GR      L L+   +  N +      KN QT   +IYA GD I AP L   +++ 
Sbjct  316  LYTVGRQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQ  375

Query  376  GRLLSRRLYNN-----STAQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEVYH  429
            GRL +  ++++     ST+Q+D       ++T  E    G +E+  +KE     N EV  
Sbjct  376  GRLAACHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGV---NYEVGI  432

Query  430  KNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGF  489
              +   E +  + T   A      + C  + + F  G H +G  A E+     +A+ +G 
Sbjct  433  AKYS--ELAKGQMTGAIAGGMLKILFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMGC  488

Query  490  TYDQMVDTVGIHP  502
            +     + V  +P
Sbjct  489  SLTYFRNAVFNYP  501

>PHALS_10055
Length=516

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 117/497 (24%), Positives = 209/497 (42%), Gaps = 67/497 (13%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            +YDL+VIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  98   QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            ++ L +    HH      +++ +       +  +++V++ +  +R      +V++   + 
Sbjct  83   EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  142

Query  157  KYENFLGSFVDAHTLELWHP--RKGTKQITTRDV-----------VIAVGGRPKE--LTC  201
            ++EN        H + +      +  K+I+   V           +IA G RP    L  
Sbjct  143  RFEN-------EHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIP  195

Query  202  PGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRG  258
              G+  I SD I        P   +V+GA  + +E A  +  + G+ V V+  R  +L  
Sbjct  196  IDGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPF  255

Query  259  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNA  318
             D ++ + +   M+  +G  F+   + +++ K+E  +  VK     G+      D +L  
Sbjct  256  CDLEIISNLTYEMQ-SNGARFL---LGETVKKVETTKNQVKVFFNSGKVLSA--DALLYT  309

Query  319  TGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGR  377
             GR      L L+   +  N + G I V KN QT  P+IYA GD I AP L   +++ GR
Sbjct  310  VGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGR  368

Query  378  LLSRRLYN-----NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNF  432
            L S  ++       +T+Q++       ++T  E    G +E+               KN 
Sbjct  369  LASCHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQ------------LTKNC  416

Query  433  VPLEWSLSEETRTAAESCY-------LKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAM  485
            +  E  +++ +  A            LK++ D      ++G H +G  A E      +AM
Sbjct  417  INYEIGIAKYSELAKGQMMGAMAGGTLKILFDP-ETLSLLGVHAIGEGATETIHIGQVAM  475

Query  486  KLGFTYDQMVDTVGIHP  502
             +G +     D V  +P
Sbjct  476  AMGCSLTYFRDAVFNYP  492

>PITG_18935
Length=480

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 128/478 (27%), Positives = 213/478 (45%), Gaps = 53/478 (11%)

Query  35   TSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKK  94
            +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  95   LMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSK  154
             +  S+ +     HD  ++G      D      ++ Q++ + +  ++ +    ++  +  
Sbjct  78   ALLHSTHLLHTAQHDFKSYGI-----DAPEVKANFPQMMKSKEKAVKTLTGGIELLFKKN  132

Query  155  YVKYENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA----IS  209
             V Y    G       + +  +  KG + +  ++++IA G     L     ++A    I 
Sbjct  133  KVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  192

Query  210  SDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGE  269
            S     +K+  P   +VVGA    +E   FL                 G D++   +  +
Sbjct  193  STGALELKRV-PEHLVVVGAGVTVVE---FLDAA------------CPGSDKEAVKEFTK  236

Query  270  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTED---GESCEEAFDTVLNATGRDPDVA  326
             ++ Q G++F   T    +T  E    +VK TTE    G++     DTVL ATGR    +
Sbjct  237  LLKKQ-GLDFQFNT---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTS  292

Query  327  KLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  385
             LGL++  ++  +K GRI V +  +T  P I+AIGDVI    L   A + G      +  
Sbjct  293  GLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAG  351

Query  386  NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRT  445
                 ++Y  I   ++T  E+   G +EE+ K    E N+  +     P+    +   RT
Sbjct  352  KH-GHVNYGAIPGVIYTFPEFASVGKTEEELKAEGIEYNVGKF-----PMMA--NSRART  403

Query  446  AAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             AE+   +KV+ DK  DK  +G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  404  IAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  460

>PYIR_14132
Length=513

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 128/509 (25%), Positives = 218/509 (43%), Gaps = 59/509 (12%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E + S  +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +
Sbjct  4    ELKASEHFDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTV  55

Query  92   PKKLMHQSSLIGELMHHDS---------ANFG-----WNIASADGSASTFSWKQLVANVD  137
            P K   +++L      H S           FG       +   + + +  +  QL+ N  
Sbjct  56   PSKTFREATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNI  115

Query  138  GYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRD-VVIAVGGRP  196
              I G   ++  +   K V   +   S+  A   +        K++ T D  +IAVG RP
Sbjct  116  ELING-TARFLPDAGKKMVAVLSN-DSYTTATDAKRHSSADICKRVLTADKFLIAVGTRP  173

Query  197  -KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-  251
             +    P  G+    SD + W   K  P + +VVGA  + +E A  +  + G +V ++  
Sbjct  174  ARRPDIPFDGQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDG  233

Query  252  RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEA  311
            R  +L   D++++  +   M  Q+G  F  +   +S+ K +NG+++V   +  G++    
Sbjct  234  RKEILDMADREVSEALCYSMR-QTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--V  288

Query  312  FDTVLNATGRDPDVAKLGLDKARVKLN-EKTGRIWVKNE-QTSTPNIYAIGDVIDAPELT  369
             D +L   GR  +    GL+ A V L  +K G I V ++ QT  P+IYA GD I  P L 
Sbjct  289  GDGLLYTLGRQGNTE--GLNLAAVGLEADKRGLIQVDDDFQTDVPHIYAAGDCIGFPALA  346

Query  370  PVAIQAGRLLSRRLYN---------NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERY  420
              +++ GRL S  +           + T   D   + T + +  E    G+         
Sbjct  347  STSMEQGRLASVHMRTSKPTNKKGESETESTDPQYMRTRMRSG-EVFPFGIYTVPEISMV  405

Query  421  GEDNIEVYHKNFVPLEWSLSEETRTAAESC------YLKVI-CDKTRDKFVVGFHYLGPN  473
            G++  ++  +N +P E  ++     A          +LK+I C KT    V+G H +G  
Sbjct  406  GKNEQQLTSQN-IPYEVGVARYEELAKGQMLGGVPGFLKIIFCPKTLQ--VLGVHAIGEG  462

Query  474  AGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            A E+     + M  G T +   + V  +P
Sbjct  463  ATEIIHIGQVVMSTGGTIEYFRNAVFNYP  491

>PYIW_19795
Length=519

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 118/487 (24%), Positives = 200/487 (41%), Gaps = 52/487 (11%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLV-ANVDGYIRGINFKYKVELRSKYV  156
            + L +    HH      +++ +       +  K++V + VD          K +L++  V
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVD--------VIKAQLKAARV  140

Query  157  KYENFLGSFVDAHTLELWHPRKGTK-----------QITTRDVVIAVGGRPKE--LTCPG  203
            +Y   L  F   H + +       +           ++     +IA G RP    L    
Sbjct  141  EYIPGLARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPID  200

Query  204  GEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFD  260
            G+    SD I     +E P   +VVGA  + +E A  L  + G+ V V+  R  +L   D
Sbjct  201  GKVIFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCD  260

Query  261  QDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATG  320
             ++ + +   M    G  F+     + + K E+G   V      G++     D +L   G
Sbjct  261  NEIISNLTYEMR-SKGARFLLGETIKQVEKTEDG---VTVHFNSGKTATA--DALLYTVG  314

Query  321  RDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
            R      L L+   +  N +       + QT+  +IYA GD I AP L   +++ GRL +
Sbjct  315  RQASTDGLNLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAA  374

Query  381  RRLYNNS----TAQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFVPL  435
              +++      T+Q++       ++T  E    G +E+  +KE     N E+    +  L
Sbjct  375  CHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKE---GANYEIGIAKYSEL  431

Query  436  EWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
                  +   +     LK++ D T  K  +G H +G  A E+     +AM +G +     
Sbjct  432  AKG---QMSGSTAGGMLKILFDPTTLKL-LGVHAIGEGATEIIHIGQVAMAMGCSVTYFR  487

Query  496  DTVGIHP  502
            D V  +P
Sbjct  488  DAVFNYP  494

>SDRG_14446
Length=495

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 116/475 (24%), Positives = 203/475 (43%), Gaps = 39/475 (8%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            +YDLVVIG G   + C+ E+   G+ V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  98   QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            +S L      H    +G + A  +      +   ++  V+  +       + +L++  V 
Sbjct  80   ESVLHLSGFRHQGF-YGKSYARDN-----ITLNDILGRVNTVVSKEMDVIQAQLKAARVD  133

Query  158  YENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEHAISSDDIF-  214
                L  F + + + +        ++  +  ++A G RP    L    G+  + SD I  
Sbjct  134  LVPGLARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILN  193

Query  215  WMKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYME  272
                K P   +VVGA  + +E A  L  + G +V V+  R+ +L   D ++ + +   M 
Sbjct  194  HGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMR  253

Query  273  VQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDK  332
               G  F+     +S+   +NG   VK     G++     + +L   GR  +   L L+ 
Sbjct  254  -HKGARFLLGESIKSVEHFKNG---VKVEFNSGKAMFA--EALLYCVGRQANTDGLNLEA  307

Query  333  ARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN---ST  388
              +  N + G I V  + QTS P+IYA GD I AP L   +++ GRL +  ++++   +T
Sbjct  308  VGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTT  366

Query  389  AQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447
            +Q++       ++T  E    G +E+  +KE     N  V    F      L++   +  
Sbjct  367  SQLESGNYPYGIYTIPEISMVGKTEQQLTKE---GANYAVGLAKF----SELAKGQMSGD  419

Query  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                LK++ D    +  +G H +G  A E+     +AM +        D V  +P
Sbjct  420  IEGILKLLFDPVSLQL-LGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYP  473

>PPTG_13000
Length=387

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 153/335 (46%), Gaps = 25/335 (7%)

Query  178  KGTKQITTRDVVIAVGGRPKELTCPGGEHA----ISSDDIFWMKKKEPGKTLVVGASYVA  233
            KG + +  ++++IA G     L     ++A    I S     +K+  P   +VVGA  + 
Sbjct  48   KGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALELKRV-PEHLVVVGAGVIG  106

Query  234  LECAGFLKGMGYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLE  292
            LE     K +G  V V+        G D++   +  + ++ Q G++F   T    +T  E
Sbjct  107  LELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEFTKLLKKQ-GLDFKFGT---KVTSSE  162

Query  293  NGQLLVKWTTE---DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE  349
                +VK TTE    G++     DTVL ATGR    A LGL++  ++  +K GRI V + 
Sbjct  163  VNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKLGRIEVDDA  221

Query  350  -QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGC  408
             +T  P I+AIGDVI    L   A + G      +       ++Y  +   ++T  E+  
Sbjct  222  FRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAVPGVIYTFPEFAS  280

Query  409  CGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKFVVGF  467
             G +EE+ K    E N+  +     P+  +     RT AES   +KV+ DK  DK + G 
Sbjct  281  VGKTEEELKAEGIEYNVGKF-----PMMAN--SRARTVAESDGLVKVLADKKTDKLL-GV  332

Query  468  HYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            H +  NAGE+     + ++ G   + +  T   HP
Sbjct  333  HIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHP  367

>PHYCA_555180
Length=521

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 121/498 (24%), Positives = 207/498 (42%), Gaps = 65/498 (13%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  83   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  142

Query  158  YEN----------------------FLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGR  195
            +EN                        GS  +  +L   H  K          +IA G R
Sbjct  143  FENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK---------FLIACGTR  193

Query  196  PKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM-  250
            P    L    G+  I SD I      + P   +V+GA  + +E A  +  + G+ V V+ 
Sbjct  194  PAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVD  253

Query  251  VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEE  310
             R  +L   D+++ + +   M+  +G  F+   + +++ K+E     VK   + G+    
Sbjct  254  GRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVEVTDR-VKVFFDSGKVLSA  308

Query  311  AFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAPELT  369
              D +L   GR      L L+   +  N + G I V KN QT  P+IYA GD I AP L 
Sbjct  309  --DALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALA  365

Query  370  PVAIQAGRLLSRRLYNNS-----TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDN  424
              +++ GRL S  ++N       T+Q++       ++T  E    G +E+   +     N
Sbjct  366  STSMEQGRLASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTK--ACIN  423

Query  425  IEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLA  484
             E+    +  L      +   A     LK++ D    K V G H +G  A E+     +A
Sbjct  424  YEIGVAKYSELAKG---QMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVA  479

Query  485  MKLGFTYDQMVDTVGIHP  502
            M +  +     D V  +P
Sbjct  480  MAMDCSLTYFRDAVFNYP  497

>H310_07641
Length=548

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 108/389 (28%), Positives = 167/389 (43%), Gaps = 54/389 (14%)

Query  25   STPSAVDEA----ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWG  80
            S PS   E       S  +DLVVIG G  G  C+ ++A  G+KV ++D            
Sbjct  23   SKPSDFSEVLRNLRASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH-------  75

Query  81   LGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYI  140
             GG CV+ G IP K   ++ L   L  H    F  N  +A  +    S ++++  V    
Sbjct  76   -GGVCVHTGTIPSKTFREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVE  132

Query  141  RGINFKYKVELRSKYVKYENFLGSFV-------------DAHTLELWHPRKGTKQITTR-  186
                   + +L    +   N    F+             D++T +    R     I  R 
Sbjct  133  EAETDLTRNQLTRNGIILINGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRV  192

Query  187  ----DVVIAVGGRPKELTCPG----GEHAISSDDIFWMKKK-EPGKTLVVGASYVALECA  237
                 V+IAVG RP     P     G     SD + W      P + +VVGA  + +E A
Sbjct  193  LTADKVLIAVGTRPAR--HPDLEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYA  250

Query  238  GFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLE---  292
              +  + G  V V+  R  +L   D+++++ +  YM  Q G  F+ +   +SI K+E   
Sbjct  251  SMISIIPGTQVTVIDGRKEILDMADKEVSDALCYYMR-QRGSRFLTE---ESILKVETKD  306

Query  293  NGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QT  351
            + +++V  T+  G+      D +L   GR  +VA L L+   +  N K G + V N  QT
Sbjct  307  DSEVVVHLTS--GKVI--MGDALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQT  361

Query  352  STPNIYAIGDVIDAPELTPVAIQAGRLLS  380
            + P+IYA GD I  P L   +++ GRL S
Sbjct  362  AVPHIYAAGDCIGYPALASTSMEQGRLAS  390

>SPRG_12054
Length=558

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 133/547 (24%), Positives = 225/547 (41%), Gaps = 84/547 (15%)

Query  8    IQESALNTKKNMQIHDPST-PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCV  66
            +  + L+T+   +  D S+  + +     S  +DLVVIG G  G  C+ ++A  G+KV +
Sbjct  17   VLRAGLSTEAEAKADDASSFTNILRNLRASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAI  76

Query  67   LDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA------  120
            +D             GG CV+ G IP K   ++ L   L  H    F  N  SA      
Sbjct  77   IDKKDMH--------GGVCVHTGTIPSKTFREAVL--HLTAHRHKGFYGNAYSATSGKRM  126

Query  121  ------------DGSASTFSWKQLVANVDGYIRGI-NFKYKVELRSKYVKYENFLGSFVD  167
                        + +    +  QL+ N    I G   F    + ++  V   +   S+ +
Sbjct  127  SIQDILDRVQKVESAEMDLTRNQLLRNGIYLINGTARFLPDADKKTVAVLSND---SYTE  183

Query  168  AHTLELWHPRKGTKQITTRD-VVIAVGGRPKELTCPG----GEHAISSDDIFW-MKKKEP  221
            A   +        K++ T D  +I+VG RP     P     GE    SD + W      P
Sbjct  184  ATDGQRHSDANICKRVLTADKFLISVGTRPAR--HPNMDFDGELIFDSDQLLWGALTNVP  241

Query  222  GKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKI-------GEYME  272
             + +VVGA  + +E A  +  + G  V V+  R  +L   D+++++ +       G    
Sbjct  242  KRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEILEMADKEVSDALCYSMRQRGTRFL  301

Query  273  VQSGIEFIRKTVPQS--ITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGL  330
             +  I+F+ K + +   +  L++G+++V              D +L   GR  +V  L L
Sbjct  302  TEETIDFVEKRLDEKEVVVHLKSGKIIVG-------------DALLYTQGRQGNVTGLDL  348

Query  331  DKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTA  389
            +   ++ N + G + V N  QTS P+IYA GD I  P L  V+++ GRL S  +  +   
Sbjct  349  EAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYPALASVSMEQGRLASVHMRTSEPT  407

Query  390  ---QMDYDKICTAVF-TPIEYGCC---GLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEE  442
               + D D   T+ F T +  G     G+         G+   ++  +N VP E  ++  
Sbjct  408  NKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSEQQLTKEN-VPYEVGVARY  466

Query  443  TRTA------AESCYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  495
               A          +LK+I C  T    ++G H +G  A E+     + M  G T +   
Sbjct  467  EELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGEGATEIIHIGQVVMSTGGTLEYFR  524

Query  496  DTVGIHP  502
            + V  +P
Sbjct  525  NAVFNYP  531

>H257_07450
Length=567

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 162/374 (43%), Gaps = 50/374 (13%)

Query  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
            S  +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K 
Sbjct  36   SEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  87

Query  96   MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKY  155
              ++ L   L  H    F  N  +A  +    S ++++  V           + +L    
Sbjct  88   FREAVL--HLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNG  145

Query  156  VKYENFLGSFV-------------DAHTLELWHPRKGTKQITTR-----DVVIAVGGRPK  197
            +   N    F+             D++T +    R     I  R      V+IAVG RP 
Sbjct  146  IILINGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPA  205

Query  198  ELTCPG----GEHAISSDDIFWMKKK-EPGKTLVVGASYVALECAGFLKGM-GYDVKVMV  251
                P     G     SD + W      P + +VVGA  + +E A  +  + G  V V+ 
Sbjct  206  RR--PDLDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVID  263

Query  252  -RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLE---NGQLLVKWTTEDGES  307
             R  +L   D+++++ +  YM  + G  F+ +   +SI K+E   N ++LV  T+  G+ 
Sbjct  264  GRKEILDMADKEVSDALCYYMR-KRGSRFLTE---ESIVKVETKDNSEVLVYLTS--GKV  317

Query  308  CEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAP  366
                 D +L   GR  +VA L L+   +  N K G + V N  QT  P+IYA GD I  P
Sbjct  318  I--VGDALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYP  374

Query  367  ELTPVAIQAGRLLS  380
             L   +++ GRL S
Sbjct  375  ALASTSMEQGRLAS  388

>PYU1_G005699
Length=550

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 132/530 (25%), Positives = 227/530 (43%), Gaps = 55/530 (10%)

Query  5    RLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKV  64
            R ++  SA  T     + D      + E + S  +DL+VIG G  G  C+ ++A  G+ V
Sbjct  21   RRALSSSATTTSGGKPLSD-----MLRELKASEHFDLIVIGSGPAGQKCAIDSAKHGKSV  75

Query  65   CVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD-GS  123
             ++D             GG CV+ G +P K   +++L      H S   G +  +   G 
Sbjct  76   AIIDKRDMH--------GGVCVHTGTVPSKTFREATLHLTAYRHRSFYDGQSSPTKRFGI  127

Query  124  ASTFSWKQLVANVDGYI-RGINFKYKVELRSKYVKY-----ENFLGSFV-DAHTLELWHP  176
                   + V + +  I R    +  VEL +   ++     +N +     D++T      
Sbjct  128  EDILQRVKKVEHAETDITRHQLLRNGVELINGTARFLPDANKNMIAVLSNDSYTTATDAK  187

Query  177  RKGT----KQITTRD-VVIAVGGRP-KELTCP-GGEHAISSDDIFWMK-KKEPGKTLVVG  228
            R  +    K++ T D  +IAVG RP +    P  G+    SD + W   K  P + +VVG
Sbjct  188  RHASADICKRVLTADKFLIAVGTRPARRPDIPFDGQAVFDSDQLLWGGVKTVPKRLIVVG  247

Query  229  ASYVALECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQ  286
            A  + +E A  +  + G +V ++  R  +L   D++++  +   M  Q+G  F  +   +
Sbjct  248  AGVIGMEYASMMSIIPGMEVTIIDGRKEILDMADREVSEALCYSMR-QTGARFFVEETIK  306

Query  287  SITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV  346
            S+ K+ NG+++V   +  G++     D +L   GR  +   L L    ++  +K G I V
Sbjct  307  SVEKV-NGEVIVHLNS--GKTL--VGDGLLYTLGRQGNTDGLNLPAVGLE-ADKRGLIQV  360

Query  347  -KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTA---VFT  402
             +N QT+ P+IYA GD I  P L   +++ GRL S  +          D   T    + T
Sbjct  361  DENFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTEKPTNKTGDSESTDPQFMRT  420

Query  403  PIEYGCC---GLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC------YLK  453
             +  G     G+         G++  ++  +N VP E  L+     A          +LK
Sbjct  421  RMRSGDVFPFGIYTVPEISMVGKNEQQLTKEN-VPYEVGLARYEELAKGQMLGGVPGFLK  479

Query  454  VI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +I C KT    ++G H +G  A E+     + M  G T +   + V  +P
Sbjct  480  IIFCPKTLQ--LLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  527

>PYIW_20257
Length=503

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 97/360 (27%), Positives = 152/360 (42%), Gaps = 66/360 (18%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E + S  +DL+VIG G  G  C+ + A  G+ V V+D            LGG C++ G +
Sbjct  43   ELKASEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTV  94

Query  92   PKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVEL  151
            P K   +++L      H S   G +       A  F  + ++  V               
Sbjct  95   PSKTFREATLHLTAYRHRSFYEGQST-----PAKRFGIEDILQRVK--------------  135

Query  152  RSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRP-KELTCP-GGEHAIS  209
                           D H  +    R+  +       +IAVG RP +    P  GE    
Sbjct  136  ------------KLHDRHGRQTPLERRHLQAF-----LIAVGTRPARRPDIPFDGETIFD  178

Query  210  SDDIFWMKKKE-PGKTLVVGASYVALECAGFLK---GMGYDVKVMVRSILLRGFDQDMAN  265
            SD + W   K  P + +VVGA  + +E A  +    GM   +    R IL      DMA+
Sbjct  179  SDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREIL------DMAD  232

Query  266  K-IGE---YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGR  321
            + + E   Y   Q+G  F  +   +S+ K +NG+++V   +  G++     D +L   GR
Sbjct  233  REVSEALCYSMRQTGARFFVEETIKSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLGR  288

Query  322  DPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
              +   L L+   +K  +K G I V ++ QT+ P+IYA GD I  P L   +++ GRL S
Sbjct  289  QGNTEGLNLEAIGLK-ADKRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLAS  347

>SDRG_05060
Length=559

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 129/518 (25%), Positives = 213/518 (41%), Gaps = 83/518 (16%)

Query  36   SYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  95
            S  +DLVVIG G  G  C+ ++A  G+KV ++D             GG CV+ G IP K 
Sbjct  47   SEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKT  98

Query  96   MHQSSLIGELMHHDSANFGWNIASA------------------DGSASTFSWKQLVANVD  137
              ++ L   L  H    F  N  SA                  + +    +  QL+ N  
Sbjct  99   FREAVL--HLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGI  156

Query  138  GYIRGI-NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRD-VVIAVGGR  195
              I G   F    + ++  V   +   S+ +A   +        K++ T D  +I+VG R
Sbjct  157  YLINGTARFLPDADKKTVAVLSND---SYTEATDGQRHSDANICKRVLTADKFLISVGTR  213

Query  196  PKELTCPG----GEHAISSDDIFW-MKKKEPGKTLVVGASYVALECAGFLKGM-GYDVKV  249
            P     P     GE    SD + W      P + +VVGA  + +E A  +  + G  V V
Sbjct  214  PAR--HPNMDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTV  271

Query  250  MV-RSILLRGFDQDMANKI-------GEYMEVQSGIEFIRKTVPQS--ITKLENGQLLVK  299
            +  R  +L   D+++++ +       G     +  I+F+ K + +   +  L++G+++V 
Sbjct  272  IDGRKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG  331

Query  300  WTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYA  358
                         D +L   GR  +V  L L+   ++ N + G + V N  QTS P+IYA
Sbjct  332  -------------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYA  377

Query  359  IGDVIDAPELTPVAIQAGRLLSRRLYNNSTA---QMDYDKICTAVF-TPIEYGCC---GL  411
             GD I  P L  V+++ GRL S  +  +      + D D   T+ F T +  G     G+
Sbjct  378  AGDCIGYPALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGI  437

Query  412  SEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTA------AESCYLKVI-CDKTRDKFV  464
                     G+   ++  +N VP E  ++     A          +LK+I C  T    +
Sbjct  438  YTVPEISMVGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--L  494

Query  465  VGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +G H +G  A E+     + M  G T +   + V  +P
Sbjct  495  LGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  532

>HYAP_04149
Length=564

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 102/399 (26%), Positives = 169/399 (42%), Gaps = 45/399 (11%)

Query  11   SALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYV  70
            S+ +   N++ +       + E   S  +DL+VIG G  G  C+ ++A  G  V ++D  
Sbjct  25   SSRSNSPNLEANKQLLTETLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--  82

Query  71   KPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWK  130
                      LGG CV+ G +P K   +++L   L  +    F    A            
Sbjct  83   ------KRDMLGGVCVHTGTVPSKTFREAAL--HLTGYRHRAFYNGQAGPSKRVGVEDIL  134

Query  131  QLVANVD----GYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQ----  182
            Q V  V+       R    +  V+L +   ++       +   + E +      K+    
Sbjct  135  QRVNKVEKAETDITRHQLMRNGVQLITGTARFMPGNSHMIAVLSNESYETATDAKRHSSA  194

Query  183  ------ITTRDVVIAVGGRP-KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVA  233
                  +T  + ++ VG RP +    P  GE    SD + W K K  P + +VVGA  V 
Sbjct  195  NICKRVLTADNFLVCVGTRPARRADIPFDGETIFDSDQLLWGKVKAVPRRLIVVGAGVVG  254

Query  234  LECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKL  291
            +E A  +  + G DV V+  R  +L   D++++  +  Y   Q+G  F+   V +S+ K 
Sbjct  255  MEYASMMSIIPGTDVTVIDGRKEILEMADKEVSEALC-YSMAQTGTRFLVDEVIKSVEKS  313

Query  292  ENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-Q  350
              G++ V    E G++     D +L   GR  +V  L L+   +   +K GRI V N  Q
Sbjct  314  AKGEVGVHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIIVDNNFQ  368

Query  351  TSTPNIYA---------IGDVIDAPELTPVAIQAGRLLS  380
            T+ P++YA          GD+I  P L   +++ GRL S
Sbjct  369  TAVPHMYAQSRLIADQNAGDIIGFPALASTSMEQGRLAS  407

>PYVX_23499
Length=519

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 127/521 (24%), Positives = 209/521 (40%), Gaps = 81/521 (16%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E + S  +DL+V+G G  G  C+ ++A  G+ V ++D            LGG CV+ G +
Sbjct  8    ELKASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTV  59

Query  92   PKKLMHQSSLIGELMHH----DSANFG----------WNIASADGSASTFSWKQLVANVD  137
            P K   +++L      H    DSA+              +   +G+ +  +  QL+ N  
Sbjct  60   PSKTFREATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNV  119

Query  138  GYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT-KQITTRD-VVIAVGGR  195
              I G       E R+      N   +  D  T    H      K++ T D  +I VG R
Sbjct  120  ELIHGTARFLPDEKRNMVAVLSN---AKYDTPTDAKRHTSADICKRVLTADKFLICVGTR  176

Query  196  P--KELTCPGGEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYDVKVMV  251
            P  +E     G+    SD + W   K  P + +VVGA  + +E A  +  + G +V V+ 
Sbjct  177  PARREDIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVID  236

Query  252  -RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEE  310
             R  +L   D++++  +   M  Q+G  F  +   + + K ENG+++    +  G+    
Sbjct  237  GRKEILDMADKEVSESLCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHLNS--GKVI--  291

Query  311  AFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPELT  369
              D +L   GR  +   L L    ++  +K G + V ++ QT  P+IYA GD I  P L 
Sbjct  292  VGDGLLYTLGRQGNTDGLNLQAVGLE-TDKRGFLNVNDDFQTEVPHIYAAGDCIGYPALA  350

Query  370  PVAIQAGRLLSRRLYNNSTAQM-----------DYDKI----------CTAVFTPIEYGC  408
              +++ GRL S  +   S               D ++I             ++T  E   
Sbjct  351  STSMEQGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISM  410

Query  409  CGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC------YLKVI-CDKTRD  461
             G +E+               K  VP E  L+     A          +LK+I C  T  
Sbjct  411  VGKNEQQ------------LTKENVPYEVGLARYEELAKGQMLGGVPGFLKIIFCPDTLK  458

Query  462  KFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
              V+G H +G  A E+     + M  G T +   + V  +P
Sbjct  459  --VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  497

>PHYKE_9807
Length=557

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 127/525 (24%), Positives = 206/525 (39%), Gaps = 92/525 (18%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E   S  +DL+VIG G  G  C+ ++A  G+ V ++D            LGG CV+ G  
Sbjct  49   ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTT  100

Query  92   PKKL-MHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVE  150
             ++  MH +       ++        I   D         Q V  V+     I    + +
Sbjct  101  FREAAMHLTGYRHRAFYNGHGGISKRIGVED-------ILQRVKKVEAAETDIT---RHQ  150

Query  151  LRSKYVKYENFLGSFV--DAHTL-----ELWHPRKGTKQITTRDVVIAVGGRPKELTCPG  203
            L+   V+  +    F+  D+H L     E +      K+ T  D+   V    K L C G
Sbjct  151  LQRNGVQLISGTARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVG  210

Query  204  ------------GEHAISSDDIFWMK-KKEPGKTLVVGASYVALECAGFLKGM-GYDVKV  249
                        GE    SD + W K K  P + ++VG   V +E A  +  + G DV V
Sbjct  211  TRPARHPDIPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTV  270

Query  250  M-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESC  308
            +  R  +L   D++++  +  Y   Q+G  F+     + + K   G++LV+   + G++ 
Sbjct  271  IDGRKEILNMADKEVSEALC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVRL--DSGKTV  327

Query  309  EEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPNIYAIGDVIDAPE  367
                D +L   GR  +V  L L+   +   +K GRI V N  QT  P+IYA GD+I  P 
Sbjct  328  --VGDGLLYTVGRQGNVEGLHLESVGIH-PDKRGRIKVDNNFQTEVPHIYAAGDIIGFPG  384

Query  368  LTPVAIQAGRLLSRRLYNNSTAQM-------------DYDKICT----------AVFTPI  404
            L   +++ GRL S  +   S                 D D++ T           ++T  
Sbjct  385  LASTSMEQGRLASVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSGEVFPFGIYTVP  444

Query  405  EYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC------YLKVI-CD  457
            E    G +E+   +              VP E  ++     A          +LK+I C 
Sbjct  445  EISMVGKNEQQLTQEQ------------VPYEVGMARYEELARGQMLGGVPGFLKIIFCP  492

Query  458  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             T    ++G H +G  A E+     + M  G T +   + V  +P
Sbjct  493  NTLQ--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVMNYP  535

>CCI39993
Length=550

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 125/523 (24%), Positives = 213/523 (41%), Gaps = 64/523 (12%)

Query  21   IHDPSTPSAVD---EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGT  77
            I  P T +  D   + + S  YDL+VIG G  G  C+ ++A  G+ V ++D  +      
Sbjct  24   IPSPKTTALTDMLRDLKASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH----  79

Query  78   SWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIAS----------------AD  121
                GG CV+ G +P K   ++ L   L  H   NF   ++S                 +
Sbjct  80   ----GGVCVHTGTVPSKTFREAIL--HLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVE  133

Query  122  GSASTFSWKQLVANVDGYIRGI-NFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGT  180
             + +  +  QLV N    I G   F      +  Y +  +     ++    EL       
Sbjct  134  NAETDITRHQLVRNNVELINGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNG--  191

Query  181  KQITTRDVVIAVGGRP--KELTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECA  237
            K +T    +IAVG RP  ++     G+    SD I W   K  P + +VVGA  + +E A
Sbjct  192  KILTADKFLIAVGTRPARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYA  251

Query  238  GFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  295
              +  + G  V V+  R  +L   D+++   +  Y   Q+G  F  +   + +      +
Sbjct  252  SMMSIIPGAQVTVIDGRKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDE  310

Query  296  LLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLN-EKTGRIWV-KNEQTST  353
            +++   +  G++     D +L   GR  +    GLD + + L  +K G I V +N QTS 
Sbjct  311  VIIHLNS--GKTI--VGDGLLYTVGRQGNTE--GLDLSAIGLQTDKRGLIKVNENFQTSV  364

Query  354  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNN-----------STAQMDYDKICTAVFT  402
            P+IYA GD    P L   +++ GRL S  +  +           +  Q    ++ +  F 
Sbjct  365  PHIYAAGDCTGFPALASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFF  424

Query  403  PIEYGCCGLSEED--SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI-CDKT  459
            P  +G   + E     K  Y      + ++  V     L++         +LK+I C  T
Sbjct  425  P--FGIYTVPEISMVGKNEYQLTKEGIAYEVGVARYEELAKGQMLGGVPGFLKIIFCPTT  482

Query  460  RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             +  ++G H +G  A E+     + M  G T +   + V  +P
Sbjct  483  LN--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  523

>PYAP_19148
Length=535

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 130/524 (25%), Positives = 213/524 (41%), Gaps = 79/524 (15%)

Query  32   EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCI  91
            E + S  +DL+VIG G  G  C+ + A  G+ V ++D             GG CV+ G +
Sbjct  4    ELKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTV  55

Query  92   PKKLMHQSSLIGELMHHDS---------ANFG-----WNIASADGSASTFSWKQLVANVD  137
            P K   ++ L      H S           FG       +   + + +  +  QL+ N  
Sbjct  56   PSKTFREAILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGI  115

Query  138  GYIRGINFKYKVELRSKYV------KYENFLGSFVDAHTLELWHPRKGTKQ-------IT  184
              I G   ++  +   K V       YE    +    HT      R G          +T
Sbjct  116  ELING-TARFLPDPSKKMVAVLSNDSYET--ATDTKRHTSADICKRTGADSSILLISVLT  172

Query  185  TRDVVIAVGGRP-KELTCP-GGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLK  241
                ++AVG RP +    P  G+    SD I W      P + +VVGA  + +E A  + 
Sbjct  173  ADKFLVAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMS  232

Query  242  GM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVK  299
             + G +V V+  R  +L   D+++A  + +Y   Q+G  F       ++ K  NG+++VK
Sbjct  233  IIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVK  291

Query  300  WTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLN-EKTGRIWVK-NEQTSTPNIY  357
              +  G++     D +L   GR  +    GL+ A V L  +K G + V  N +TS P+IY
Sbjct  292  LNS--GKTI--VGDGLLYTVGRQGNTD--GLNLAAVGLEADKRGLLKVDDNFRTSVPHIY  345

Query  358  AIGDVIDAPELTPVAIQAGRLLS----------RRLYNNSTAQMDYDKICT--------A  399
            A GD I  P L   +++ GRL S          ++  +N  +   Y +            
Sbjct  346  AAGDCIGYPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFG  405

Query  400  VFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVI-CDK  458
            ++T  E    G SE    ++   +NI  Y       E  L++         +LK++ C K
Sbjct  406  IYTVPEISMVGKSE----QQLTRENIP-YEVGVARYE-ELAKGQMLGGVPGFLKIVFCPK  459

Query  459  TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +    V+G H +G  A E+     + M  G T +   + V  +P
Sbjct  460  SLQ--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYP  501

>PYAR_16664
Length=577

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 103/396 (26%), Positives = 171/396 (43%), Gaps = 60/396 (15%)

Query  30   VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  89
            + + + S  +DL+VIG G  G  C+ + A  G+ V ++D            +GG C++ G
Sbjct  55   LQDLKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTG  106

Query  90   CIPKKLMHQSSLIGELMHHDS---------ANFG-----WNIASADGSASTFSWKQLVAN  135
             +P K   ++ L      H S           FG       +   + + +  +  QL+ N
Sbjct  107  TVPSKTFREAILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRN  166

Query  136  VDGYIRG-------------INFKYKVELRSKYVKY-ENFLGSFVDAHTLELWHPRKGTK  181
                I G             I  +  +EL +   ++  +     V   + + +     TK
Sbjct  167  GIELINGTARFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAVLSNDSYDTPTDTK  226

Query  182  QITTRDV----------VIAVGGRP--KELTCPGGEHAISSDDIFWMKKKE-PGKTLVVG  228
            + T+ D+          +IAVG RP  +E     G+    SD I W      P + +VVG
Sbjct  227  RHTSADICKRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQILWGGVDAVPKRLIVVG  286

Query  229  ASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQ  286
            A  + +E A  +  + G +V V+  R  +L   D+++A  + +Y   QSG  F      +
Sbjct  287  AGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIK  345

Query  287  SITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL-NEKTGRIW  345
            S+ K  NG+++VK  +  G++     D +L   GR       GL+ A V L  +K G + 
Sbjct  346  SVEKAANGEVIVKLNS--GKTI--IGDGLLYTVGRQGSTD--GLNLAAVGLETDKRGLLQ  399

Query  346  VK-NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
            V  N +TS P+IYA GD I  P L   +++ GRL S
Sbjct  400  VDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRLAS  435

>CCA14030
Length=560

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 107/394 (27%), Positives = 170/394 (43%), Gaps = 60/394 (15%)

Query  21   IHDPSTPSAVD---EAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGT  77
            +  P T    D   + + S  YDL+V+G G  G  C+ ++A  G+ V ++D  +      
Sbjct  34   VSSPKTAVLTDMLRDLKASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH----  89

Query  78   SWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASAD---GSASTFSWKQLVA  134
                GG CV+ G +P K   ++ L   L  H   NF   ++S     G     +  + V 
Sbjct  90   ----GGVCVHTGTVPSKTFREAIL--HLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVE  143

Query  135  NVDGYI-RGINFKYKVELRSKYVKY-----ENFLG----SFVDAHTLELWHPRKGTKQ--  182
            N +  I R    +  VEL +   ++     +N +     S  +  T    H R    Q  
Sbjct  144  NAETDITRHQLVRNNVELINGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRI  203

Query  183  ITTRDVVIAVGGRP--KELTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGF  239
            +T    +IAVG RP  ++     G+    SD I W   K  P + +VVGA  + +E A  
Sbjct  204  LTADKFLIAVGTRPARRDDVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASM  263

Query  240  LKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEF-IRKTVP--------QSI  288
            +  + G  V V+  R  +L   D+++   +  Y   Q+G  F + +T+         + I
Sbjct  264  MSIIPGAQVTVIDGRKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVI  322

Query  289  TKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKL-NEKTGRIWV-  346
            T L +G+ +V              D +L   GR  +    GLD + + L  +K G I V 
Sbjct  323  THLNSGKTVVG-------------DGLLYTVGRQGNTE--GLDLSAIGLETDKRGLIKVN  367

Query  347  KNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLS  380
            +N QTS P+IYA GD    P L   +++ GRL S
Sbjct  368  ENFQTSVPHIYAAGDCTGFPALASTSMEQGRLAS  401

>PHYSO_489418
Length=471

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 116/477 (24%), Positives = 199/477 (42%), Gaps = 85/477 (18%)

Query  81   LGGTCVNVGCIPKKLMHQSSLIGELMHHD---------SANFG-----WNIASADGSAST  126
            +GG CV+ G +P K   +++L      H          S  FG       +   + + + 
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  127  FSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKG------T  180
             +  QL+ N    I G          ++++   N + + +   + E     K        
Sbjct  62   ITRHQLMRNGVQLINGT---------ARFLPGNNHMVAVLSNESYETATDAKRHTSADIC  112

Query  181  KQITTRD-VVIAVGGRP-KELTCP-GGEHAISSDDIFWMK-KKEPGKTLVVGASYVALEC  236
            K++ T D  ++ VG RP +    P  GE    SD + W K K  P + +VVGA  V +E 
Sbjct  113  KRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEY  172

Query  237  AGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENG  294
            A  +  + G DV V+  R  +L   D++++  +  Y   Q+G  F+     +S+ K   G
Sbjct  173  ASMMTIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLVGETIKSVEKTPKG  231

Query  295  QLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTST  353
            ++ V    E G++     D +L   GR  +V  L L+   + + +K GRI V N  QT+ 
Sbjct  232  EVFVHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAV  286

Query  354  PNIYAIGDVIDAPELTPVAIQAGRL----------LSRRLYNNSTAQMDYDKICT-----  398
            P+IYA GD+I  P L   +++ GRL          L+ +  ++     D D++ T     
Sbjct  287  PHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSG  346

Query  399  -----AVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESC--  450
                  ++T  E    G +E+  +KE+             VP E  ++     A      
Sbjct  347  EVFPFGIYTVPEISMVGKNEQQLTKEQ-------------VPYEVGMARYEELARGQMLG  393

Query  451  ----YLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
                +LK+I C +T    ++G H +G  A E+     + M  G T +   + V  +P
Sbjct  394  GLPGFLKIIFCPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  448

>PHYKE_2864
Length=486

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 112/490 (23%), Positives = 191/490 (39%), Gaps = 87/490 (18%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ E+A  G++V ++D      + TS  LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD------KKTS--LGGVCVHTGTIPSKTFRE  85

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +++ +       +  +++V++    +R      +V++   + +
Sbjct  86   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFAR  145

Query  158  YENFLGSFVDAHTLELWHPRK---------------GTKQITTRDVVIAVGGRPKE--LT  200
            +EN        H + +                       ++     +IA G RP    L 
Sbjct  146  FEN-------EHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLV  198

Query  201  CPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMVRSILLRG  258
               G+  I SD I      + P   +VVGA  + +E A  +  + G+ V V      + G
Sbjct  199  PIDGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTV------VDG  252

Query  259  FDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNA  318
                   ++  +                      +G++L             + D +L  
Sbjct  253  RPDTTDKRVKVF--------------------FNSGKVL-------------SADALLYT  279

Query  319  TGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDVIDAPELTPVAIQAGR  377
             GR      L L+   +  N + G I V KN QT  P+IYA GD I AP L   +++ GR
Sbjct  280  VGRQASTDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  338

Query  378  LLSRRLYN-----NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNF  432
            L S  ++N      +T+Q++       ++T  E    G +E    ++  +D +  Y    
Sbjct  339  LASCHMWNPDEELAATSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVN-YEIGI  393

Query  433  VPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYD  492
                     +   A     LK++ D    K V G H +G  A E+     +AM +G +  
Sbjct  394  AKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLT  452

Query  493  QMVDTVGIHP  502
               D V  +P
Sbjct  453  YFRDAVFNYP  462

>PITG_01778
Length=470

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 113/474 (24%), Positives = 188/474 (40%), Gaps = 79/474 (17%)

Query  81   LGGTCVNVGCIPKKLMHQSSLIGELMHHD---------SANFG-----WNIASADGSAST  126
            LGG CV+ G +P K   +++L      H          S  FG       +   + + + 
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  127  FSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTR  186
             +  QL+ N             V+L +   ++     + V   + E +      K+ T+ 
Sbjct  62   ITRHQLLRN------------GVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSA  109

Query  187  DVVIAVGGRPKELTCPG------------GEHAISSDDIFWMKKKE-PGKTLVVGASYVA  233
            D+   V    K L C G            GE    SD + W   K  P + ++VGA  V 
Sbjct  110  DICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVG  169

Query  234  LECAGFLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKL  291
            +E A  +  + G DV V+  R  +L   D+ ++  +  Y   Q+G  F+     +S+ K 
Sbjct  170  MEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMAQTGTRFLTGETIKSVEKS  228

Query  292  ENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-Q  350
              G++      E G++     D +L   GR  +V  L L+   +   +K GRI V N  Q
Sbjct  229  PKGEVFAHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQ  283

Query  351  TSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRL----------YNNSTAQMDYDKICT--  398
            T+ P+IYA GD+I  P L   +++ GRL S  +           ++     D D++ T  
Sbjct  284  TAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRM  343

Query  399  --------AVFTPIEYGCCGLSEED-SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  449
                     ++T  E    G +E+  +KE       +V ++  V     L+         
Sbjct  344  RSGEVFPFGIYTVPEISMVGKNEQQLTKE-------QVPYEVGVARYEELARGQMLGGVP  396

Query  450  CYLKVI-CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             +LK+I C  T   F  G H +G  A E+     + M  G T +   + V  +P
Sbjct  397  GFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYP  448

>PYIR_21896
Length=518

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 115/495 (23%), Positives = 199/495 (40%), Gaps = 68/495 (14%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            +YDLVVIG G     C+ E+A  G++V V+D            +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  88

Query  98   QSSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156
            ++ L +    HH      +++ +       +  K++V +            +V++     
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS------------EVDISIVRD  136

Query  157  KYENFLGSFVDAHTLELWHPRKGT-KQITTRDVVIAVGGRPKE--LTCPGGEHAISSDDI  213
              +   G   D+      H    T  ++     +IA G RP    L    G+    SD I
Sbjct  137  TPDAAGGDAGDSD-----HDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSDQI  191

Query  214  FWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEY  270
                 +E P   +VVGA  + +E A  +  + G+ V V+  RS +L   D ++ + +   
Sbjct  192  LSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNLTYE  251

Query  271  MEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGL  330
            M  + G  F+     + + K E+G + V + +    S     D +L   GR      L L
Sbjct  252  MRSK-GARFLLGETIKHVEKTESG-VTVHFNSGKITSA----DALLYTVGRQAATDGLNL  305

Query  331  DKARVKLNEKTGRIWVKNEQTSTPNI------------------YAIGDVIDAPELTPVA  372
            +   +  N +      K+ QT+ P++                  YA GD I AP L   +
Sbjct  306  EAVDLSRNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLASTS  365

Query  373  IQAGRLLSRRLYNNS----TAQMDYDKICTAVFTPIEYGCCGLSEED-SKERYGEDNIEV  427
            ++ GRL +  +++      T+Q++       ++T  E    G +E+  +KE     N E+
Sbjct  366  MEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGL---NFEI  422

Query  428  YHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKL  487
                +  L      +   +     LK++ D T  K   G H +G  A E+     +AM +
Sbjct  423  GIAKYSELAKG---QMSGSTAGGMLKILFDPTTLKL-FGVHAIGEGATEIIHIGQVAMAM  478

Query  488  GFTYDQMVDTVGIHP  502
            G +     D V  +P
Sbjct  479  GCSITYFRDAVFNYP  493

>HYAP_08069
Length=255

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (44%), Gaps = 21/219 (10%)

Query  38   DYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMH  97
            DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  98   QSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
             S+ +     H+  ++G      D    T ++ Q++   +  +R +    +       V 
Sbjct  86   HSTHLLHTAQHEFKSYGI-----DAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  140

Query  158  YENFLGSFVDAHTLEL-WHPRKGTKQITTRDVVIAVGGR-----PKELTCPGGEHAISSD  211
            Y   +G       + +    R+G   +T +++++A G       P  +    G+   S+ 
Sbjct  141  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  200

Query  212  DIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  250
             +     + P   +VVGA  + LE     K +G  V V+
Sbjct  201  ALALT--RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PITG_19065
Length=416

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 86/332 (26%), Positives = 145/332 (44%), Gaps = 24/332 (7%)

Query  182  QITTRDVVIAVGGRPKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAG  238
            +I     +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A 
Sbjct  74   RIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYAS  133

Query  239  FLKGM-GYDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQL  296
             +  + G+ V V+  R  +L   D+++ + +   M+  +G  F+   + +++ K+E    
Sbjct  134  MVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVETTDK  189

Query  297  LVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPN  355
             VK     G++   + D +L   GR      L L+   +  N + G I V KN QT  P+
Sbjct  190  RVKVFFNSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPH  246

Query  356  IYAIGDVIDAPELTPVAIQAGRLLSRRLYN-----NSTAQMDYDKICTAVFTPIEYGCCG  410
            IYA GD I AP L   +++ GRL S  ++N      +T+Q++       ++T  E    G
Sbjct  247  IYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEISMVG  306

Query  411  LSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYL  470
             +E    ++  +D +  Y             +   A     LK++ D    K V G H +
Sbjct  307  QTE----QQLTKDCVN-YEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-VFGVHAI  360

Query  471  GPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            G  A E+     +AM +G +     D V  +P
Sbjct  361  GEGATEIIHIGQVAMAMGCSLTYFRDAVFNYP  392

>PHYSO_562795
Length=415

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 87/327 (27%), Positives = 145/327 (44%), Gaps = 28/327 (9%)

Query  189  VIAVGGRPKE--LTCPGGEHAISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-G  244
            +IA G RP    L    G+  I SD I      + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  245  YDVKVMV-RSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTE  303
            + V V+  R  +L   D+++ + +   M+  +G  F+   + +++ K+E  +  VK   +
Sbjct  140  HSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFL---LGETVKKVETTENRVKVFFD  195

Query  304  DGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWV-KNEQTSTPNIYAIGDV  362
             G+    + D +L   GR      L L+   +  N + G I V +N QT  P+IYA GD 
Sbjct  196  SGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDC  252

Query  363  IDAPELTPVAIQAGRLLSRRLYN-----NSTAQMDYDKICTAVFTPIEYGCCGLSEEDSK  417
            I AP L   +++ GRL S  ++N       T+Q+D       ++T  E    G +E    
Sbjct  253  IGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTE----  308

Query  418  ERYGED--NIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAG  475
            ++  +D  N EV    +  L      +   A     LK++ D    K   G H +G  A 
Sbjct  309  QQLTKDCVNYEVGIAKYSELAKG---QMMGAMAGGTLKILFDPDTLKL-FGVHAIGEGAT  364

Query  476  EVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            E+     +AM +G +     D V  +P
Sbjct  365  EIIHIGQVAMAMGCSLTYFRDAVFNYP  391

>SPRG_04114
Length=376

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 81/330 (25%), Positives = 143/330 (43%), Gaps = 23/330 (7%)

Query  182  QITTRDVVIAVGGRPKE--LTCPGGEHAISSDDIFWM-KKKEPGKTLVVGASYVALECAG  238
            ++  +  ++A G RP    L    G+  + SD I      K P   +VVGA  + +E A 
Sbjct  39   RLRGKKFLVACGTRPAHSPLVPCDGKIILDSDQILNHDTTKLPKSWIVVGAGVIGMEYAS  98

Query  239  FLKGM-GYDVKVM-VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQL  296
             L  + G +V V+  R+ +L   D ++ + +   M    G  F+     +S+   +NG  
Sbjct  99   MLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMR-HKGARFLLGESIKSVEHFKNG--  155

Query  297  LVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTSTPN  355
             VK     G++     + +L   GR  +   L L+   +  N + G I V  + QTS P+
Sbjct  156  -VKVEFNSGKAMFA--EALLYCVGRQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPH  211

Query  356  IYAIGDVIDAPELTPVAIQAGRLLSRRLYNN---STAQMDYDKICTAVFTPIEYGCCGLS  412
            IYA GD I AP L   +++ GRL +  ++++   +T+Q++       ++T  E    G +
Sbjct  212  IYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKT  271

Query  413  EEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGP  472
            E+   +     N  V    F      L++   +      LK++ D    +  +G H +G 
Sbjct  272  EQQLTKEGA--NYAVGLAKF----SELAKGQMSGDIEGILKLLFDPVSLQL-LGVHAIGH  324

Query  473  NAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
             A E+     +AM +        D V  +P
Sbjct  325  GATEIIHIGQVAMAMNCKITYFRDAVFNYP  354

>PPTG_24712
Length=67

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 3/62 (5%)

Query  39  YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
           YD +VIGGGSGG+A ++ AA+FG KV V   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7   YDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  99  SS  100
           ++
Sbjct  64  TA  65

>HYAP_13613
Length=423

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/225 (24%), Positives = 100/225 (44%), Gaps = 21/225 (9%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            YDLVVIG G     C+ ++A  G++V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  99   SSL-IGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVK  157
            + L +    HH      +++ +       +  +++V++ +  +R      +V++   + +
Sbjct  85   AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  144

Query  158  YENFL-------GSFVD-AHTLELWHPRKGTKQITTRDVVIAVGGRPKE--LTCPGGEHA  207
            +E+         G+  D A T +  +      ++     ++A G RP    L    G+  
Sbjct  145  FESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKIV  204

Query  208  ISSDDIFWMKKKE-PGKTLVVGASYVALECAGFLKGM-GYDVKVM  250
            I SD I     ++ P   +VVGA  + +E A  +  + G+ V V+
Sbjct  205  IDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  249

>PITG_19802
Length=185

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 70/159 (44%), Gaps = 10/159 (6%)

Query  345  WVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPI  404
            W      S P I+AIGDVI    L   A + G      +       ++Y  I   ++T  
Sbjct  16   WPLERIKSVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFP  74

Query  405  EYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES-CYLKVICDKTRDKF  463
            E+   G +EE+ K    E N+  +     P+    +   RT AE+   +KV+ DK  DK 
Sbjct  75   EFASVGKTEEELKAEGIEYNVGKF-----PM--MANSRARTIAEADGLVKVLADKKTDK-  126

Query  464  VVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            ++G H +  NAGE+     + ++ G   + +  T   HP
Sbjct  127  LLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  165

>PYIW_27568
Length=128

 Score = 39.3 bits (90),  Expect = 0.011, Method: Composition-based stats.
 Identities = 33/115 (29%), Positives = 48/115 (42%), Gaps = 9/115 (8%)

Query  389  AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAE  448
              ++Y+ I   ++T  E    G +EE  KE       E    N        +   R   E
Sbjct  2    GHVNYNAIPGVIYTFPEVASVGKTEEQLKE-------EGVAYNVGKFPMMANSRARAVGE  54

Query  449  SCYL-KVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +  L KVI DK  DK ++G H +  NAGE+     L M+ G   + +  T   HP
Sbjct  55   ADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHP  108

>PHYSO_507629
Length=703

 Score = 40.4 bits (93),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
            VVIA G  P+EL  PG +H      I  +K K P   K  V+GA  +  + A F+  +G 
Sbjct  462  VVIATGVLPRELKIPGADHPKVLSYIDVLKNKAPVGKKVAVIGAGGIGFDVAEFITHVGE  521

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 V +   R +  DM N       V+ G+  I+ ++P
Sbjct  522  STSSSVDA-FAREWGIDMTN------SVRGGVAGIKPSIP  554

>PYU1_G014369
Length=703

 Score = 40.0 bits (92),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP-GKTL-VVGASYVALECAGFLKGMGY  245
            VVIA G  P++L  PGG+H+     I  +K K P GK + V+GA  +  + + FL  +G 
Sbjct  462  VVIATGVLPRDLKIPGGDHSKVLSYIDVLKHKAPVGKRVAVIGAGGIGFDVSEFLTHIGK  521

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
               + V ++  + +  D +N       V+ G++ +++ VP
Sbjct  522  SASLDV-NLFAKEWGIDTSN------SVRGGVQGVKQEVP  554

>SPRG_18643
Length=85

 Score = 36.2 bits (82),  Expect = 0.048, Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (56%), Gaps = 1/59 (2%)

Query  11  SALNTKKNMQIHDPST-PSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
           + L+T+   +  D S+  + +     S  +DLVVIG G  G  C+ ++A  G+KV ++D
Sbjct  20  AGLSTEAEAKADDASSFTNILRNLRASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID  78

>SPRG_04231
Length=90

 Score = 36.2 bits (82),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  460  RDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +DK VVG H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  51

>PPTG_08060
Length=725

 Score = 37.7 bits (86),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
            VVIA G  P+ L  PG +H      I  +K K P   K  ++GA  +  + A FL  +G 
Sbjct  484  VVIATGVLPRTLKIPGADHPKVLSYIDVLKHKAPVGKKVAIIGAGGIGFDVAEFLSHVGE  543

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 V  +  R +  D  N       V+ G+  I+ ++P
Sbjct  544  STSSSV-DVFAREWGIDTTN------SVRGGVAGIKPSIP  576

>PHALS_10960
Length=702

 Score = 37.0 bits (84),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGY  245
            VV+A G  P+ L  PG +H   +S  D+   K K   +  ++GA  +  + A FL  +G 
Sbjct  462  VVMASGVLPRPLKIPGADHPMVLSYMDVLKKKSKVGQRVAIIGAGGIGFDVAEFLTHVGE  521

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 V  +  R +  D  N       V+ G+  I+ +VP
Sbjct  522  STSSSV-EVFAREWGIDTTN------SVRGGVAGIKSSVP  554

>PITG_00703
Length=703

 Score = 36.6 bits (83),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEH--AISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGY  245
            VVIA G  P+ L  PG +H   +S  D+   K     K  ++GA  +  + A FL  +G 
Sbjct  462  VVIATGVLPRALKIPGADHPKVLSYLDVLKNKAPVGNKVAIIGAGGIGFDVAEFLAHVGE  521

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 V  +  R +  D  N       V+ G+  ++ ++P
Sbjct  522  STSSSV-DVFAREWGIDTTN------SVRGGVAGVKPSIP  554

>SPRG_17626
Length=148

 Score = 34.7 bits (78),  Expect = 0.53, Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (47%), Gaps = 9/115 (8%)

Query  389  AQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAE  448
              ++Y+ I   V+T  E    G +EE+ K      N+  Y+    P+    +   RT  E
Sbjct  22   GHVNYNAIPGVVYTFPEVASVGKTEEELKAA----NV-AYNVGKFPM--MANSRARTVGE  74

Query  449  S-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  502
            +  ++K++  K  DK ++G H +  NAGE+     L ++ G + + +  T   HP
Sbjct  75   TDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHP  128

>PYAP_17256
Length=705

 Score = 36.2 bits (82),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 37/164 (23%), Positives = 76/164 (46%), Gaps = 18/164 (11%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
            V++A G  P++L  PG +H      I  +K K P   K  V+GA  +  + + ++   G 
Sbjct  464  VIVATGVLPRDLKIPGADHPKVVSYIDVLKHKVPVGKKVAVIGAGGIGFDVSEYVTHHGK  523

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDG  305
               + V ++  + +  D+ N       V+ GI  ++  +P+S  ++    LL + +T+ G
Sbjct  524  SPSLDV-NLFAKEWGFDVTN------SVRGGIAGVKPEIPESPREV---YLLQRKSTKHG  573

Query  306  ESCEEAFDTVLNATGRDPDVAKLG------LDKARVKLNEKTGR  343
            +   +    +  A+ +  DV  +G      +D A + + +K G+
Sbjct  574  KDLGKTTGWIHRASLKARDVKMIGGVKYDKVDDAGLHITDKKGQ  617

>PHYRA_87328
Length=486

 Score = 35.8 bits (81),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
            VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G 
Sbjct  245  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVGE  304

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 V +   R +  D  N       V+ G+  I+ ++P
Sbjct  305  STSSSVDA-FAREWGIDTTN------SVRGGVAGIKSSIP  337

>CCI40989
Length=552

 Score = 35.8 bits (81),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 14/99 (14%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            +D V+IGGG  GL  +   A  G++VCVL+            +GG  V     P  L  +
Sbjct  14   WDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEIFPGFLFSR  65

Query  99   SSLIGELMHHDSANF------GWNIASADGSASTFSWKQ  131
            +S +  L   D   +      G +I S D  + T +  Q
Sbjct  66   ASYVFSLFRPDIIEYLELKRRGLHIYSRDPGSFTPTLNQ  104

>PHYRA_72196
Length=691

 Score = 35.8 bits (81),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
            VVI+ G  P+ L  PG +H      I  +KKK P   K  ++GA  +  + A F+  +G 
Sbjct  462  VVISTGVLPRALKIPGADHPKVLSYIDVLKKKAPVGKKVAIIGAGGIGFDVAEFITHVGE  521

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVP  285
                 V +   R +  D  N       V+ G+  I+ ++P
Sbjct  522  STSSSVDA-FAREWGIDTTN------SVRGGVAGIKSSIP  554

>HYAP_08068
Length=100

 Score = 33.5 bits (75),  Expect = 0.70, Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 33/64 (52%), Gaps = 2/64 (3%)

Query  440  SEETRTAAES-CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTV  498
            +   RT AE+   +KV+ DK  DK ++G H +  NAGE+     + ++ G   + +  T 
Sbjct  3    NSRARTVAEADGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTC  61

Query  499  GIHP  502
              HP
Sbjct  62   HAHP  65

>PHYSO_317690
Length=1057

 Score = 35.4 bits (80),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 75/163 (46%), Gaps = 20/163 (12%)

Query  245  YDVKVMVRSI------LLRGFDQDMANKIGEYMEVQSGIEFI-RKTVPQSITKLENGQLL  297
            +D+KV VR I      + R  D D A  +   +  + GI+ +  K+  + +   ENG   
Sbjct  192  HDLKVAVRVINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYDKSTQEILGSEENGVEA  251

Query  298  VKWTTEDGESCEEAFDTVLNATG---RDPDVAKLGLDKARVKLNEKTGRIWVKNE-QTST  353
            V++T  +GE  ++    ++ ATG   RD      GL+ A      K G I + +  + S 
Sbjct  252  VQFT--NGERFDDVC-MIIFATGIKPRDELAHSSGLELA------KRGGILINDYLECSA  302

Query  354  PNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396
            P++YA+G+ I     T   +  G  ++  L  N T +   D+I
Sbjct  303  PSVYALGECISHRNFTYGLVAPGYEMADTLAKNFTCRSPEDRI  345

>PYU1_G000378
Length=1070

 Score = 35.4 bits (80),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (47%), Gaps = 11/172 (6%)

Query  225  LVVGASYVALECAGFLKGMGYDVKVMVRS--ILLRGFDQDMANKIGEYMEVQSGIEFIRK  282
            LV+G   + LE A  +  +   V+++ R   ++ R  D   A  +   +  + GIE +  
Sbjct  160  LVIGGGLLGLEAAKAIHDLQLSVRIVNRGSRLMSRQLDDAGAKVLHNEIVSKFGIEVLY-  218

Query  283  TVPQSITKLENGQLLVKWTT-EDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKT  341
                  TK  +G  +V+     DGES ++ F  V  ATG  P    LG D   + + ++ 
Sbjct  219  ---HKTTKYIHGTTVVEGVDFTDGESYDDVFMIVF-ATGIKPR-DDLGRDSG-LDVAQRG  272

Query  342  GRIWVKNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMD  392
            G I V +  +TS  ++YAIG+ +   ++T   +  G  ++  L  N TA  D
Sbjct  273  GGILVNDLLETSHKDVYAIGECVSHRDVTYGLVAPGYEMADNLAKNFTANGD  324

>PYAP_15943
Length=139

 Score = 33.5 bits (75),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  39  YDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
           +D VV+GGG  GL  +   A  G++VCVL+
Sbjct  14  WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>PHYCA_524942
Length=1028

 Score = 35.0 bits (79),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 77/171 (45%), Gaps = 19/171 (11%)

Query  228  GASYVALECAGFLKGMGYDVKVMVRSI------LLRGFDQDMANKIGEYMEVQSGIEFI-  280
            G     +E AG  K + +D+ V VR I      + R  D D A  +   +  + GI+ + 
Sbjct  148  GEKQAKIEAAGAAKAV-HDLNVSVRIINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLY  206

Query  281  RKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATG---RDPDVAKLGLDKARVKL  337
             K+  + I   ENG   V++T  +GE  ++    ++ ATG   RD      GL+     L
Sbjct  207  EKSTQEIIGSQENGVEAVQFT--NGERFDDIC-MIIFATGIKPRDELAHSSGLE-----L  258

Query  338  NEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNST  388
              + G +     + S P++YA+G+ I   +LT   +  G  ++  L  N T
Sbjct  259  GNRGGILINDFLECSVPDVYALGECISHRDLTYGLVAPGYEMADVLAKNFT  309

>HYAP_03065
Length=701

 Score = 34.7 bits (78),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 55/128 (43%), Gaps = 16/128 (13%)

Query  120  ADGSASTFSWKQLVANVDGYIRGIN-FKYKVELRSKYVKYENFLGSFVDAHTLELWHPRK  178
            AD     F+  ++V   + +   +  F+ +++LR   VK    LG  V+A  L      K
Sbjct  404  ADAIGGQFNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LGHRVEAAELMSGAFDK  459

Query  179  GTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALEC  236
                     VVIA G  P+ LT PG +H      I  +K + P   K  ++GA  +  + 
Sbjct  460  ---------VVIATGVVPRSLTIPGADHPKVLSYIDVLKNEAPVGQKVAIIGAGGIGFDV  510

Query  237  AGFLKGMG  244
            A FL   G
Sbjct  511  AEFLTHEG  518

>PYVX_21196
Length=604

 Score = 33.9 bits (76),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 34/144 (24%), Positives = 63/144 (44%), Gaps = 12/144 (8%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMGY  245
            VV+A G  P+ L  PG +H+     I  +K K P   K  V+GA  +  + + FL   G 
Sbjct  461  VVMATGVLPRALKIPGSDHSKVLSYIDVLKNKAPVGEKVAVIGAGGIGFDVSEFLTHKGK  520

Query  246  DVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDG  305
               + +  +  R +  D  N       V+ G+  +  +VP    ++    L+ + TT+ G
Sbjct  521  SASLDI-DLFAREWGIDTTN------SVRGGVAGVTPSVPPPAREV---FLMQRKTTKHG  570

Query  306  ESCEEAFDTVLNATGRDPDVAKLG  329
            +   +    +  ++ +  DV  +G
Sbjct  571  KDLGKTTGWIHRSSLKHRDVHMIG  594

>PYU1_G004385
Length=562

 Score = 33.5 bits (75),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 22/36 (61%), Gaps = 0/36 (0%)

Query  33  AETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
           A T   +D +V+GGG  GL  +   A  G++VCVL+
Sbjct  7   ALTRKKWDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PPTG_15916
Length=590

 Score = 33.1 bits (74),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 36/66 (55%), Gaps = 2/66 (3%)

Query  4   LRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGG-LACSKEAASFGQ  62
           LR S+Q   L T+    +   S   A+  + TS +YD V++GGGS G +  ++ +A    
Sbjct  2   LRRSLQSKTLVTRGRHAVQ-ASFARALSSSATSAEYDYVIVGGGSAGCVLANRLSADPTN  60

Query  63  KVCVLD  68
           KV +++
Sbjct  61  KVLLVE  66

>PITG_02760
Length=165

 Score = 32.0 bits (71),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  39  YDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
           +D +V+GGG  GL  +   A  G+ VCVL+
Sbjct  12  WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>CCI50227
Length=707

 Score = 33.1 bits (74),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query  200  TCPGGEHAISSDD-IFWMKKKEPGKTLVVGASYVALECAGF---LKGMGYDVKVMVRSIL  255
            +   GE   S DD I  M++ +PG   V G S  A+E + F   LK  GY+V  MV +I 
Sbjct  445  STKSGEEMTSLDDYISRMQENQPGIYYVTGESKKAVENSPFLEKLKKKGYEVIYMVEAI-  503

Query  256  LRGFDQDMANKIGEY  270
                D+    ++ EY
Sbjct  504  ----DEYAVQQLKEY  514

>PYIR_15912
Length=617

 Score = 32.7 bits (73),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (59%), Gaps = 2/46 (4%)

Query  25  STPSAVDEAETSYDYDLVVIGGGSGGLACSK--EAASFGQKVCVLD  68
           +T S V    T+ +YD+VVIG G GGL  ++    AS+   V VL+
Sbjct  16  ATVSTVAHGATAAEYDVVVIGSGPGGLVAAEYLSRASYNLSVLVLE  61

>H257_04036
Length=1049

 Score = 32.7 bits (73),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (52%), Gaps = 5/62 (8%)

Query  40   DLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQS  99
            D+V+ GGG+G  +C  +    G     ++++   P GT+  + G  + VG  P+ L H  
Sbjct  442  DVVLFGGGAGAASCELQVPEPG----TVEFMVAMP-GTTCLINGLPLTVGAAPRPLAHGD  496

Query  100  SL  101
            +L
Sbjct  497  TL  498

>PYVX_18330
Length=558

 Score = 32.7 bits (73),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  39  YDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
           +D +V+GGG  GL  +   A  G++VCVL+
Sbjct  13  WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PYU1_G010456
Length=617

 Score = 32.7 bits (73),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  24   PSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
            PS  S +D  +  + +D+++IGGG+ G  C+ +AA+ G    V++
Sbjct  59   PSRDSQLDRLKKEH-FDVLIIGGGATGSGCALDAATRGLNTAVVE  102

>H310_07705
Length=546

 Score = 32.3 bits (72),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 8/68 (12%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            +D +V+GGG  GL  +   A  G+ VCVL+            LGG  V    +P     +
Sbjct  12   WDAIVVGGGHNGLVAATYLAKAGKAVCVLE--------KRHVLGGAAVTEEIVPNFRFSR  63

Query  99   SSLIGELM  106
            +S +  L 
Sbjct  64   ASYVFSLF  71

>SPRG_08354
Length=550

 Score = 32.3 bits (72),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 30/68 (44%), Gaps = 8/68 (12%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            +D V++GGG  GL  +   A  G+ VCVL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPNFHFSR  66

Query  99   SSLIGELM  106
            +S +  L 
Sbjct  67   ASYVFSLF  74

>PYVX_16132
Length=390

 Score = 32.3 bits (72),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 73/184 (40%), Gaps = 29/184 (16%)

Query  320  GRDPDVAKLGLDKARVKLNEKTGRIWVKNEQT---------STPNIYAIGDVIDAPELTP  370
            GR P    LGL K R K +       V+ + T          T     +   I    L P
Sbjct  33   GRQPQTLGLGLLKGRYKNHPTCDLCAVRFDVTRRRHQCGGVGTVGAAVVSSCIPGRLLVP  92

Query  371  VAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNI-EVYH  429
               Q   + +   Y+ +T Q   ++ CT V  P++    GL          EDNI E   
Sbjct  93   WTEQFDDVPN---YDKATPQRVCEQ-CTPVLRPLQEELVGLYAHAH-----EDNIHEAKE  143

Query  430  KNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLA----M  485
            +  +P  WS++EE + AA+     +I +  RD++        P A  +  A GLA    +
Sbjct  144  RLHLPYTWSMAEECQHAAD-----IIGNFFRDRWGASKDRAIP-AAILKNAKGLAIMTIL  197

Query  486  KLGF  489
            K GF
Sbjct  198  KAGF  201

>SDRG_05159
Length=551

 Score = 32.3 bits (72),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 30/68 (44%), Gaps = 8/68 (12%)

Query  39   YDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQ  98
            +D V++GGG  GL  +   A  G+ VCVL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPDFHFSR  66

Query  99   SSLIGELM  106
            +S +  L 
Sbjct  67   ASYVFSLF  74

>PYAR_15823
Length=705

 Score = 32.3 bits (72),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query  188  VVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEP--GKTLVVGASYVALECAGFLKGMG  244
            VV+A G  P+EL  PG +H      I  +K   P   K  VVGA  +  + + F+   G
Sbjct  475  VVVATGVEPRELKIPGADHPKVVSYIDVLKHNAPVGKKVAVVGAGGIGFDVSEFVTHHG  533

>PITG_02553
Length=398

 Score = 32.3 bits (72),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 51/112 (46%), Gaps = 14/112 (13%)

Query  308  CEEAFDTVLNATGRDP-DVAKLGLDKARVK---------LNEKTGRIWVKNEQTSTPNIY  357
            C  + D   N     P DV KL L+  + +         ++ ++ R+W  +   + PN+ 
Sbjct  9    CRPSEDVASNQANTPPLDVKKLSLEPEQEQDLQIPGTPPMDAQSRRVWGDDTPPANPNLT  68

Query  358  AIGDVIDAPELTPVAIQAGR----LLSRRLYNNSTAQMDYDKICTAVFTPIE  405
                +++  +L P+  +A R    ++++RL     A+ +  K  +AV  P+E
Sbjct  69   EAQRLVEQEKLQPLEQRATRHAAAVVTQRLVRCFMARRNLAKRLSAVGRPVE  120

>PHYKE_9463
Length=602

 Score = 32.3 bits (72),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  24  PSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLD  68
           PS  + +D  +  + +D++VIGGG+ G  C+ +AA+ G    V++
Sbjct  45  PSRAAQLDRLKKEH-FDVLVIGGGATGSGCALDAATRGLNTAVVE  88

Lambda      K        H        a         alpha
   0.318    0.135    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 39570152127

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40