Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_321157147571180116452850.0
PPTG_17128147571177116744950.0
PITG_18457147571170116644200.0
PHALS_06477147571166116836470.0
PHYRA_9590114757107582133730.0
PHYCA_344751475769272529020.0
PYIW_1879314757997101824990.0
PYU1_G0017341475780079923000.0
PYIR_1345314757118680822940.0
PYAP_1774614757116979020570.0
SPRG_063541475788479015950.0
SDRG_0176414757109279015850.0
H310_0921214757111378815300.0
H257_0630514757109979214970.0
CCA18898147571147121414415e-179
CCI4512214757110576413793e-170
PHYKE_8394147574282228953e-108
PYAR_13581147577303027414e-83
H310_112724789179940890.23
CCI491231646542039802.5
CCA253811513681939784.9
PYIR_22258495132342775.7
PYVX_21490799342926131776.6
PHALS_035993109610658707.1
PYIR_169721233993677767.6
CCI419087773154131769.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_321157

Length=1181
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_321157                                                          2040       0.0   
PPTG_17128                                                            1736       0.0   
PITG_18457                                                            1707       0.0   
PHALS_06477                                                           1409       0.0   
PHYRA_95901                                                           1303       0.0   
PHYCA_34475                                                           1122       0.0   
PYIW_18793                                                            967        0.0   
PYU1_G001734                                                          890        0.0   
PYIR_13453                                                            888        0.0   
PYAP_17746                                                            796        0.0   
SPRG_06354                                                            619        0.0   
SDRG_01764                                                            615        0.0   
H310_09212                                                            593        0.0   
H257_06305                                                            581        0.0   
CCA18898                                                              559        5e-179
CCI45122                                                              535        3e-170
PHYKE_8394                                                            349        3e-108
PYAR_13581                                                            290        4e-83 
H310_11272                                                            38.9       0.23  
CCI49123                                                              35.4       2.5   
CCA25381                                                              34.7       4.9   
PYIR_22258                                                            34.3       5.7   
PYVX_21490                                                            34.3       6.6   
PHALS_03599                                                           31.6       7.1   
PYIR_16972                                                            33.9       7.6   
CCI41908                                                              33.9       9.6   

>PHYSO_321157
Length=1180

 Score = 2040 bits (5285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1164/1164 (100%), Positives = 1164/1164 (100%), Gaps = 0/1164 (0%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61    AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
             AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR
Sbjct  61    AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  121   VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180
             VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL
Sbjct  121   VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180

Query  181   PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQ  240
             PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGVMKQ
Sbjct  181   PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGVMKQ  240

Query  241   RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapftppppapessppatattrrrstr  300
             RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPPAPESSPPATATTRRRSTR
Sbjct  241   RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPPAPESSPPATATTRRRSTR  300

Query  301   rgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSeqpd  360
             RGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSEQPD
Sbjct  301   RGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSEQPD  360

Query  361   eeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEF  420
             EEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEF
Sbjct  361   EEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEF  420

Query  421   VSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCI  480
             VSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCI
Sbjct  421   VSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCI  480

Query  481   VNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAW  540
             VNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAW
Sbjct  481   VNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAW  540

Query  541   RAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLS  600
             RAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLS
Sbjct  541   RAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLS  600

Query  601   AENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVK  660
             AENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVK
Sbjct  601   AENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVK  660

Query  661   LVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlp  720
             LVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLP
Sbjct  661   LVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLP  720

Query  721   ilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWL  780
             ILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWL
Sbjct  721   ILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWL  780

Query  781   LKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLA  840
             LKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLA
Sbjct  781   LKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLA  840

Query  841   RLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP  900
             RLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP
Sbjct  841   RLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP  900

Query  901   DGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSL  960
             DGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSL
Sbjct  901   DGTVHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSL  960

Query  961   DFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLA  1020
             DFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLA
Sbjct  961   DFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLA  1020

Query  1021  AVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLH  1080
             AVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLH
Sbjct  1021  AVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLH  1080

Query  1081  GVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMAT  1140
             GVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMAT
Sbjct  1081  GVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMAT  1140

Query  1141  SPSRPGSARSGNFAQVLSAVRAST  1164
             SPSRPGSARSGNFAQVLSAVRAST
Sbjct  1141  SPSRPGSARSGNFAQVLSAVRAST  1164

>PPTG_17128
Length=1177

 Score = 1736 bits (4495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1167 (81%), Positives = 1043/1167 (89%), Gaps = 9/1167 (1%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEKVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSA+VTTAEVQAFN
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  61    AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
             AILQQTE ELR+KAELVLNGMVNSS++AQNNQ+QSG  LPAVTVAA PST+HRSGY    
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  121   VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180
               + MDASSIPMEFFREQFRNSSVE+RQ+LMPSP   QRH G+HHGRLMRKKTTQHCRLL
Sbjct  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180

Query  181   PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQ  240
             PSVNKVDPSAP PELREEDAKHGVLNLVTRGFLPAYADLTPAFAGP+G ++GS GG+MKQ
Sbjct  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240

Query  241   RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL--Rapftppppapessppatattrrrs  298
             RATRI+DRSEQ+VR TPFTQSTGYNLA+LKFDL       PP P  +   P  +TTRRRS
Sbjct  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTRRRS  300

Query  299   trrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSeq  358
              R+ SA  GP++VTMSFP+S    K+ RS  Q+SL+SAA+AAFTNQ +D+++NR RFS+ 
Sbjct  301   VRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFSDD  360

Query  359   pdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  418
                +   E  E+ ++E  E  E   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP
Sbjct  361   DVSDEDQENDENGKDEDAEMEE---LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  417

Query  419   EFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLASTGQPRFSKRELLS  478
             EF+SFRRVAQELWGSVEEALRALE LLTQYFVPLAY DGQRLL+LA TGQPRFSKRELLS
Sbjct  418   EFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLS  477

Query  479   CIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQL  538
             CIVNE+Q+M+VLRRPGQRYKGRDRKRRAATT+QAC+RMW +RRRY RSRASD +ATKIQL
Sbjct  478   CIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQL  537

Query  539   AWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSR  598
             AWRA+SCH ALK RLRE+RRE+L+ WE +M  LK+QW QIA RRRVVVHVPSLSLDEH R
Sbjct  538   AWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYR  597

Query  599   LSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPR  658
             LSAENFAVQQNLQLTR+CA ALDSNVDLLVYV+PFELTADV  YFLKLLQLGGL DS PR
Sbjct  598   LSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPR  657

Query  659   VKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALD  718
             VK VFPEQ+ RFPAHFSLSS+LLYSPHCLRRIRHYT GK+AYLVMGLPG EDQRLAIALD
Sbjct  658   VKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALD  717

Query  719   lpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPR  778
             LPILGAPP QALPLLTRSGGKRLLIRADVNVP GTYELYDEHEL AALAKLA+AHMDQP+
Sbjct  718   LPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPK  777

Query  779   WLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGV  838
             WL+KLDYDPLGVGEAVVDLS +QAMRELRREK+TPEYWRQPGPRDAA+K++LAELERPG+
Sbjct  778   WLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGM  837

Query  839   LARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFI  898
             LARLA PMH+E+FP+WR+Y +A+ HFGCV+EAVPPT+  ASPE +++ VEPAYVRANLF+
Sbjct  838   LARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFV  897

Query  899   DPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGY  957
             DPDG+VH+TSTQNVLA+ GGGLNRKTVAFTFPQT APHEA+KGAC AAGKLLVETNVWGY
Sbjct  898   DPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGY  957

Query  958   VSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANS  1017
             VSLDFVVFQD+KS GAPRLWALAVHPFLTDSAASFACFHLLARGVLD +SG YR+A+ + 
Sbjct  958   VSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSL  1017

Query  1018  TLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHAC  1077
             T     +GR+G G TTDLLLREASLAK + AG PRC+VVCSYVFHPHVTTMQYTAFFHAC
Sbjct  1018  TTV---TGRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHAC  1074

Query  1078  RLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVE  1137
             RLHGVCFDVERTLGTLFLL DSLTAGVFGVLS+GET +GALAF+RTALEVIGREAG+T+ 
Sbjct  1075  RLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTIN  1134

Query  1138  MATSPSRPGSARSGNFAQVLSAVRAST  1164
             M +SPSRP S RSGNFAQVLSAVRAST
Sbjct  1135  MVSSPSRPVSGRSGNFAQVLSAVRAST  1161

>PITG_18457
Length=1170

 Score = 1707 bits (4420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 926/1166 (79%), Positives = 1026/1166 (88%), Gaps = 14/1166 (1%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             M+KVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+A+VTTAEVQAFN
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  61    AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
             AILQQTE ELRAKAELVLNGMVNSSSSA+NNQ+QSGTLLPAVTVAA PS  HRSGY K  
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  121   VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180
               + MDASSIP+EFFREQFRN+SVE+RQ+L P P   +RH GIHHGRLMRKKTTQHCRLL
Sbjct  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL-PEPW--ERHFGIHHGRLMRKKTTQHCRLL  177

Query  181   PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQ  240
             PSVNK DPS PTPELREEDAKHGVLNLVTRGFLPAYADLTP F+G S  + G    VMKQ
Sbjct  178   PSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGG---VMKQ  234

Query  241   RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapftppppapessppatattrrrstr  300
             RATRI++RSEQ VR TPFTQSTGYNLA+LKFDLRAP TPPP  PE++ P + T RR + R
Sbjct  235   RATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRSTRR  294

Query  301   rgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSeqpd  360
               +   GP+  T S P S+   K+GRS   +SL+SAA+AAFTNQ +D E+NR+RFS+   
Sbjct  295   SSAL-QGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSDDDI  353

Query  361   eeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEF  420
              +   E  E+D++E  E  +   LGANVDKIRGYNELLD YSLHQFLIHKGRTMRDTPEF
Sbjct  354   SDEEQESDENDKDEYAEMEK---LGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEF  410

Query  421   VSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCI  480
             VSFRRV QELWGSVEEALRALETLL QYFVPLAY DGQRLL+LA TGQPRFSKRELLSCI
Sbjct  411   VSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCI  470

Query  481   VNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAW  540
             VNE+QVM+VLRRPGQRYKGRDRKRRAATTI+ACVRMW +RRRY R+RASDF+A+KIQLAW
Sbjct  471   VNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAW  530

Query  541   RAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLS  600
             RA+SCH +LKARLRE+  E+L+ WE +M++LK+ W QIAGRRRVVVHVPSLSLDEHSRL 
Sbjct  531   RAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLG  590

Query  601   AENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVK  660
             AENFA+QQNLQLTR+CAAALDSNV+LL+YV+PFELT+DVS YFLKLLQLGGL DSRPRVK
Sbjct  591   AENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVK  650

Query  661   LVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlp  720
             LVFPEQ  RFPAHFSLSS+LLYSPHCLRRIRHYT GK+AYLVMGLPG EDQRLA+ALDLP
Sbjct  651   LVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLP  710

Query  721   ilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWL  780
             ILGAPP QALPLLTRSGGKRLLIRADVNVP GTYELYDEHE+ AALAKLA+AHMDQPRWL
Sbjct  711   ILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWL  770

Query  781   LKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLA  840
             +KLDYDPL VGEAVVDLS MQAMRELRREK+TPEYWRQPGPRDAA+KL+LAELERPG+LA
Sbjct  771   IKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLA  830

Query  841   RLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP  900
             R+ATPM TEIFP WRE+ +A+ HFGCVVEAVPPT+  AS E ++  VEPAYVRANLF+DP
Sbjct  831   RIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDP  890

Query  901   DGTVHITSTQNVLAS-GGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVS  959
             DG+VHI+STQNVLA+ GGGLNRKTVAFTFPQT AP+EA+KGAC AAGKLLVETNVWGYVS
Sbjct  891   DGSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVS  950

Query  960   LDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTL  1019
             LDFVVFQD+KS  APRLWALAVHPFLTDSA SFACFHLLARGVLD +SG YR+  AN +L
Sbjct  951   LDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV--ANKSL  1008

Query  1020  AAVNSGR-SGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACR  1078
                NSGR S  G  TDLLLREA LAK +  G  RC+V CSYVFHPHV TMQYTAFFHACR
Sbjct  1009  TTANSGRKSESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACR  1068

Query  1079  LHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEM  1138
             LHGVCFDVERTLGTLFLL DSLTAGVFG+LS+GETT+GALAF+RTALEVIGREAG+T+ +
Sbjct  1069  LHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISV  1128

Query  1139  ATSPSRPGSARSGNFAQVLSAVRAST  1164
             A+SPSR  ++RSGNFAQ+LSA+R ST
Sbjct  1129  ASSPSRSVASRSGNFAQILSAIRVST  1154

>PHALS_06477
Length=1166

 Score = 1409 bits (3647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 777/1168 (67%), Positives = 905/1168 (77%), Gaps = 38/1168 (3%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEKVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+V+T AEVQAF+
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  61    AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
             A+LQQTE+ELRAKAELVLNG++NSS+S  N+Q Q  T LPAV+VAAP   +HR G ++  
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  121   V---AKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHC  177
                    +D +S  MEFFR+QFRN+ VE+RQ+LM SP + +R  G    R +RKKTTQH 
Sbjct  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192

Query  178   RLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggV  237
             RLLP VNK DPS PTP+LREEDA  G+LNLVTRGFLPAYADLTPAFAGP+G ++GSGG  
Sbjct  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252

Query  238   MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapftppppapessppatattrrr  297
             +K RAT I+DRS++S R TP   S G+NLA LKFD R   TP      +     +     
Sbjct  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSA----  308

Query  298   strrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAIAAFTNQSDDLEDNRERFSe  357
                        S     F    +   SG + R S +V    AA  NQ++D+E+N    + 
Sbjct  309   -----------SMPNTKFSSIMQTVSSGPAKRNSLVV----AAPRNQNEDIENN---CTH  350

Query  358   qpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDT  417
               +++  +E  +D +  KDE    ++L  NV KIR YN+L+DAYSLHQ LI+KGR +RDT
Sbjct  351   SFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDT  410

Query  418   PEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLASTGQPRFSKRELL  477
             PEF SFRRV  +LWGSVEE LRALE +L QYFVPLA+ DGQRL++LAST QP+FS+RELL
Sbjct  411   PEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELL  470

Query  478   SCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQ  537
             SCIVN+EQVM+VLRRPGQRY GRDRK RAATTIQAC RMW +  RYV+SR+S+ +A KIQ
Sbjct  471   SCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQ  530

Query  538   LAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHS  597
              A+RA+S   ALKARLRE+R E+   WEA+M + K+QW QIA RRR+VVHVPS+SL EHS
Sbjct  531   SAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHS  590

Query  598   RLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRP  657
             RL+AENFAVQQNLQLTRICAAALD  VDLLVYV+P+ELTADVS YF KLLQL G ADSRP
Sbjct  591   RLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRP  650

Query  658   RVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIAL  717
             RVK V+PEQAARFPAHFSLSS++LYSP+CLRRIRHYTAG +AYLVMGLPG EDQRLAI L
Sbjct  651   RVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITL  710

Query  718   DlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQP  777
             DLPILGA P QALPLLTRSGGKRLLI+AD+NVPTGTYELYDEHE+  ALAKLAVAH+DQ 
Sbjct  711   DLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQS  770

Query  778   RWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPG  837
             +WL+KLDYDPLGVGEAVVDLS MQAMREL REK+TPEYWRQPG RDAA+ L L E ERPG
Sbjct  771   KWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPG  830

Query  838   VLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLF  897
              LARL TP+HTE++P+WREY  AI HFGCV+EAVPPT+  AS E      EP Y+RAN+F
Sbjct  831   KLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASME------EPTYLRANIF  884

Query  898   IDPDGTVHITSTQNVLASG-GGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWG  956
             +DP+GTVH+TSTQNVL +  GGL+RK+  F FPQTVAPH A+KGAC A GK L ETNVWG
Sbjct  885   VDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWG  944

Query  957   YVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAAN  1016
             YVSLDFVVFQD KS  A RLWALA+HPFLT+SAA+FACFHLL RG LDA+SG YR+    
Sbjct  945   YVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTK  1004

Query  1017  STLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHA  1076
                 A  + +SG     DLLLREASL K    G  RCYVVCSYVFHP+VT  QYT FF  
Sbjct  1005  KLQTACTAEQSGNHDAMDLLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQN  1064

Query  1077  CRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATV  1136
             CRLHGVCFDV R LGTLFLL DSLTAGVFG+LS+GET   AL+++RTALEVIGREAGAT 
Sbjct  1065  CRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATK  1124

Query  1137  EMATSPSRPGSARSGNFAQVLSAVRAST  1164
              + +S SR   +  GNFA VLS VRAST
Sbjct  1125  GIVSSSSR---SVLGNFADVLSTVRAST  1149

>PHYRA_95901
Length=1075

 Score = 1303 bits (3373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 691/821 (84%), Positives = 743/821 (90%), Gaps = 22/821 (3%)

Query  345   SDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYSLH  404
             +DD+E NRE    +  +E       D + E + E     LGANVDKIRGYN+LLDAYSLH
Sbjct  260   NDDMEGNREHIDGEISDEDQGGADNDKDEEAEMEE----LGANVDKIRGYNDLLDAYSLH  315

Query  405   QFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLA  464
             QFLIHKGR+MRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAY DGQRLLSLA
Sbjct  316   QFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLA  375

Query  465   STGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  524
             +TGQPRFSK ELL+CIVNEEQVM+VLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV
Sbjct  376   ATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  435

Query  525   RSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRRV  584
             RSRASD SAT+IQLAWR++SCHAALK RLRE+RREQL+ WEA+M DL+TQW QIAGRRRV
Sbjct  436   RSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRV  495

Query  585   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFL  644
             VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDS+VDLLVYV+PFELTADVS YFL
Sbjct  496   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFL  555

Query  645   KLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMG  704
             KLLQLGGLADSRPRVKLVFPEQAARFP HFSLSS+LLYSPHCLRRIRHYTAGK+AYLVMG
Sbjct  556   KLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMG  615

Query  705   LPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFA  764
             LPG EDQRLA+ALDLPILGAPP QALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFA
Sbjct  616   LPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFA  675

Query  765   ALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDA  824
             ALAKLAVAHM+QP+WLLKLDYDPLG+GEAVVDLSGMQAMRELRREK+TPEYWRQPGPRDA
Sbjct  676   ALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDA  735

Query  825   ASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETAS  884
             A+KLVLAELERPGVLARLATPMHTEIFP+WR++TEAI HFGCV+EAVPP    A+PE++S
Sbjct  736   AAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSS  795

Query  885   SSVEPAYVRANLFIDPDGTVHITSTQNVLA-SGGGLNRKTVAFTFPQTVAPHEAVKGACT  943
               VEPAYVRANLF+ PDG       +NVLA SGGGLNRKTVAFTFPQT APHEAV+GAC 
Sbjct  796   LLVEPAYVRANLFVYPDG-------KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQGACD  848

Query  944   AAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVL  1003
             A GKLLVET+VWGYVSLDFVVFQD+K+GG+PRLWALAVHPFLTDSAASFACFHLLAR   
Sbjct  849   ATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLAR---  905

Query  1004  DASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHP  1063
                 G YR+AA+NS + A N GRSG GG  DLLLREASL K A AG PRC+VVCSYVFHP
Sbjct  906   ----GAYRVAASNSMVNA-NPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960

Query  1064  HVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRT  1123
             HVTTMQY+AFFHACRLHGVCFDVERTLGTLFLL DSLTAGVFG+LSVGETT+GALAF+RT
Sbjct  961   HVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRT  1020

Query  1124  ALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
             ALEVIGRE GAT+EMAT  SRP S R+GNFAQVLSAVRAST
Sbjct  1021  ALEVIGREVGATIEMAT--SRPVSTRNGNFAQVLSAVRAST  1059

 Score = 384 bits (987),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 225/274 (82%), Positives = 231/274 (84%), Gaps = 25/274 (9%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61   AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
            AILQQTE ELRAKAELVL GMVNSSSSAQ NQSQSGTLLP VTVAAPPSTRHRSGY    
Sbjct  61   AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYG---  117

Query  121  VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180
                 DASSIP+EFFREQF NSSVEVRQ+LMPSP H QRHLGI HGRL+RKKTTQHCRLL
Sbjct  118  -----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLL  172

Query  181  PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggVMKQ  240
            PSVNKVDP+APTPELREEDAKHGVLNLVTR                  +    G GVMKQ
Sbjct  173  PSVNKVDPTAPTPELREEDAKHGVLNLVTRS-----------------SGTKDGSGVMKQ  215

Query  241  RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLR  274
            RATRI+DRSEQ  R TPFTQSTGYNLAALKFDLR
Sbjct  216  RATRIYDRSEQPARATPFTQSTGYNLAALKFDLR  249

>PHYCA_34475
Length=692

 Score = 1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/725 (83%), Positives = 650/725 (90%), Gaps = 34/725 (5%)

Query  392   RGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVP  451
             RGYNELLDAYSLHQFLIHKGRTMRDTPEF+SF RVAQELWGSVEEALRALETLLT YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  452   LAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQ  511
             LAY DGQRLLSLA+TGQPRFSKRELLSCIVNEEQVMA LRRPGQRYKGRDRKRRAATTIQ
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  512   ACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDL  571
             A VRMW+ RRRY RSRA D +AT+IQLAWRA+SCHAALKARLRE+RREQL+ WEA+M+ L
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  572   KTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVA  631
             K+QW QIA  RRVVVHVPSLSLDE+SRLSAEN AV+QNLQLTRICAAALDS VDLLVYV+
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  632   PFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIR  691
             PFELT DVS YF+KLLQLGGLADSRPRVKL+FPEQA RFPAHFSLSS+LLYSPHCLRRIR
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  692   HYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPT  751
             HYTAGK+AYLVMGLPG EDQRLA+ LDLPILGAPP QALPLLTRSGGKRLLIRADVNVP 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  752   GTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKK  811
             GTYELYDEHELF+ALAKLAVAHMDQP+WL KLDYDPLGVGEAVVDLSGMQAMRELRREK+
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  812   TPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAV  871
             TPEYWRQPGPRDAA+KLVL ELERPG LARLA P+H +IFPSW E+ EAI HFGCV+EAV
Sbjct  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  872   PPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS-GGGLNRKTVAFTFPQ  930
             P T+   +PET+++ +EPAY+RANLF+DPDG+VH+TST N+LA+ GGGLNR+TVAFTFPQ
Sbjct  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  931   TVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAA  990
             T APHEAVKGAC+AAGKLLVETNVWGYVSLDFVVFQDDKS GAPRLWALAVHPFLTDSAA
Sbjct  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  991   SFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGT  1050
             SFACFHLLARGVLDA+SG YRMAAA+                                 T
Sbjct  601   SFACFHLLARGVLDANSGVYRMAAAS---------------------------------T  627

Query  1051  PRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSV  1110
             PRC+VVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLL DSLTAGVFGVLS+
Sbjct  628   PRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSI  687

Query  1111  GETTD  1115
             GETT+
Sbjct  688   GETTE  692

>PYIW_18793
Length=997

 Score = 967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/1018 (52%), Positives = 696/1018 (68%), Gaps = 67/1018 (7%)

Query  175   QHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsg  234
             QH RLLPSVNK DPSAPTPEL E+DAK+G+L+LV RGFLP   DLT AF    G      
Sbjct  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGG-----  57

Query  235   ggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapf-------tppppapess  287
               +++   TRI+DR EQ +R  P T  +G+N+A LKFDL A         +  P   +++
Sbjct  58    --IIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115

Query  288   ppatattrrrstrrgsagHGPSKVTMSFPESARADKSGRSVRQSSLVSAAI---AAFTNQ  344
                   ++       +   GP+ +T+SF   AR      +VR +    + I   A+   +
Sbjct  116   LAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQE  175

Query  345   SDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAYSLH  404
             ++  E N +                  + + D+   M+EL  NV+KIRGYNELLD YSLH
Sbjct  176   AESPETNVDE-------------DLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLH  222

Query  405   QFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSLA  464
             QF+IHKGR MR+TPEFVSF+RVAQE+WGSV+E ++ALE LLT+YFVPLAY DGQRL+++A
Sbjct  223   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVA  282

Query  465   STGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  524
             +     +SKR+LLSCIVNE+QV +++RRPGQRYKG+DRKRRAA TIQ   RMW  +++Y 
Sbjct  283   AMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYS  342

Query  525   RSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRRV  584
             R R    S   IQ  WR ++ H  LK R++  R +Q   WEAKM  LK  W +I G RRV
Sbjct  343   RFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRV  402

Query  585   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFL  644
             V+HVPS S+DE  RLSA+NF+V+QNLQL+R+C   +DSNVD+ VYV+PFELT DV  Y +
Sbjct  403   VIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNVDI-VYVSPFELTTDVVQYSM  460

Query  645   KLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMG  704
             KLLQLGG+AD   RVKLVFPE A RFP HFSL+++LLYSPHCLRRI+ Y   K+AYLV G
Sbjct  461   KLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTG  520

Query  705   LPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFA  764
             +PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +RADVNVPTGTY++YDE EL  
Sbjct  521   MPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVF  580

Query  765   ALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDA  824
             +LAKL V+H++Q  W+LK+DYDP   G A++D+S M A+RE+RREK++PEYWRQPG RD 
Sbjct  581   SLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDN  640

Query  825   ASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETAS  884
             A+++++AELER   L  L TP+H E++PSW++Y +AI  FG VVEA P            
Sbjct  641   AARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAP------------  686

Query  885   SSVEPAYVRANLFIDPDGTVHITSTQNVL---------ASGGGLNRKTVAFTFPQTVAPH  935
              S    +VRANLF++P G VH++STQ++L           GG    K+V + FPQT AP+
Sbjct  687   -SAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPY  745

Query  936   EAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACF  995
             EA++GA TA GKLL E NV+GY S+DF+VFQ+DKS  A RLWA+A+ P+LTDSAA+F  F
Sbjct  746   EAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTF  804

Query  996   HLLARGVLDASSGGYRMAAANSTLAAV------NSGRSGGGGTTDLLLREAS---LAKGA  1046
             HLL RG L+ +SG Y + AA  T A++      ++  + G    DL+L EA+   L    
Sbjct  805   HLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLE  864

Query  1047  QAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFG  1106
             + G    YVV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++FLL DSLTAGVFG
Sbjct  865   KVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFG  924

Query  1107  VLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRAST  1164
             ++   +T  GAL F+RTALEV+GRE G T  +    +  G A +GNFA VL+A+RA T
Sbjct  925   LMCCSDTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAIRALT  981

>PYU1_G001734
Length=800

 Score = 890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/799 (56%), Positives = 597/799 (75%), Gaps = 37/799 (5%)

Query  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
             L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEFVSF+RVAQE+WG VEE ++ALET
Sbjct  4     LRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALET  63

Query  444   lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
             LLT+YFVPLAY DGQRL+++AS     FSK++LLSCIVNE+QV +++RRPGQRYKG+DRK
Sbjct  64    LLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  123

Query  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
             RRAA TIQ   RMWS +++Y R R    S   IQ  WRA++ H  L+ +L+  R++Q + 
Sbjct  124   RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHEQ  183

Query  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
             WEA+M  L+ +W +I   RRV++HVPSLS+DE  R+ A+NFAV+QNLQL+R+C   +D+N
Sbjct  184   WEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-IDAN  242

Query  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
             VD+ VYV+PFELT++V  YF+KLLQLGG+AD   RVKLVFPEQA RFPAHFSL++VLLYS
Sbjct  243   VDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYS  301

Query  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLI  743
             PHCLRRIR    GK+AYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR  +
Sbjct  302   PHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFM  361

Query  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803
             RADVNVPTGTY++YDE EL  +LAKL V+H++Q  WLLK+DYDP G G A+VD S + A+
Sbjct  362   RADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTAL  421

Query  804   RELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISH  863
             RE+RREKK+PEYWRQPG RD A+++++AELER   + +L TP+H E++P+W+E+ +AI+ 
Sbjct  422   REIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIAQ  479

Query  864   FGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKT  923
             FG V+EA P             S    Y+RANLF++P G VH++STQ+V+ S   ++++ 
Sbjct  480   FGVVIEAAP-------------SAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRK  526

Query  924   VA-FTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVH  982
             VA + FPQT AP+EA++GA  A GK+LV+ +V+GY S+D++VF++DK+   PRLWA+A+H
Sbjct  527   VAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT-HVPRLWAMALH  585

Query  983   PFLTDSAASFACFHLLARGVLDASSGGYRMAAANST--------------LAAVNSGRSG  1028
             P+LTDSA++FA FHLL RG L+  +G Y + A  ++              L A ++  +G
Sbjct  586   PYLTDSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAG  645

Query  1029  GGGTTDLLLREAS---LAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFD  1085
                + +L+L+EA+   L    +AG  R Y V  Y+FHP+V+TMQY++FFH CRLHGVCFD
Sbjct  646   SATSANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFD  705

Query  1086  VERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRP  1145
             VER  GT+F+L DSLTAGVFG++  G+T   AL F+RTALEVIGRE G T  +       
Sbjct  706   VERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDLRGG  764

Query  1146  GSARSGNFAQVLSAVRAST  1164
             G   SGNFA+VL+ VR  T
Sbjct  765   GDCESGNFAEVLTVVRTLT  783

>PYIR_13453
Length=1186

 Score = 888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/808 (57%), Positives = 594/808 (74%), Gaps = 46/808 (6%)

Query  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
             L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEFVSF+RVAQE+WGSVEE +RALE 
Sbjct  382   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEA  441

Query  444   lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
             LLT+YFVPLAY DGQRL+++A+     FSKR+LLSCIVNE+QV +++RRPGQRYKG+DRK
Sbjct  442   LLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  501

Query  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
             RRAA TIQ   RMW  +++Y R R    S   IQ  WRAF+ H +LK +L+  R +Q + 
Sbjct  502   RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQ  561

Query  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
             WEAKM  LK  W  I G RRVV+HVPSLS+DE SR+SA+NF+V+QN+QL+R+C   +D N
Sbjct  562   WEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPN  620

Query  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
             VD +VYV+PFELTADV+ Y +KLLQLGG+AD   RVKLV+PEQAARFPAHFSL+++LLYS
Sbjct  621   VD-IVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYS  679

Query  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLI  743
             PHCLRRI+ Y   K+AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +
Sbjct  680   PHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFM  739

Query  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803
             RADVNVPTGTY++YDE EL  +LAKL ++H++Q  W+LK+DYDP G G A++D+S M  +
Sbjct  740   RADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVL  799

Query  804   RELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISH  863
             RE+RREKK+PEYW+QP  RD A++ ++AELER   LA L TP+H E++PSW+E+ +AIS 
Sbjct  800   REIRREKKSPEYWKQPSTRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQ  857

Query  864   FGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS--------  915
             FG VVEA P             S    +VRANLFI+P G VH++STQ+++ +        
Sbjct  858   FGVVVEAAP-------------SAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSG  904

Query  916   ------GGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDK  969
                    G    KTV + FPQT AP+EA++GA TA GKLL +  V+GY S+D++VFQ+DK
Sbjct  905   GGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDK  964

Query  970   SGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGG  1029
             +  A RLWA+A+HP+LTDSA++FA FHLL RG L+ASSG Y +    ++ ++ ++     
Sbjct  965   THAA-RLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKP  1023

Query  1030  GGT----------TDLLLREAS---LAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHA  1076
               +           DL+++EA+   L    +AG  R YVV  Y+FHP+V+TMQY+AFFH 
Sbjct  1024  SHSRAAGATGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHT  1083

Query  1077  CRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATV  1136
             CRLHGVCFDVER +G++FLL DSLTAGVFG++   ++  GAL F+RTALEVIGRE G   
Sbjct  1084  CRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQA  1143

Query  1137  EMATSPSRPGSARSGNFAQVLSAVRAST  1164
              M       G + +GNFA VL+ +RA T
Sbjct  1144  LMDEFMG-GGESETGNFADVLAVIRALT  1170

 Score = 215 bits (548),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 179/282 (63%), Gaps = 32/282 (11%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRH-SAVVTTAEVQAF  59
            M++ QQQHHVEDVGR+LLQTQEQLR+MREQM A +       S MR  S+  +  +V AF
Sbjct  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPS---SSMRFASSGASQPDVLAF  57

Query  60   NAILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAA----PPSTRHRSG  115
              ILQ+ E E+RAKAELVLNG VN+SS          + LP V+ +A     P  R R  
Sbjct  58   QEILQRAEVEIRAKAELVLNGFVNTSSQ--------ASALPTVSSSANGNASPKARLRQN  109

Query  116  YAKPRVAK--SMDASSIP-MEFFREQFRNSSVE-VRQTLMPSPLHLQRHLGIHHGRLMRK  171
                  A+  S  AS  P +++FR +F N +VE V   ++PSP+  QR   I  G+L++K
Sbjct  110  VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSPV--QR---ITKGQLVKK  164

Query  172  KTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgand  231
            K  Q+ RLLPSVNK DPSAPTPEL E+DAK G+L+LV RGFLP  ADLTPAF        
Sbjct  165  KMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAF-------I  217

Query  232  gsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
             + G ++K   TRI+DR EQ +R  P T  +G+N+A+LKFD+
Sbjct  218  NNHGSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDI  259

>PYAP_17746
Length=1169

 Score = 796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/790 (54%), Positives = 558/790 (71%), Gaps = 42/790 (5%)

Query  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
             L  NV+KIRGYNELLDAYSLHQF+IHKGR +RDTPEF SF+RVAQE+WGS+EE ++ALE 
Sbjct  352   LRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEI  411

Query  444   lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
             LLT+YFVPLAY DGQRL++LAS    + S  ELL+C+VNE+QV +++RRPGQRYKG+DRK
Sbjct  412   LLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRK  471

Query  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
             RRAATT+QA  RM   R R+ + R +  SA  IQ  WR+++C  +L+ RL  +R E+L  
Sbjct  472   RRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGE  531

Query  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
             W+AK+  +++QW  I  +RRVV+HV S+S+DE +RLS ENF+V+QNLQL+R+ A  +D N
Sbjct  532   WKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-AGLVDQN  590

Query  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
             V+ +VYV PFEL+ +VS YF+KLLQL G+A++  RV+LVFPE AA+FP HFSL++ L+YS
Sbjct  591   VE-IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYS  649

Query  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDl-pilgapppqalpllTRSGGKRLL  742
             P+C+RRI+    GK+AYLVMG+PG EDQRLA+AL +  +    P   LPL+TRSG KR  
Sbjct  650   PNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFF  709

Query  743   IRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQA  802
             I+ADVNVPTGTY++YD  EL  +LAKL ++H++Q  WLLKLD DPLG G A++D+S M  
Sbjct  710   IKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTT  769

Query  803   MRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAIS  862
             +R++RREK+ PEYW+QPG RD  ++ +L ELER   +  L  P H EIF SW+E+  AI 
Sbjct  770   LRDIRREKRPPEYWKQPGIRDTIARALLQELERE--IGSLLKPSHPEIFASWKEFASAIP  827

Query  863   HFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGL---  919
              FG VVEA+P    VA             +R N+FI+P G VH+ ST +VL+  G     
Sbjct  828   EFGVVVEALP--FHVA-----------GVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQ  874

Query  920   -NRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVW-GYVSLDFVVFQDD---KSGGAP  974
               R+  AF FPQT+ PHEA+ GA +A G++L E + + GY S+D  + Q++       A 
Sbjct  875   RQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAE  934

Query  975   RLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGR-SGGGGTT  1033
             RLWA+++ P+LTDSAA+FA FH L RGVL+ ++G Y + A  ST    +S   S   GT 
Sbjct  935   RLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIGTL  994

Query  1034  DLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  1093
             D +            G PR Y V  YVFHP+V+ M Y AFFH CRLHGVCFDVER +G++
Sbjct  995   DRI------------GAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSV  1042

Query  1094  FLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSA--RSG  1151
             FLL DSLTAG+FGVLS GE+   AL ++RTA EVIGRE G T  M +  S  GS+   SG
Sbjct  1043  FLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVG-TQSMVSGDSDIGSSVQLSG  1101

Query  1152  NFAQVLSAVR  1161
             NFA++L  +R
Sbjct  1102  NFAEILGLLR  1111

 Score = 175 bits (443),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 162/284 (57%), Gaps = 28/284 (10%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   S + +        
Sbjct  1    MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSN-------GPGNGSVIASNNAGAEIE  53

Query  61   AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
             ILQ+ E ELR KAELVL+ +V +  ++     + G L+P  TV  PP  R R   A+  
Sbjct  54   EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELH  113

Query  121  VAKSMDASSIPMEFFREQFRNSSVEVRQTLM----------PSPLHLQRHLGIHHGRLMR  170
               S D   + +E+FR++F+ ++V+   + M          P+P H        HG++++
Sbjct  114  DGGSYD---LDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHA-------HGKVVK  163

Query  171  KKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsg-a  229
             KTT + RLLP VNK DP+AP P L   DAK GVL+L+ RGFLP   DLTPAF   S   
Sbjct  164  HKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPK  223

Query  230  ndgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
            + G+   V++  + ++H R EQ VR T ++    +NLA LKFD+
Sbjct  224  SQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDM  267

>SPRG_06354
Length=884

 Score = 619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/790 (43%), Positives = 485/790 (61%), Gaps = 39/790 (5%)

Query  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
             L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+ ++LWGSV  A+R LET
Sbjct  100   LRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELET  159

Query  444   lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
             LL  Y VPLAY DGQ+LL +A+      SK ELL+C++N ++V   + RPGQR+KG D +
Sbjct  160   LLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGR  219

Query  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
               AA  IQ+  RM   RR  +R       AT IQ  +R + C   ++ +LR  R      
Sbjct  220   HAAAIVIQSVYRMHRTRR-LLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADART  278

Query  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
             WE +M      W +I  +RRVVVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D N
Sbjct  279   WETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPN  337

Query  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
             VD+ +Y++PFEL+ D+  Y ++LLQLGG+AD   RV+++ PE A RFP HFSL+++LLYS
Sbjct  338   VDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYS  396

Query  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLI  743
             PHCL++I+ Y  GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KRL  
Sbjct  397   PHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFT  456

Query  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803
             +ADVN+P G +++YDE EL  +LAKL  A++ Q  WL+KLD DP   G A +D+  ++ +
Sbjct  457   QADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECV  516

Query  804   RELRREK---KTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEA  860
              ++R EK   K  EY+ QP  ++   + ++AEL       RL +P   +++P+W+     
Sbjct  517   NKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPV  574

Query  861   ISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLN  920
             ++  G V+EA PP                A VRAN+FI+P G VH+TS Q  L       
Sbjct  575   VNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHVTSAQEQLMHVKN-K  620

Query  921   RKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS----GGAP--  974
              ++V   +P T  P+ A++GA  A  + +  + + GY S+D+V F D K+     G P  
Sbjct  621   HQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL  680

Query  975   RLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTD  1034
             RLWAL + P LT +A SF  F  L+   LDA++G   +       A   S  +G   T  
Sbjct  681   RLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPLP----APRPSSLAGPPATET  736

Query  1035  LLLREASLAKGAQA---GTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLG  1091
              L  E  L + + A   G  R Y+   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G
Sbjct  737   QLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIG  796

Query  1092  TLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSG  1151
               F+L DSLTAGV G+L +GE+   A+   R ALE+IG + G    +  +P      R G
Sbjct  797   AAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTGERLG  852

Query  1152  NFAQVLSAVR  1161
             NFA VL A+R
Sbjct  853   NFAAVLGAIR  862

 Score = 43.5 bits (101),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%)

Query  238  MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
            M+    R++DRSEQ V+  P+  S+G+N+A+LK DL
Sbjct  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDL  36

>SDRG_01764
Length=1092

 Score = 615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/790 (43%), Positives = 488/790 (62%), Gaps = 36/790 (5%)

Query  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
             L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+ ++LWGSV  A+R LET
Sbjct  312   LRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELET  371

Query  444   lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
             LL  Y VPLAY DGQ+LL +A+      SK ELL+C++N ++V   + RPGQR+KG D +
Sbjct  372   LLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSR  431

Query  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
               AA  +Q+  RM   RRR +R       A+ IQ  +R +     ++ +LR  R      
Sbjct  432   HAAAILLQSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADART  490

Query  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
             WE +M      W +I  +RRVVVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D N
Sbjct  491   WETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-DPN  549

Query  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
             VD+ +Y++PFEL+AD+  Y ++LLQLGG+AD   RV+++ PE A RFP HFSL+++LLYS
Sbjct  550   VDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYS  608

Query  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLI  743
             PHCL++I+ Y  GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KRL  
Sbjct  609   PHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFT  668

Query  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803
             +ADVN+P G +++YDE EL  +LAKL  A++ Q  WL+KLD DP   G A +D+  ++ +
Sbjct  669   QADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECV  728

Query  804   RELRREK---KTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEA  860
              ++R EK   K  EY+ QP  ++   + ++AEL       RL +P   +++P+W+     
Sbjct  729   NKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPV  786

Query  861   ISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLN  920
             ++  G V+EA PP                A VRAN+FI+P G VH+TS Q  L       
Sbjct  787   VNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAKN-K  832

Query  921   RKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS----GGAP--  974
              ++V   +P T  P+ A++GA  A  + +  + + GY S+D+V F D K+     G P  
Sbjct  833   HQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL  892

Query  975   RLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRM--AAANSTLAAVNSGRSGGGGT  1032
             RLWAL + P LT +A SF  F  L+   LDA++G   +   A + + A      +     
Sbjct  893   RLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLA  952

Query  1033  TDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT  1092
              + +L E+   + +  G  R Y+   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G 
Sbjct  953   VEKILSESP--RSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGA  1010

Query  1093  LFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGN  1152
              F+L DSLTAGV G+L +GE+   A+   R ALE+IG + G    +  +P      R GN
Sbjct  1011  AFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTGERLGN  1066

Query  1153  FAQVLSAVRA  1162
             FA VL A+R+
Sbjct  1067  FAAVLGAIRS  1076

 Score = 166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 154/276 (56%), Gaps = 30/276 (11%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43

Query  61   AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
            AIL++ E +LR+KAE+VLNG+VN++          G   P+V+  +    + R       
Sbjct  44   AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103

Query  121  VAKSMD---ASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHC  177
               S+D     S P+E  R+Q     V V +   P    + R + +  GRL++KK T   
Sbjct  104  RDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQV--GRLIKKKVTGPQ  161

Query  178  RLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsgandgsgggV  237
            RLLP VN++DP AP P+L ++DAK GVLNLV RGF+P  ADL+ AF          G G+
Sbjct  162  RLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF--------THGDGI  213

Query  238  MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
            ++    R++DRSEQ V+  P+  S+ +N+A+LK DL
Sbjct  214  IQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDL  249

>H310_09212
Length=1113

 Score = 593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/788 (42%), Positives = 486/788 (62%), Gaps = 35/788 (4%)

Query  387   NVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletllt  446
             NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEF+SF+R  ++LWGSV ++++ LE +LT
Sbjct  331   NVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLT  390

Query  447   QYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRA  506
              Y VPLAY DGQ+L+ +A+         ELLSCI+N ++V +++RRPGQR+KG+     A
Sbjct  391   NYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLA  450

Query  507   ATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEA  566
             A  +Q+  RM+  ++R +++   +  A  IQ  +R++ C + L+ RL+ +R   L  W+A
Sbjct  451   AVLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDA  509

Query  567   KMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDL  626
             +M   +  W  I  +RRVVVHVPS S +E +RL  ENF++QQNLQ+ R+CA A D NVD+
Sbjct  510   QMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVDI  568

Query  627   LVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHC  686
              +Y++PFEL+ D+  Y ++LLQLGG+AD + R++++ PE   RFP HFSL++VLLYSPHC
Sbjct  569   -IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHC  627

Query  687   LRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRAD  746
             L++I+ +  GKDAY+V G  G ED+RLAIAL LP+LG  P +AL   TRSGGKR+ + AD
Sbjct  628   LKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAAD  687

Query  747   VNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMREL  806
             VN+P G +++YDE EL  +L+KL  A +DQ  WL+K+D D    G A +++  MQ++ + 
Sbjct  688   VNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKF  747

Query  807   RREKK-----TPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAI  861
             R EK+       EY++QP  RDA  + V +EL      A   TP   E++ SW       
Sbjct  748   RAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFPEMYASWAAMRPIA  806

Query  862   SHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNR  921
                G V+EA P                 ++VR N+FI+P G VHITS  +V       + 
Sbjct  807   LRVGVVIEAYPSKVL-------------SHVRTNIFIEPSGGVHITSAHDVFMCPVNKHL  853

Query  922   KTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS--GGAP--RLW  977
                A  FPQ+  P++A++GA  A    +    + GY S+D++ F D K+   G P  RLW
Sbjct  854   PQCA-VFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLW  912

Query  978   ALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTD---  1034
             A+ V P LT++A SF  F  L+    +  +G   +  A + +A +++  +    T     
Sbjct  913   AMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIA  972

Query  1035  -LLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  1093
              +L   +S A  +  G  R Y+V  Y++HP++ T+Q+  FF+ CRLHGV FD++R +G  
Sbjct  973   TILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAA  1032

Query  1094  FLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNF  1153
             ++L DSLTAGV G++ +GE+   A    R A+E+IG + G    +   P+     R GNF
Sbjct  1033  YILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG----VQALPNSLSGERLGNF  1088

Query  1154  AQVLSAVR  1161
               +L+ VR
Sbjct  1089  PHLLAIVR  1096

 Score = 151 bits (381),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 156/287 (54%), Gaps = 51/287 (18%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            MEK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1    MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43

Query  61   AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
            AIL++ EA+LRAKAE+VLNG+VN+S            +LPA+   AP   R+ S ++   
Sbjct  44   AILERAEADLRAKAEIVLNGVVNNSM----------KMLPAID--APGGQRYLSKFSSKL  91

Query  121  VAKSMDASSIPMEFFREQF-----RNSSVEVRQTLMP--SPLHLQRHLG-------IHHG  166
              K   A+++  E   E        ++S     +L     P+   R  G       +  G
Sbjct  92   AQKRDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAG  151

Query  167  RLMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagp  226
             L++ KTT+  R+LP +N++DP+AP P L ++DA+ GV NL+TRGFLP   D+TPAF   
Sbjct  152  SLVKHKTTKPRRILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAF---  208

Query  227  sgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
                   G  V++    +I+DR+ Q V+  P+T  +G+N+A+LKFD+
Sbjct  209  -----THGTSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  250

>H257_06305
Length=1099

 Score = 581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/792 (41%), Positives = 482/792 (61%), Gaps = 43/792 (5%)

Query  387   NVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletllt  446
             NV+KIRGYNELLD YSLHQF+I KG+T+ DTPEF+SF+R  ++LWGSV  +++ LET+LT
Sbjct  317   NVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLT  376

Query  447   QYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRA  506
              Y VPLAY DGQ+L+ +A+         ELLSCI+N ++V +++RRPGQRYKG      A
Sbjct  377   SYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLA  436

Query  507   ATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEA  566
                IQ+  RM+  ++R +++   +  A  IQ  +R++ C + L+ RL+ +R   L  W+A
Sbjct  437   VVLIQSVWRMFLTKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDA  495

Query  567   KMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDL  626
             +M   +  W  +  +RRVVVHVPS + D+ +RL  +NF+++QNLQ+ R+CA A D NVD+
Sbjct  496   QMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVDI  554

Query  627   LVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHC  686
              +Y++PFEL+ D+  Y ++LLQLGG+ D + R++++ PE   RFP HFSL+++LLYSPHC
Sbjct  555   -IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHC  613

Query  687   LRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRAD  746
             L++I+ +  GK+AY+V G  G ED+RLAIAL +P+LG  P +AL   TRSGGKR+ + AD
Sbjct  614   LKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAAD  673

Query  747   VNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMREL  806
             VN+P G +++YDE EL  +L+KL  A +DQ  WL+K+D D    G A +++  MQ++ ++
Sbjct  674   VNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKV  733

Query  807   RREKK-----TPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAI  861
             R EK+       EY++QP  RDA  + +  EL      A + TP   +++ SW E     
Sbjct  734   RAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANI-TPCFPDVYASWAELRPVA  792

Query  862   SHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNR  921
                G V+EA P                 + VRAN+FI+P G VHITS  ++  S    + 
Sbjct  793   LRVGVVIEAYPSKVL-------------SQVRANVFIEPSGGVHITSAHDLFMSPANKHL  839

Query  922   KTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS---GGAP--RL  976
                A  FPQT  P++A++GA  A    +    + GY S+D++ F D K+   GG P  RL
Sbjct  840   PQCAL-FPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRL  898

Query  977   WALAVHPFLTDSAASFACFHLLARGVLDASSGGYRM-------AAANSTLAAVNSGRSGG  1029
             WA+ V P LT++A SF  F  L+    +  +G   +        AA++T+A +   +   
Sbjct  899   WAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKA-  957

Query  1030  GGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERT  1089
                 + +L           G  R Y+V  Y++HP++ T+ ++ FF+ CRL+GV FD++R 
Sbjct  958   ---VETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRA  1014

Query  1090  LGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSAR  1149
             +G  F+L DSLTAGV G++ +GE    A    R A+E+IG + G    +   P      R
Sbjct  1015  IGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVG----VQALPDSLSGER  1070

Query  1150  SGNFAQVLSAVR  1161
              GNF  +L+ VR
Sbjct  1071  LGNFPHLLAIVR  1082

 Score = 165 bits (417),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 155/284 (55%), Gaps = 48/284 (17%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            M+K+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   N
Sbjct  1    MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEK-----------------NNVDVNEIN  43

Query  61   AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGYAKPR  120
            AIL++ EA+LRAKAE+VLNG+VN+S            +LPA+   AP      S ++   
Sbjct  44   AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAI--EAPGGKTSLSKFSSKL  91

Query  121  VAKSMDASSIPMEFFRE----QFRNSSVEVRQTLMPSPLHLQRHLG-------IHHGRLM  169
              K   A+++  +   E     +R    E R      P+   R  G       I  G L+
Sbjct  92   AQKRELAATMTRDSSYEPASPTYRQEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLV  151

Query  170  RKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagpsga  229
            +KKTT+  RLLP +N+ DP+AP+P+L EEDA+ GV NLVTRGFLP   D+TPAF      
Sbjct  152  KKKTTKPHRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF------  205

Query  230  ndgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
                G  V++    +I+DR+ Q V+  P+T  +G+N+A+LKFD+
Sbjct  206  --THGTSVIQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDM  247

>CCA18898
Length=1147

 Score = 559 bits (1441),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 391/1214 (32%), Positives = 636/1214 (52%), Gaps = 149/1214 (12%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaa---aveanaSPMR--HSAVVT---  52
             ME+V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  53    TAEVQAFNAILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPP----  108
             + +++  + IL + E E++AK +L+  G       A N      T LPAVT  +PP    
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRG-------AANFGQMMQTGLPAVT--SPPRQVS  136

Query  109   -STRHRSGYAKPRVAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGR  167
              +T+  S          +D +   +   ++ ++  S  ++Q+ + SP    +  G+   +
Sbjct  137   TTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYK-CSPSMQQSELISPKRPTQ--GLLTSK  193

Query  168   LMRKKTTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFagps  227
               +K+     + LP+V     S  +  L ++ ++     L +R   P  +          
Sbjct  194   ASKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHF-LNSRHGSPLNS---------I  243

Query  228   gandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRapftppppapess  287
               +  +    + QR  ++H+R E+ +R TP T +  +++ +LKFD               
Sbjct  244   EISQSTYDRALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF--------------  289

Query  288   ppatattrrrstrrgsagHGPSKVTM-----SFPESARADKSGR-SVRQSSLVSAAIAAF  341
                            +    P KV +      F + A  + + R S  Q S+  A I  F
Sbjct  290   ------------SAPTILQSPGKVQIHEQVTHFNDQALGECNCRLSTNQVSM--ALINGF  335

Query  342   TNQSDDLEDNRERFSeqpdeeisdeeqeddenekdeeaemeeLGANVDKIRGYNELLDAY  401
                +  L  +R+                  +    +  +  ++  + +  +G N     +
Sbjct  336   REDNSKLSPSRDH---------------SKKMGIPKVIKSTKINTDTESHKGNNSSNHDF  380

Query  402   SLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLL  461
             ++HQ ++ + R+     +F SF+  A ++W +VEE +  LE LL+ YF+P+A+ +GQR+L
Sbjct  381   TIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRIL  435

Query  462   SLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRR  521
             +L+       + R+LLSC+ NE +V  +L +PGQR++G ++  RAA  +Q+ +RM + RR
Sbjct  436   TLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRR  495

Query  522   RYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGR  581
              Y+   ++      IQ  WR ++ + A K ++  +R  Q   +   M    + W +I  +
Sbjct  496   TYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQ  555

Query  582   RRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSH  641
             RR V+H+PS+S+D   R+  E F++QQNLQL R+C A +D NV+ L+Y+ PFELT D+  
Sbjct  556   RRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLC-ALIDENVE-LIYICPFELTDDIVQ  613

Query  642   YFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYL  701
             Y++KLLQL G++D+  R+KL+ PE A+RFP+HFSLS+V+L SPH ++R+  Y  G++AYL
Sbjct  614   YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  673

Query  702   VMGLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHE  761
             V G PGTED+RLA  L +PILG  P +   + T SG KR   + + N   G+ +LYDE+E
Sbjct  674   VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  733

Query  762   LFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGP  821
             L  +LAKL  A+  Q   +LKLDYDP   G A+VD+S +Q+++ LR   +T +YWRQP  
Sbjct  734   LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPI  793

Query  822   RDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPE  881
             ++   + ++ E++   +++ L   ++ E++PSW+ + +AI  +G V+E  P         
Sbjct  794   QNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKN-------  844

Query  882   TASSSVEPAYVRANLFIDPDGTVHITSTQNVLA-----------------SGGGLNRKTV  924
                      YVRANLFI+P   V I+STQ  L+                        +T+
Sbjct  845   ------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTI  898

Query  925   AFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPF  984
              FTFPQT+  HE +K A    G+ L +  + GY+S+DF+V  DD++     L+A+A+ PF
Sbjct  899   GFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-LYAMALQPF  957

Query  985   LTDSAASFACFHLLARGVLDASSGGYRMA--------AANSTLAAVNSGRSGGGGTTDLL  1036
             LT+SAASF+ F  L+RG      GGY           A  S     ++  S     TDL+
Sbjct  958   LTNSAASFSLFQFLSRG------GGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLM  1011

Query  1037  LREASLAKGAQAGTP----RCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT  1092
             +REA L+       P    R YV+  YV +P+V T+ Y +FF  CR  GV FD+ER +GT
Sbjct  1012  IREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGT  1071

Query  1093  LFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPS------RPG  1146
             +FLL DSLTAGV G++ + +T   AL   R A+E I   AG    ++ S        R  
Sbjct  1072  VFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDLMRAD  1131

Query  1147  SARSGNFAQVLSAV  1160
             S R   F+++L A+
Sbjct  1132  STRD-RFSEILRAL  1144

>CCI45122
Length=1105

 Score = 535 bits (1379),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 302/764 (40%), Positives = 444/764 (58%), Gaps = 41/764 (5%)

Query  404   HQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYADGQRLLSL  463
             + F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY +GQR+L+L
Sbjct  338   YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397

Query  464   ASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRY  523
             A       + ++L+SCI NE++V  +L +PGQR++G +R +RA   +Q+ +RM   R+R+
Sbjct  398   AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457

Query  524   VRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQIAGRRR  583
             +  R   +  T IQ  WR FS H A K ++   R  Q   +   M    + W +I  +RR
Sbjct  458   LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517

Query  584   VVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYF  643
              ++H+PS+S+D   R+  E F++QQNLQL R+C A +D NV+ L+Y+ PFELT D+  Y+
Sbjct  518   TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLC-AVIDENVE-LIYICPFELTDDIVQYY  575

Query  644   LKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVM  703
             +KLLQLGG++D+  R+KL+ PE A+RFP+HFSLSSV+LYSP  L R+     G++AY+V 
Sbjct  576   MKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVP  635

Query  704   GLPGTEDQRLAIALDlpilgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELF  763
             G PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL 
Sbjct  636   GFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELI  695

Query  764   AALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRD  823
              +LAKL  +H  Q   +L+LDYDP G G A++D+S +Q+++E+R   KT E W QP  + 
Sbjct  696   FSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQA  755

Query  824   AASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETA  883
                + ++ E++    ++     +H EIFPS + + +AI  +G ++E  P           
Sbjct  756   KLIRNLVLEMQ--NNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK---------  804

Query  884   SSSVEPAYVRANLFIDPDGTVHITSTQNV-----------------LASGGGLNRKTVAF  926
                    +VRANLFI+P   V ++ST  +                 L        +T   
Sbjct  805   ----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGV  860

Query  927   TFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLT  986
             TFPQT+  HE +K A  A G+ L +  + GY+S+DFVV  DD++     L+A  + PFLT
Sbjct  861   TFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFLT  919

Query  987   DSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGA  1046
             ++AASFA F LL+RG    S  G         L  V +        TDL++REA L+   
Sbjct  920   NTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIV  979

Query  1047  QAGTP----RCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTA  1102
                 P    R Y +  YV +P V T+  ++FF  CR  GV FD ER  GT+FLL DSLTA
Sbjct  980   SNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTA  1039

Query  1103  GVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPG  1146
             GVFG++ + +T   AL+  R A+E I   AG   +M+ S S  G
Sbjct  1040  GVFGIMCISDTRKNALSNCRAAMEAIAGVAGT--KMSVSKSSDG  1081

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/288 (24%), Positives = 123/288 (43%), Gaps = 54/288 (19%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaS--------PMRHSAVVT  52
            M+ ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    +V  
Sbjct  1    MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  53   TAEVQAFNAILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRH  112
            + +++    IL + E E++AK +L+  G+ +     Q       T LP V  A+PP  R 
Sbjct  61   SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQ-------TGLPFV--ASPP--RQ  109

Query  113  RSGYAKPRVAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKK  172
                A   + +      + ++  R+Q    SV+ +   +P                    
Sbjct  110  IPSSANSSLERKSSFQELSVDLIRKQLH--SVKEKYKCLP--------------------  147

Query  173  TTQHCRLLPSVNKVDPSAPT-------PELREEDAKHGVLNLVTRGFLPAYADLTPAFag  225
            T QH  L      + P  PT       P  +  +A    L  V RG    ++  +    G
Sbjct  148  TKQHSEL------ISPKRPTQGLLTSKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIG  201

Query  226  psgandgsgggVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273
             +         V+ QR   +H+R E+ ++ TP+T +  +N+ ++KFD 
Sbjct  202  EASNTLSVNDRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDF  249

>PHYKE_8394
Length=428

 Score = 349 bits (895),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 192/222 (86%), Gaps = 23/222 (10%)

Query  602  ENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKL  661
            ENFAVQQNLQLTRICAAALDSNVDLLVYV+PFELTADVS YFLKLLQLGGLADSRPRVKL
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  662  VFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDlpi  721
            VFPEQA RFP                        GKDAYLVMGLPG EDQRLAIALDLPI
Sbjct  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  722  lgapppqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLL  781
            LGAPP QALPLLTRSGGKRLLIRADVNVPTGTYELYD+HELFAALAKLAV HMDQPRWLL
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  782  KLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRD  823
            KLDYDPLGVGEA++DLSGMQAMRELRREK+ PEYWRQPGPRD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 115/148 (78%), Gaps = 17/148 (11%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS V          
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV----------  50

Query  61   AILQQTEAELRAKAELVLNGMVnssssaqnnqsqsGTLLPAVTVAAPPSTRHRSGY---A  117
                +TE ELRAKAELVLNGMVNSSS+ Q+NQ+Q GTLLPAVTV APPS R R GY    
Sbjct  51   ----KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  106

Query  118  KPRVAKSMDASSIPMEFFREQFRNSSVE  145
            KP++    D  SIPMEFFRE+FRNS+VE
Sbjct  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)

Query  904  VHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK  939
            VH+TSTQNVLASG GLNRKTVA+TFPQT APHEAVK
Sbjct  390  VHVTSTQNVLASGSGLNRKTVAYTFPQTAAPHEAVK  425

 Score = 42.7 bits (99),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)

Query  384  LGANVDKIRGYNELLDAYS  402
            LGANVDKIRGYNELLDAY+
Sbjct  159  LGANVDKIRGYNELLDAYT  177

>PYAR_13581
Length=730

 Score = 290 bits (741),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 215/302 (71%), Gaps = 28/302 (9%)

Query  384  LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVeealralet  443
            L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RALE 
Sbjct  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143

Query  444  lltQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503
            LLT+YF             +AS     F    LLSC+VNE+QV ++LRRPGQRYKG+DRK
Sbjct  144  LLTRYF-------------MAS-----FPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185

Query  504  RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHaalkarlrelrreqlDN  563
            RRAATT+QA  RM   R R+ R      SAT+IQ  WR F+   +L+  L   R EQL  
Sbjct  186  RRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245

Query  564  WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623
            W+ +M  L++QW +I+ +RRVVVHVPSLSLDEH+R+S ++FAVQQNLQL R+ AA +D+ 
Sbjct  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-AAVVDAT  304

Query  624  VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683
            V+ +VYV+PFEL  D+SH         G+A++  RVK+V PE AA FP HFSL++ LLYS
Sbjct  305  VEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYS  355

Query  684  PH  685
            PH
Sbjct  356  PH  357

 Score = 171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 123/381 (32%), Positives = 172/381 (45%), Gaps = 109/381 (29%)

Query  793   AVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFP  852
             A++D+S +  +RE+RR  K P YW+QPG RD  ++ +L ELER   +  LA P H+E FP
Sbjct  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446

Query  853   SWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP-----DGTVHIT  907
              WR + +AI   G V+EA+P            + V    VR N+F+ P     D  V + 
Sbjct  447   DWRAFAQAIGRDGVVIEALP------------ARVR-GVVRVNIFVTPASSDHDADVPVV  493

Query  908   STQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVW-GYVSLDFVVFQ  966
             STQ  L +  G  R  +AF  PQT+ PH+AV GA  A G+LL E   + GY S+D  + +
Sbjct  494   STQEALRASAG--RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCR  551

Query  967   DDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGR  1026
             D+ SG                        +LL    +D S                    
Sbjct  552   DETSG-----------------------LYLLPSPAVDTS--------------------  568

Query  1027  SGGGGTTDLLLREASLAK------GAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLH  1080
             +     T L+L+EA L         + + +PRC+V   +  HP++ TM   AFF ACR  
Sbjct  569   APLSPATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRR  628

Query  1081  GVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMAT  1140
             GVCFDV R                            A+ ++RTA EV+ RE G+      
Sbjct  629   GVCFDVTRR---------------------------AMQYLRTAFEVLAREVGS------  655

Query  1141  SPSRPGSARSGNFAQVLSAVR  1161
               S P S   GNF  VL+ +R
Sbjct  656   --STPSS--DGNFGDVLALLR  672

>H310_11272
Length=1799

 Score = 38.9 bits (89),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 3/40 (8%)

Query  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAF  543
             R+AATTI + +RM+  RRRY +SRA   +  K+Q  WR+F
Sbjct  1122  RKAATTIASGIRMFLARRRYRKSRA---AFVKLQARWRSF  1158

>CCI49123
Length=420

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  507  ATTIQACVRMWSIRRRYVRSRASDFS--ATKIQLAWRAF  543
            AT IQ+  RM   RRR+V  R S +S  A +IQ+AWR F
Sbjct  120  ATMIQSWYRMQIARRRFVWKRLSLYSIAAAEIQIAWRNF  158

>CCA25381
Length=819

 Score = 34.7 bits (78),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  507  ATTIQACVRMWSIRRRYVRSRASDF--SATKIQLAWRAF  543
            AT IQ+  RM   RRRY+  R S +  +A +IQ+AWR F
Sbjct  552  ATRIQSWYRMQVARRRYMWKRFSVYPIAAFEIQIAWRKF  590

>PYIR_22258
Length=1323

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  502  RKRRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAF  543
            RKR++A  IQ+  R  S RRRY+     + SA K+Q A R F
Sbjct  844  RKRQSAILIQSAWRRVSCRRRYLHIIQRERSAIKLQAAARGF  885

>PYVX_21490
Length=2926

 Score = 34.3 bits (77),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 64/131 (49%), Gaps = 5/131 (4%)

Query  472   SKRELLSCIVNEEQVMAVLRRPGQRYKG-RDRKRRAATTIQACVRMWSIRRRY-VRSRAS  529
             +K  +L C    +  +  +R+  +R +  R+RK +A  TI+ C+R W +RRR  V  R +
Sbjct  998   AKETILRCWRRMQARLRRVRKQQERLRQQRERKDQAIRTIKQCLREWILRRRLAVAQRQT  1057

Query  530   DFSATKIQLAW-RAFSCHaalkarlrelrreqlDNWEAKMNDLKTQWHQI-AGRRRVVVH  587
               +  K  L W +A   H  + +  ++ R E      + + +L+ +W Q  A R ++  H
Sbjct  1058  RQTMFKENLKWTKAKRDHEKILSLEKKRRDELSSKLTSNLAELEQKWQQTDAERIKLAAH  1117

Query  588   VPSLSLDEHSR  598
                + L +H R
Sbjct  1118  NEKV-LKQHQR  1127

>PHALS_03599
Length=106

 Score = 31.6 bits (70),  Expect = 7.1, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 27/58 (47%), Gaps = 4/58 (7%)

Query  852  PSWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITST  909
            P+WR YTEA S+   V+ A    S VAS         P Y+    F  P  T+H+  T
Sbjct  48   PNWRLYTEATSNL--VISACDTDSGVASGSLCFDKTNP-YIGIGTF-SPSKTLHVNGT  101

>PYIR_16972
Length=936

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query  448  YFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAA  507
            Y   + Y D  R+  L   G    + REL +C+   E   A       R+K RD +R AA
Sbjct  313  YAAKVTYKDMLRIFVLLEDG----TARELKTCVARLEAHFAFYFESFSRWKDRDAERLAA  368

Query  508  TTIQACVRMWSIRRRYV  524
              +++   ++ +++RY+
Sbjct  369  EMLRSYHDIYKMKKRYL  385

>CCI41908
Length=1541

 Score = 33.9 bits (76),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  497  YKGRDRKRRAATTIQACVRMWSIRRRYVRSR  527
            Y+ R R++ A   IQA +RM+ +R+++VR R
Sbjct  867  YEYRKRRQNAILKIQATMRMYQVRKKFVRHR  897

Lambda      K        H        a         alpha
   0.321    0.132    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 100113972876

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40