Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_321155147551361367079e-97
PPTG_17126147551361366304e-85
PHYRA_95903147551341336151e-82
PHYCA_11834147551341336132e-82
PHYKE_8392147551381386099e-82
PHALS_06479147551361366081e-81
PITG_18455147551321305992e-80
HYAP_07103147551641645353e-70
PYVX_18180147551351364527e-58
PYAP_17747147551341344083e-51
PYIW_19970147551301223528e-43
PYU1_G001736147551231253474e-42
CCA17542147551201213457e-42
CCI44820147551231243258e-39
PYIR_13454147551291273137e-37
H257_06293147551231232972e-34
SDRG_01782147551231222954e-34
H310_09224147551231232945e-34
SPRG_06335147551231222875e-33
PHALS_115641114710766961e-04
PITG_137391114710566952e-04
PHYSO_3150171114710950952e-04
HYAP_084991114710866952e-04
PYU1_G0059631114710360933e-04
HYAP_085006526017266963e-04
PPTG_092521114710550933e-04
PHYKE_58411114712164918e-04
PYAP_2284611147104102900.001
CCA175211114710454870.003
PYAR_232071114711260850.005
PYIW_147431114710564850.005
CCI442321114710554840.005
PHYRA_751931416310461830.009
H310_07567111479860830.009
SDRG_149121114710543830.009
SPRG_128831114710543830.010
PYIR_151861114710964830.010
PHYCA_5353801114710846820.012
PYIW_142931416310466800.026
PHYRA_816751114710650780.044
PYVX_208541114710458780.049
H257_07358111479847750.12
PHYCA_507051226447764720.17
CCA240562362427061770.18
PHYCA_5404611416310461720.30
PYVX_151505606474667750.36
SPRG_1173112822943181720.78
PHYSO_3211894996633745710.87
PYVX_18358141636254660.99
PHYSO_5143231416310461681.0
PPTG_156551416311261681.1
PYAP_195249573253737711.1
PYU1_G0016629318242883701.2
PITG_177011416310461671.5
PYIR_221473362117389683.1
PYIR_182231416310559643.4
CCI487201340311484644.6
PPTG_171541557258142655.6
PHALS_05180574949843656.3
PYU1_G0131561561313157637.2
PYAR_21749141639245627.4
CCA224011561310953628.8
PYU1_G0054094837111138649.3
PYIW_215664837112838649.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_321155

Length=137
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_321155                                                          276        9e-97
PPTG_17126                                                            247        4e-85
PHYRA_95903                                                           241        1e-82
PHYCA_11834                                                           240        2e-82
PHYKE_8392                                                            239        9e-82
PHALS_06479                                                           238        1e-81
PITG_18455                                                            235        2e-80
HYAP_07103                                                            210        3e-70
PYVX_18180                                                            178        7e-58
PYAP_17747                                                            161        3e-51
PYIW_19970                                                            140        8e-43
PYU1_G001736                                                          138        4e-42
CCA17542                                                              137        7e-42
CCI44820                                                              129        8e-39
PYIR_13454                                                            125        7e-37
H257_06293                                                            119        2e-34
SDRG_01782                                                            118        4e-34
H310_09224                                                            117        5e-34
SPRG_06335                                                            115        5e-33
PHALS_11564                                                           41.6       1e-04
PITG_13739                                                            41.2       2e-04
PHYSO_315017                                                          41.2       2e-04
HYAP_08499                                                            41.2       2e-04
PYU1_G005963                                                          40.4       3e-04
HYAP_08500                                                            41.6       3e-04
PPTG_09252                                                            40.4       3e-04
PHYKE_5841                                                            39.7       8e-04
PYAP_22846                                                            39.3       0.001
CCA17521                                                              38.1       0.003
PYAR_23207                                                            37.4       0.005
PYIW_14743                                                            37.4       0.005
CCI44232                                                              37.0       0.005
PHYRA_75193                                                           36.6       0.009
H310_07567                                                            36.6       0.009
SDRG_14912                                                            36.6       0.009
SPRG_12883                                                            36.6       0.010
PYIR_15186                                                            36.6       0.010
PHYCA_535380                                                          36.2       0.012
PYIW_14293                                                            35.4       0.026
PHYRA_81675                                                           34.7       0.044
PYVX_20854                                                            34.7       0.049
H257_07358                                                            33.5       0.12 
PHYCA_507051                                                          32.3       0.17 
CCA24056                                                              34.3       0.18 
PHYCA_540461                                                          32.3       0.30 
PYVX_15150                                                            33.5       0.36 
SPRG_11731                                                            32.3       0.78 
PHYSO_321189                                                          32.0       0.87 
PYVX_18358                                                            30.0       0.99 
PHYSO_514323                                                          30.8       1.0  
PPTG_15655                                                            30.8       1.1  
PYAP_19524                                                            32.0       1.1  
PYU1_G001662                                                          31.6       1.2  
PITG_17701                                                            30.4       1.5  
PYIR_22147                                                            30.8       3.1  
PYIR_18223                                                            29.3       3.4  
CCI48720                                                              29.3       4.6  
PPTG_17154                                                            29.6       5.6  
PHALS_05180                                                           29.6       6.3  
PYU1_G013156                                                          28.9       7.2  
PYAR_21749                                                            28.5       7.4  
CCA22401                                                              28.5       8.8  
PYU1_G005409                                                          29.3       9.3  
PYIW_21566                                                            29.3       9.6  

>PHYSO_321155
Length=136

 Score = 276 bits (707),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%), Gaps = 0/136 (0%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS
Sbjct  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60

Query  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120
            LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR
Sbjct  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120

Query  121  RQYFMDRKSGPPRPIF  136
            RQYFMDRKSGPPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PPTG_17126
Length=136

 Score = 247 bits (630),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 128/136 (94%), Gaps = 0/136 (0%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            MAEA RELRPLYKKLLRLAQSLPEPKR+ S+DQIRR+FR+HGDLTDP+ VSALIQRAQSS
Sbjct  1    MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSS  60

Query  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120
            LSYLKIVTPR ESN GVQR+IYRNGQRVNA EFE KGEENAR+KTQD+E GL+RHHQLLR
Sbjct  61   LSYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLR  120

Query  121  RQYFMDRKSGPPRPIF  136
            RQYF+DRKSGPPRPIF
Sbjct  121  RQYFLDRKSGPPRPIF  136

>PHYRA_95903
Length=134

 Score = 241 bits (615),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)

Query  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63
            AARELRPLYKKLLRLAQSLPEPKR+QSLDQIRREFRSH +LTDP+ VSALIQRAQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61

Query  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123
            LKIVTPR ESN G+QR+IYRNGQRVNA E EA GEENARYKTQDIE GLKRHHQLLRRQ+
Sbjct  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121

Query  124  FMDRKSGPPRPIF  136
            FMDRKSGPPRPIF
Sbjct  122  FMDRKSGPPRPIF  134

>PHYCA_11834
Length=134

 Score = 240 bits (613),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 124/133 (93%), Gaps = 0/133 (0%)

Query  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63
            AARELRPLYKKLLRLAQSLPEPKR+ S+DQIRREFRSH DLTDP+ VS L+QRAQSSL Y
Sbjct  2    AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGY  61

Query  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123
            LKIVTPR ESNTGVQRFIYR+G+RVNA E E KGEENAR+KTQD+EAGLKRHHQLLRRQY
Sbjct  62   LKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQY  121

Query  124  FMDRKSGPPRPIF  136
            FMDRKSGPPRPIF
Sbjct  122  FMDRKSGPPRPIF  134

>PHYKE_8392
Length=138

 Score = 239 bits (609),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 2/138 (1%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            MAEAARELRPLYKKLLR+AQ+LPEPKR QSL QIRREFR+HGDL+DP+ VS L+Q AQSS
Sbjct  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS  60

Query  61   LSYLKIVTPRGE--SNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQL  118
            LSYLKIVTPR E  SN+GVQR+IYRNGQRVNAAE E KGEENARYKTQD+EAGLKRHHQL
Sbjct  61   LSYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120

Query  119  LRRQYFMDRKSGPPRPIF  136
            +RRQ+FMDRKSGPPRP+F
Sbjct  121  MRRQHFMDRKSGPPRPMF  138

>PHALS_06479
Length=136

 Score = 238 bits (608),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 123/136 (90%), Gaps = 0/136 (0%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            M+ A RELRPLYKKLLRLAQ+LP+ KR+ S+DQIRREFR H DLTDP+ VS  IQRAQSS
Sbjct  1    MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSS  60

Query  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120
            LSYLKI+TPR ESNTGVQRFIYRNGQRVNAA+FE KG ENAR+KTQD+EAG KRHHQLLR
Sbjct  61   LSYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLR  120

Query  121  RQYFMDRKSGPPRPIF  136
            RQYFMDRKSGPPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 235 bits (599),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)

Query  7    ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKI  66
            ELRPLYKKLLRLAQSLPEPKR+ S+DQIRR+FRSHGD TDP+ VSALIQRAQSSLSYLKI
Sbjct  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62

Query  67   VTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126
            VTPR ESNTGVQR+IYRNGQRVNAAEFE KG ENAR+K QD+E GLKRHHQLL+RQYFM+
Sbjct  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122

Query  127  RKSGPPRPIF  136
            RKSGPPRPIF
Sbjct  123  RKSGPPRPIF  132

>HYAP_07103
Length=164

 Score = 210 bits (535),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 123/164 (75%), Gaps = 35/164 (21%)

Query  8    LRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIV  67
            +RPLYKKLLRLAQSLPEPKR++SLDQIRREFR HGDLTDP+ VS+L+QRAQSS+ +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  68   TPRGES-----------------------------------NTGVQRFIYRNGQRVNAAE  92
            TPR ES                                   +TG+QRF+YR+G+R++AAE
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  93   FEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRKSGPPRPIF  136
             + KGEENARYKTQDIEAG+KRHHQLLRRQ+FMDRKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 178 bits (452),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 109/136 (80%), Gaps = 1/136 (1%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            MA  A ELRPLYKKLLRLAQSLPEPKR  ++ QIR EFRSH ++TD   V+ L+QRAQS 
Sbjct  1    MASPA-ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQ  59

Query  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120
            L YLKIVTPRG S +GV+R+IYRNGQRV+A   EA GE+ ARYKT D+E  LKRHHQLLR
Sbjct  60   LGYLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLR  119

Query  121  RQYFMDRKSGPPRPIF  136
            RQ+FMDR   PPRPIF
Sbjct  120  RQHFMDRGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 161 bits (408),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 2/134 (1%)

Query  4    AARELRPLYKKLLRLAQSLP-EPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLS  62
            A  ELRPLYK+LLRLA+SLP E KRE ++ QIR EFRS  D  DP+ V+AL+QRAQ+ + 
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  63   YLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQ  122
            YLKIVTPR  ++ GV+ F+Y NG+RV++++ + + EE ARYKT D E  ++RH+QLLRRQ
Sbjct  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQ  120

Query  123  YFMDRKSGPPRPIF  136
            +FMDR   PP+PIF
Sbjct  121  HFMDRGVAPPKPIF  134

>PYIW_19970
Length=130

 Score = 140 bits (352),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 94/122 (77%), Gaps = 3/122 (2%)

Query  7    ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKI  66
            +LRP+YKKLL+LA++LPE KRE +  QIR EFRS  +L+DP+ ++AL+ RAQSS+SYLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  67   VTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126
            VTPR  S+ GV+ +IY+NGQRV AA   A  E+ A+Y+  D    + RH +LLRRQ+FMD
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAA---AVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  127  RK  128
            RK
Sbjct  129  RK  130

>PYU1_G001736
Length=123

 Score = 138 bits (347),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 95/125 (76%), Gaps = 3/125 (2%)

Query  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63
            A+ +LRP+YKKLL+LAQ+LP  KR+ +++QIRREFR+H    DP+ ++AL+ RAQSS+ Y
Sbjct  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61

Query  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123
            LKIVTPR  S+ GV+ ++Y  G+RV AA      E+ ARYKT D  A ++RH QLLRRQ+
Sbjct  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAA---EDGARYKTADYNAQMQRHVQLLRRQH  118

Query  124  FMDRK  128
            FMDRK
Sbjct  119  FMDRK  123

>CCA17542
Length=120

 Score = 137 bits (345),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 91/121 (75%), Gaps = 3/121 (2%)

Query  7    ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKI  66
            + R +YK+L+RLA+SLP  K+  +L  IR EFR H D++DP  +S L++RAQS++ YLKI
Sbjct  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62

Query  67   VTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126
            VTP   S++GV+RF++++G+R+   E   K  E AR+K QDI  GLKRHHQLLRRQ+FMD
Sbjct  63   VTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119

Query  127  R  127
            R
Sbjct  120  R  120

>CCI44820
Length=123

 Score = 129 bits (325),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63
            A  E R ++KK+++LA+SLP  K+  +L  IR EFR H D+ DP  ++ L++RAQS++ Y
Sbjct  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62

Query  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123
            LKIVTP   S++GV+ F+Y++G+R+   E   +  E A++K QD+E GLKRH+QL+RRQY
Sbjct  63   LKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQY  119

Query  124  FMDR  127
            FMDR
Sbjct  120  FMDR  123

>PYIR_13454
Length=129

 Score = 125 bits (313),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 3/127 (2%)

Query  2    AEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSL  61
            A A  +LRP+YKKLL+LA++LPE KR+ +L QIR EFR+  D++DP+ ++AL+ RAQSS+
Sbjct  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65

Query  62   SYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRR  121
             YLKIVTPR  S+ GV+ +IY+NGQRV A       E+ A+Y   D  A ++RH +LLRR
Sbjct  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRR  122

Query  122  QYFMDRK  128
            Q+FMDRK
Sbjct  123  QHFMDRK  129

>H257_06293
Length=123

 Score = 119 bits (297),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 87/123 (71%), Gaps = 2/123 (2%)

Query  6    RELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLK  65
            + +R  YKKL++LAQSLP  ++  +LD+IR +FRS G ++  E +  L+ +AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62

Query  66   IVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFM  125
            IVTP+    +G QRFIY++G+R+++   +  G  N   KT D+ A ++RH +L+RRQ+FM
Sbjct  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  126  DRK  128
            DRK
Sbjct  121  DRK  123

>SDRG_01782
Length=123

 Score = 118 bits (295),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query  8    LRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIV  67
            +R  YKKLL+LA+S+P+ +R Q+L+++R EFR+H     PE +  L+++AQS +SYLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TP-RGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126
            TP +  S+T    F+Y+NGQR++  E  A   ++A  KT D  A + +H QL+RRQ+FMD
Sbjct  65   TPKKSSSSTQGSHFVYKNGQRIDGRELSA---DSATIKTHDYNAMMTKHVQLVRRQHFMD  121

Query  127  RK  128
            RK
Sbjct  122  RK  123

>H310_09224
Length=123

 Score = 117 bits (294),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 85/123 (69%), Gaps = 2/123 (2%)

Query  6    RELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLK  65
            + +R  YKKL++LAQSLP  ++  +LD++R EFRSHG +T  + +  ++ +AQS +SYLK
Sbjct  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62

Query  66   IVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFM  125
            IVTP+    T  QR+IY++G+R++    +     NA  KT D  A ++RH +L+RRQ+FM
Sbjct  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  126  DRK  128
            DRK
Sbjct  121  DRK  123

>SPRG_06335
Length=123

 Score = 115 bits (287),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 85/122 (70%), Gaps = 4/122 (3%)

Query  8    LRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIV  67
            +R  YKKLL+LA+S+P+ +R Q+L+++R EFR+H     PE +  L+++AQS +SYLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  68   TPRGESNTGV-QRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMD  126
            TP+   + G    F+Y+NGQR++  E  A   ++A  KT D  A + +H QL+RRQ+FMD
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMD  121

Query  127  RK  128
            RK
Sbjct  122  RK  123

>PHALS_11564
Length=107

 Score = 41.6 bits (96),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (58%), Gaps = 1/66 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
           MAE  + LR +Y++LL+LAQ  P  KRE  +  I+ EF ++  +TD + +   +  A + 
Sbjct  1   MAETKQVLR-VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAG  59

Query  61  LSYLKI  66
           +  L +
Sbjct  60  IKELSM  65

>PITG_13739
Length=105

 Score = 41.2 bits (95),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (61%), Gaps = 1/66 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
           MAE  RE+  +Y+++L+LAQ  P  KRE  +  I+ EF ++ DLTD + +   +   ++ 
Sbjct  1   MAET-REVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAG  59

Query  61  LSYLKI  66
           ++ L +
Sbjct  60  ITELSM  65

>PHYSO_315017
Length=109

 Score = 41.2 bits (95),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGV  50
           MAE    LR +Y+++L+LAQ  P  KRE  +  I+ EF ++ DLTD + +
Sbjct  1   MAETKEVLR-MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKI  49

>HYAP_08499
Length=108

 Score = 41.2 bits (95),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 40/66 (61%), Gaps = 1/66 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
           MAEA   LR +Y+++L+LAQ  P  KR+  +  I+ EFR++ +L+D + V   +   Q+ 
Sbjct  1   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  59

Query  61  LSYLKI  66
           +  L +
Sbjct  60  IKELSM  65

>PYU1_G005963
Length=103

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  5   ARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64
           A+E+  +Y+++L+LA   P  KR   +  I+ EFR +  LTD   + A +Q A+  +  L
Sbjct  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63

>HYAP_08500
Length=172

 Score = 41.6 bits (96),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 40/66 (61%), Gaps = 1/66 (2%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            MAEA   LR +Y+++L+LAQ  P  KR+  +  I+ EFR++ +L+D + V   +   Q+ 
Sbjct  65   MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAG  123

Query  61   LSYLKI  66
            +  L +
Sbjct  124  IKELSM  129

>PPTG_09252
Length=105

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGV  50
           MAE    LR LY+++L+LAQ  P  KRE  +  I+ EF ++ +LTD + +
Sbjct  1   MAETKEVLR-LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKI  49

>PHYKE_5841
Length=121

 Score = 39.7 bits (91),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 38/64 (59%), Gaps = 1/64 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
           MAE  +E+  +Y+++L+LAQ  P  KR+  +  I+ EF +H  LTD + +   +  A++ 
Sbjct  1   MAEV-KEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAG  59

Query  61  LSYL  64
           +  L
Sbjct  60  IKEL  63

>PYAP_22846
Length=104

 Score = 39.3 bits (90),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 4/102 (4%)

Query  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
            MA+  + LR LY+ +L+LA+  P  KR+  +  I+ EF      TD   +   I  AQ+ 
Sbjct  1    MADKQKVLR-LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAG  59

Query  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENAR  102
            +  L +      S+T    +    G+ V+    +A G+ N +
Sbjct  60   IKELSMYATLNPSSTA---WTVGVGREVSPEATQAAGDTNTK  98

>CCA17521
Length=104

 Score = 38.1 bits (87),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64
           LY+++LRLA+  P  KR+  ++ IR EFR   D+T    +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PYAR_23207
Length=112

 Score = 37.4 bits (85),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  5   ARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64
           +RE+  LY+++L+LA+  P  KR+  ++ I+ EF     LTD   +   I  AQ+ +  L
Sbjct  7   SREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PYIW_14743
Length=105

 Score = 37.4 bits (85),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 1/64 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
           MAEA +E+  LY+++L+LA   P  KR   + +I+ EF  +  LTD   +   +Q A+  
Sbjct  1   MAEA-KEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQG  59

Query  61  LSYL  64
           +  L
Sbjct  60  IVEL  63

>CCI44232
Length=105

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  11  LYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64
           LY+++LRLA+  P  KR+  ++ IR EFR   ++  P  +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>PHYRA_75193
Length=104

 Score = 36.6 bits (83),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 34/61 (56%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP-EPKREQSL-DQIRREFRSHGDLTDPEGVSALIQRAQSSLS-YLKIV  67
           LY+  +RLAQ +    K+ Q++ D +RREF    D TDPE V AL   A   LS YL + 
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANAIRGLSNYLMLA  73

Query  68  T  68
            
Sbjct  74  N  74

>H310_07567
Length=98

 Score = 36.6 bits (83),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 4/60 (7%)

Query  11  LYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDP----EGVSALIQRAQSSLSYLKI  66
           +Y+++L+LA+  P  KR+Q ++ I+ EF  +  LTDP    E V+  I+  Q    Y+ +
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQLNQYVSL  69

>SDRG_14912
Length=105

 Score = 36.6 bits (83),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (63%), Gaps = 0/43 (0%)

Query  4   AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTD  46
           A R +  +Y+++L+LAQ  P  K++Q +  I+ EF  +  LTD
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTD  44

>SPRG_12883
Length=105

 Score = 36.6 bits (83),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (63%), Gaps = 0/43 (0%)

Query  4   AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTD  46
           A R +  +Y+++L+LAQ  P  K++Q +  I+ EF  +  LTD
Sbjct  2   AGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTD  44

>PYIR_15186
Length=109

 Score = 36.6 bits (83),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 37/64 (58%), Gaps = 1/64 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60
           MAEA +E+  +Y+++L+LA   P  KR   + +I+ EF ++  LTD   +   +Q A+  
Sbjct  1   MAEA-KEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQG  59

Query  61  LSYL  64
           +  L
Sbjct  60  IVEL  63

>PHYCA_535380
Length=108

 Score = 36.2 bits (82),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (61%), Gaps = 1/46 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTD  46
           MAE    LR +Y+++L+LA   P  KRE  +  I+ EF ++  LTD
Sbjct  1   MAETKEVLR-MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTD  45

>PYIW_14293
Length=104

 Score = 35.4 bits (80),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  2   AEAARELRPLYKKLLRLAQSLPEPKREQSL--DQIRREFRSHGDLTDPEGVSALIQRAQS  59
           A+ +R    LY+  +RLA+ +    ++ S   D IRREF    D TDPE + AL   A  
Sbjct  4   AQVSRTSIQLYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEALKTNAIR  63

Query  60  SLS-YL  64
            LS YL
Sbjct  64  GLSNYL  69

>PHYRA_81675
Length=106

 Score = 34.7 bits (78),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGV  50
           MAE    +R +Y+++L+LAQ  P  KR   +  I+ EF ++  LTD + +
Sbjct  1   MAETKEVVR-MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKI  49

>PYVX_20854
Length=104

 Score = 34.7 bits (78),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 33/58 (57%), Gaps = 0/58 (0%)

Query  7   ELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYL  64
           E+  LY+++L+LAQ  P  KR+  +  I+ EF  +  L+D + V   I  A++ +  L
Sbjct  6   EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>H257_07358
Length=98

 Score = 33.5 bits (75),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 0/47 (0%)

Query  11  LYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRA  57
           +Y+++L+LA   P  K++Q +  I+ EF  +  LTDP  +   I  A
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIA  56

>PHYCA_507051
Length=77

 Score = 32.3 bits (72),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 4/64 (6%)

Query  1   MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRRE---FRSHGDLTDPEGVSALIQRA  57
           +A+A R  R LY++LLR ++ L EP   +   +  R    F SH +  DPE V + I+R 
Sbjct  5   LAQAQRNSRSLYRRLLRESRQL-EPNTREFYRRFARSVQGFPSHANDKDPEAVQSHIRRV  63

Query  58  QSSL  61
           +  +
Sbjct  64  EQDI  67

>CCA24056
Length=4270

 Score = 34.3 bits (77),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (48%), Gaps = 4/61 (7%)

Query  60    SLSYLKIVTPRGESNTGVQRFI----YRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRH  115
             S+  L +V P+ ES   V   +    YR G R++A +     ++N R K+ D E     H
Sbjct  2039  SMEQLSMVVPKQESKDSVDEILGPVRYREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFH  2098

Query  116   H  116
             H
Sbjct  2099  H  2099

>PHYCA_540461
Length=104

 Score = 32.3 bits (72),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP-EPKREQSL-DQIRREFRSHGDLTDPEGVSALIQRAQSSLS-YLKIV  67
           LY+  LRLA+ +    K+ Q++ D +RREF      TDPE + AL   A   LS YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  68  T  68
            
Sbjct  74  N  74

>PYVX_15150
Length=746

 Score = 33.5 bits (75),  Expect = 0.36, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 34/67 (51%), Gaps = 4/67 (6%)

Query  18   LAQSLPEPKR--EQSLDQIRREFRSHGDLTDPEGVSALIQ--RAQSSLSYLKIVTPRGES  73
            LA+ L  P     Q++      FRS  D ++   V  +++  R+  SL YL +V PR + 
Sbjct  592  LAKELARPSSLVAQNVLCWSYSFRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQH  651

Query  74   NTGVQRF  80
            +  ++RF
Sbjct  652  DASLERF  658

>SPRG_11731
Length=431

 Score = 32.3 bits (72),  Expect = 0.78, Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query  2    AEAARELRPLYKKLLRLAQSLPE--PKREQSLDQIRRE--FRSHGDLTDPEGVSALIQRA  57
            ++A +  RPL K  L L   L +  PK+  + +Q  +   FRSH  L DP  VS  I   
Sbjct  294  SKAEKRKRPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPHLQDPATVSTWIPTI  353

Query  58   QSSLSYLKIVTPRGESNTGVQ  78
             S+ S  ++ T + +  +G Q
Sbjct  354  TSA-SCHEMATRKAKKESGAQ  373

>PHYSO_321189
Length=337

 Score = 32.0 bits (71),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 26/45 (58%), Gaps = 0/45 (0%)

Query  63   YLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQD  107
            Y  I+   G ++  +++F+YR+G   N  E +  GEE+  ++ +D
Sbjct  49   YETIIQHAGAADPAMKQFVYRSGLIQNFPEIDTSGEEDKAFENKD  93

>PYVX_18358
Length=62

 Score = 30.0 bits (66),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 27/54 (50%), Gaps = 2/54 (4%)

Query  11  LYKKLLRLAQSL--PEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLS  62
           LY+  LRLA+ +     K E   + +RREF      TDPE + AL   A   LS
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEALKANAIRGLS  54

>PHYSO_514323
Length=104

 Score = 30.8 bits (68),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP-EPKREQSLDQ-IRREFRSHGDLTDPEGVSALIQRAQSSLS-YLKIV  67
           LY+  +RLA+ +    K+ Q++ + +RREF      TDPE + AL   A   LS YL + 
Sbjct  14  LYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  68  T  68
            
Sbjct  74  N  74

>PPTG_15655
Length=112

 Score = 30.8 bits (68),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP-EPKREQSLDQ-IRREFRSHGDLTDPEGVSALIQRAQSSLS-YLKIV  67
           LY+  LRLA+ +    K+ Q++ + +RREF      TDPE + AL   A   LS YL + 
Sbjct  22  LYRDCLRLAKHIGGNSKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  81

Query  68  T  68
            
Sbjct  82  N  82

>PYAP_19524
Length=537

 Score = 32.0 bits (71),  Expect = 1.1, Method: Composition-based stats.
 Identities = 14/37 (38%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  87   RVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123
            R+ A +  AKG + A      I++G++  H+LLRR Y
Sbjct  163  RIGAPKLWAKGVDGAGITVGSIDSGVRVTHELLRRNY  199

>PYU1_G001662
Length=428

 Score = 31.6 bits (70),  Expect = 1.2, Method: Composition-based stats.
 Identities = 23/83 (28%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query  50   VSALIQ-RAQSSLSYLKIVTPRGESN-TGVQRFIYRNG----QRVNAAEFEAKGEENARY  103
            +S++++ R +S L   K++   G+SN T    F+        Q+V A E  AKG      
Sbjct  85   ISSIVEIREESVLELPKMLAANGQSNSTNFAAFVTNPSAWGIQKVQAPELWAKGTTGQNI  144

Query  104  KTQDIEAGLKRHHQLLRRQYFMD  126
                I++G++  H+ LR  +  D
Sbjct  145  VVGVIDSGVRGTHEALRDNFVGD  167

>PITG_17701
Length=104

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  11  LYKKLLRLAQSLP-EPKREQSL-DQIRREFRSHGDLTDPEGVSALIQRAQSSLS-YLKIV  67
           LY+  LRLA+ +    K+ Q++ + +RREF      TDPE + AL   A   LS YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIRELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  68  T  68
            
Sbjct  74  N  74

>PYIR_22147
Length=1173

 Score = 30.8 bits (68),  Expect = 3.1, Method: Composition-based stats.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 4/89 (4%)

Query  44   LTDPEGVSALIQRAQSSLSYLKIVTPRGESNTGVQRFIYRNG-QRVNAAEFEAKGEENAR  102
            L D      L QRA+S ++ L++ T    +  G      RN   + +  +  A   +NA+
Sbjct  568  LADTRAEKVLAQRAKSQVNILEVYTSYSSTMKGHPSGCLRNSFLKSHVRDCPACAGQNAQ  627

Query  103  YKTQDIEAGLKRHHQLLRRQYFMDRKSGP  131
                 + +G+  H  +L RQ+    KSGP
Sbjct  628  EGQCGLHSGMSFHKPVLERQF---SKSGP  653

>PYIR_18223
Length=105

 Score = 29.3 bits (64),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 32/59 (54%), Gaps = 7/59 (12%)

Query  11  LYKKLLRLAQSLPEPKRE----QSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLS-YL  64
           LY+  +RLA+ +    ++    +SL  +RREF    D TDPE + AL   A   LS YL
Sbjct  14  LYRDCMRLAKHIGGKSKKGIAIKSL--VRREFEKARDETDPEKIEALKTNAIRGLSNYL  70

>CCI48720
Length=114

 Score = 29.3 bits (64),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 20/84 (24%), Positives = 36/84 (43%), Gaps = 0/84 (0%)

Query  12   YKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIVTPRG  71
            Y++  R+   LP   R     QIR EF +   + + E +  L++  +  L Y+  +    
Sbjct  21   YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQLKYVSSLVDTA  80

Query  72   ESNTGVQRFIYRNGQRVNAAEFEA  95
             S    +R + RN +  N    +A
Sbjct  81   VSKQHQKRKVNRNPEHTNGQGVDA  104

>PPTG_17154
Length=581

 Score = 29.6 bits (65),  Expect = 5.6, Method: Composition-based stats.
 Identities = 13/42 (31%), Positives = 21/42 (50%), Gaps = 0/42 (0%)

Query  66   IVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQD  107
            I+   G  +T  ++FI+R G   N  E +   E+   +K QD
Sbjct  267  IIRHAGAEDTNTKQFIFRAGLAANFPEVDTSAEDGKTFKNQD  308

>PHALS_05180
Length=498

 Score = 29.6 bits (65),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 21/43 (49%), Gaps = 9/43 (21%)

Query  93   FEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRKSGPPRPI  135
            F AKG +  R K   IE+ LKR H         D K+ PPR +
Sbjct  126  FVAKGRDRKRRKVDVIESALKRFH---------DEKADPPRCV  159

>PYU1_G013156
Length=131

 Score = 28.9 bits (63),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 30/57 (53%), Gaps = 1/57 (2%)

Query  6   RELRPLYKKLLRLAQSLPE-PKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSL  61
           R++  LY + LR A+  P+  +RE     ++ +FR   D+ DP  +  L+  A+  L
Sbjct  9   RQVLGLYAQCLRSARKCPQWEQREMMKAYVKMKFRHDADVQDPARIQRLLADAREEL  65

>PYAR_21749
Length=92

 Score = 28.5 bits (62),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (58%), Gaps = 2/45 (4%)

Query  11  LYKKLLRLAQSLP-EPKREQSL-DQIRREFRSHGDLTDPEGVSAL  53
           LY+  +RLA+ +    K+ Q++ D IRREF      TDPE +  L
Sbjct  14  LYRDCMRLAKHIGGTSKKGQAIRDLIRREFDKGRSETDPEKIEML  58

>CCA22401
Length=109

 Score = 28.5 bits (62),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (2%)

Query  11  LYKKLLRLAQSLPEPK-REQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLS  62
           LY+  LR A+  PE + RE     I+ +FR    L DP  +  L++     L 
Sbjct  8   LYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDPRAIKLLLREGNEELD  60

>PYU1_G005409
Length=1111

 Score = 29.3 bits (64),  Expect = 9.3, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 0/38 (0%)

Query  9    RPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTD  46
            +P YKK  R  Q L      Q LD +RR + S G++ D
Sbjct  303  QPKYKKGQRPPQKLFSANMAQGLDVVRRRYPSTGEMLD  340

>PYIW_21566
Length=1128

 Score = 29.3 bits (64),  Expect = 9.6, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 0/38 (0%)

Query  9    RPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTD  46
            +P YKK  R  Q L      Q LD +RR   S GD+ D
Sbjct  344  QPKYKKGQRPPQKLFSTNMSQGLDVVRRRHPSTGDMLD  381

Lambda      K        H        a         alpha
   0.322    0.137    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3490505892

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40