Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_29655271351356972e-95
PHYKE_572173171374582e-56
PPTG_1667372581354174e-51
PITG_0000974181162331e-22
PYVX_1587378546552741433e-10
PYIW_2348983681235691291e-08
PYIR_2121783681393681124e-06
PYU1_G00322483681369741019e-05
SDRG_0805613632161036720.81
PYAR_222561390140375682.3
PHYKE_44045448729178673.1
PYU1_G004446897171360673.2
PYIW_1570112322176165673.6
PYVX_15781418450469647.8
PITG_038603389512963648.2
H257_0820514172256551649.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_296552

Length=136
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_296552                                                          273        2e-95
PHYKE_5721                                                            181        2e-56
PPTG_16673                                                            165        4e-51
PITG_00009                                                            94.4       1e-22
PYVX_15873                                                            59.7       3e-10
PYIW_23489                                                            54.3       1e-08
PYIR_21217                                                            47.8       4e-06
PYU1_G003224                                                          43.5       9e-05
SDRG_08056                                                            32.3       0.81 
PYAR_22256                                                            30.8       2.3  
PHYKE_4404                                                            30.4       3.1  
PYU1_G004446                                                          30.4       3.2  
PYIW_15701                                                            30.4       3.6  
PYVX_15781                                                            29.3       7.8  
PITG_03860                                                            29.3       8.2  
H257_08205                                                            29.3       9.6  

>PHYSO_296552
Length=135

 Score = 273 bits (697),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%), Gaps = 0/135 (0%)

Query  1    MKKLVNNVDISATNRGGSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDL  60
            MKKLVNNVDISATNRGGSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDL
Sbjct  1    MKKLVNNVDISATNRGGSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDL  60

Query  61   PEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPIKP  120
            PEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPIKP
Sbjct  61   PEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPIKP  120

Query  121  TLVSNMPPLFAPRFG  135
            TLVSNMPPLFAPRFG
Sbjct  121  TLVSNMPPLFAPRFG  135

>PHYKE_5721
Length=317

 Score = 181 bits (458),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 104/137 (76%), Gaps = 8/137 (6%)

Query  1    MKKLVNNVDISATNRG--GSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGD  58
            M+K+ N    +A  RG  GS RIA+LS G    CS  SDEDILAEIWA RSP  DG + D
Sbjct  170  MQKIANK---AARQRGSSGSNRIALLSAGV---CSIASDEDILAEIWASRSPSCDGIADD  223

Query  59   DLPEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPI  118
            DLPEVD++ S++APMEF+FF+GCPDD+NLR LDVGYRR RSN RA R P T SYAT++PI
Sbjct  224  DLPEVDEDFSQSAPMEFVFFTGCPDDRNLRELDVGYRRHRSNTRAARCPSTSSYATTIPI  283

Query  119  KPTLVSNMPPLFAPRFG  135
            KPTLVS MPPLF PR G
Sbjct  284  KPTLVSKMPPLFVPRLG  300

>PPTG_16673
Length=258

 Score = 165 bits (417),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 98/135 (73%), Gaps = 4/135 (3%)

Query  1    MKKLVNNVDISATNRGGS-GRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDD  59
            M+KL    D S   RGGS  RIA+LS  TVSDCS  SD++ILAEIWAMRS  +   S + 
Sbjct  127  MQKLAKKSDRSVRERGGSCNRIALLSTTTVSDCSVMSDQEILAEIWAMRSSSMGRVSDES  186

Query  60   LPEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPIK  119
            +P VDD+L++TAPMEFLFF+GCPDD +   LDV +RR RS  R  RY  TPS+ T+VP+K
Sbjct  187  MPVVDDKLADTAPMEFLFFTGCPDDNS---LDVRHRRARSKARLARYSATPSFTTTVPVK  243

Query  120  PTLVSNMPPLFAPRF  134
             TLVSNMPPLF PRF
Sbjct  244  STLVSNMPPLFVPRF  258

>PITG_00009
Length=418

 Score = 94.4 bits (233),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (63%), Gaps = 4/116 (3%)

Query  2    KKLVNNVDISATNRGGS-GRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDL  60
            +KL      S   RG S  RIA+LS  +V DCS TS+E+ILAEIWAMRS      S +D+
Sbjct  300  QKLARKSHRSLRERGSSSNRIALLSASSVYDCSITSNEEILAEIWAMRSSFTAQVSDEDV  359

Query  61   PEVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSV  116
               DD+ + +AP+EFLFF GCPDD +    ++GY R R   R+ R   TPS+AT++
Sbjct  360  SAADDKAASSAPIEFLFFMGCPDDSS---REIGYLRARPKSRSARNTATPSFATAI  412

>PYVX_15873
Length=552

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 0/74 (0%)

Query  62   EVDDELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPIKPT  121
            + DD     APMEFLFFSGCPDD NL  L++   R R +  +       S + +  ++ +
Sbjct  179  QWDDREEWPAPMEFLFFSGCPDDSNLYRLEMNQHRRRPDAVSREAADRGSASDAAFLRRS  238

Query  122  LVSNMPPLFAPRFG  135
            LV +MPP+FAPR  
Sbjct  239  LVYDMPPVFAPRLN  252

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 50/103 (49%), Gaps = 8/103 (8%)

Query  41   LAEIWAMRSPRLDGASGDDLPEVDDELSETAP--MEFLFFSGCPDDKNLRVLDVGYRRLR  98
            L+E W      +    G D+     +L  + P  MEFLFF  CPDD  +  L++   R R
Sbjct  447  LSESWESLEASILTTQGSDMSARFSDLRASGPEPMEFLFFPSCPDDLVVNTLEINQFRRR  506

Query  99   SNPRA--TRYPVTPSYAT----SVPIKPTLVSNMPPLFAPRFG  135
            +N  +        PS AT    S+ +  TLV++MPPLF PR  
Sbjct  507  ANIASGGATAQSEPSAATSDLDSIRVGRTLVTDMPPLFTPRLS  549

>PYIW_23489
Length=235

 Score = 54.3 bits (129),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 40/69 (58%), Gaps = 9/69 (13%)

Query  73   MEFLFFSGCPD-DKNLRVLDVGYRRLR-------SNPRATRYPVTPSYATSVPIKPTLVS  124
            MEFLFF G PD D NL  L+VG+RR +       ++  A+ YP   S   S+ I PTLV 
Sbjct  163  MEFLFFGGSPDADSNLNELEVGHRRFQPHRIDYYNSSAASEYP-RESCTVSIKINPTLVR  221

Query  125  NMPPLFAPR  133
            NMP  F PR
Sbjct  222  NMPRPFNPR  230

>PYIR_21217
Length=393

 Score = 47.8 bits (112),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 35/68 (51%), Gaps = 6/68 (9%)

Query  73   MEFLFFSGCPDDKNLRVLDVGYRRLR------SNPRATRYPVTPSYATSVPIKPTLVSNM  126
            MEFLFF G  DD NL  L+VG+ +        ++  A R     S   ++ + PTLV NM
Sbjct  322  MEFLFFGGSVDDYNLNCLEVGHHQFEPDTTAITSNTAERDFQKDSSLITIKVNPTLVHNM  381

Query  127  PPLFAPRF  134
            P  F PR 
Sbjct  382  PRPFNPRM  389

>PYU1_G003224
Length=369

 Score = 43.5 bits (101),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 12/74 (16%)

Query  73   MEFLFFSGCPDDK--NLRVLDVGYR-RLRSNPRATR---------YPVTPSYATSVPIKP  120
            +EFLFF G PD+   +L  L+VG+R R+ +   AT          Y    S   ++ I P
Sbjct  292  LEFLFFGGNPDESESSLMQLEVGHRSRIMNFQTATAPAFANPPADYSAADSRTNAIKINP  351

Query  121  TLVSNMPPLFAPRF  134
            TLV NMP  F P F
Sbjct  352  TLVRNMPRPFVPTF  365

>SDRG_08056
Length=610

 Score = 32.3 bits (72),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 23/36 (64%), Gaps = 0/36 (0%)

Query  83   DDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSVPI  118
            D K L VLDV   R+   P  T +P++P++A +VP+
Sbjct  571  DAKRLVVLDVKSWRIFMIPVDTMHPISPAFAAAVPL  606

>PYAR_22256
Length=403

 Score = 30.8 bits (68),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (47%), Gaps = 3/75 (4%)

Query  58   DDLPEVDDEL-SETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYPVTPSYATSV  116
            D++    DE+ S    ++ L    C D K LR+ D+ +   R   R+TR  +T  +AT +
Sbjct  303  DNVALTQDEVQSFEVLLQVLKLEYCVDHKQLRIFDIHHP--RHATRSTRGSLTHGHATHL  360

Query  117  PIKPTLVSNMPPLFA  131
                TL + +    A
Sbjct  361  VTSTTLCNLLFEFLA  375

>PHYKE_4404
Length=291

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 32/78 (41%), Gaps = 12/78 (15%)

Query  57   GDDLPEVDDELS-ETAPMEFLFFSGCPDDKNLRVLDVGYRRLR----SNPRA-TRYPVTP  110
            G  +P VD   S   APM      G      LR L V   RLR    S P A +   V P
Sbjct  177  GATMPAVDSPASAHAAPM------GAEMAAQLRALQVEAERLRAMVASQPHAPSPTAVAP  230

Query  111  SYATSVPIKPTLVSNMPP  128
            S+ +S P  P     MPP
Sbjct  231  SFVSSAPNVPNAKGEMPP  248

>PYU1_G004446
Length=713

 Score = 30.4 bits (67),  Expect = 3.2, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 30/60 (50%), Gaps = 10/60 (17%)

Query  17   GSGRIAVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDLPEVDDELSETAPMEFL  76
            G G+  +L  GT  DCS       LA      +PR +GA+GD +     EL +TA M+ L
Sbjct  594  GPGKQVLLEIGTKMDCSLEMSMKFLAT-----TPRANGAAGDVV-----ELEDTATMQKL  643

>PYIW_15701
Length=1761

 Score = 30.4 bits (67),  Expect = 3.6, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 8/65 (12%)

Query  14    NRGGSGRIAVLSPG-TVSDCSA----TSDEDILAEIWAMRSPRLD--GASGDDLPEVDDE  66
             ++GG GR+ V+S G T  D SA     +DE++L + WA R P  D  G +  D    D++
Sbjct  1481  SQGGGGRLTVVSGGATREDASAGDHDDNDEELLKKYWA-RKPDADAGGLAIQDKSIDDEQ  1539

Query  67    LSETA  71
             LS +A
Sbjct  1540  LSPSA  1544

>PYVX_15781
Length=504

 Score = 29.3 bits (64),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (45%), Gaps = 3/69 (4%)

Query  66   ELSETAPMEFLFFSGCPDDKNLRVLDVGYRRLRSNPRATRYP---VTPSYATSVPIKPTL  122
             LS  A +E   F    D   LR +D G   ++S P+AT  P    T + A +  ++  +
Sbjct  196  HLSSVAVVELKAFLQHADKTTLRPIDAGQINVQSTPQATSAPSKTQTQAEAMATTLEELM  255

Query  123  VSNMPPLFA  131
               MP  FA
Sbjct  256  RPPMPKTFA  264

>PITG_03860
Length=5129

 Score = 29.3 bits (64),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 33/63 (52%), Gaps = 14/63 (22%)

Query  72    PMEFLFFSGCPDDKNLRVLDVGYR--RLRSN----------PRATRYPVTPSYATSVPIK  119
             P+ FL F G   D  +R+ DV +R  +LRS+          P+++  P TP+ A+  P+ 
Sbjct  4101  PLSFLAFRGHLYD--IRLWDVAFRVEQLRSHYRGLDSVDVVPKSSSRPGTPTSASKRPLS  4158

Query  120   PTL  122
             P +
Sbjct  4159  PAM  4161

>H257_08205
Length=565

 Score = 29.3 bits (64),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 1/51 (2%)

Query  22   AVLSPGTVSDCSATSDEDILAEIWAMRSPRLDGASGDDLPEVDDELSETAP  72
            +V+ PG V+D SA   + ++A +W     R+    GD L    D+LS+  P
Sbjct  403  SVVKPGAVTDSSAVWMDAVVAALWNEHRMRVH-VQGDVLCRTTDDLSKKRP  452

Lambda      K        H        a         alpha
   0.320    0.138    0.416    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3387843954

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40