Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYSO_284086147522042049093e-125
PHYCA_129425147522042047991e-108
PPTG_17122147522041867931e-107
PHYKE_8389147522041837591e-102
PITG_18450147522031867549e-102
PHYRA_81106147522021657271e-97
PHYKE_8388568762051876992e-93
PHYSO_477820568762021646941e-92
PPTG_17121568762021646914e-92
PHYRA_81107568762021636862e-91
PHYSO_341599109791851666852e-91
PHYCA_14369109792481656902e-91
PHYKE_3446231281991886852e-91
PHYRA_82864231281931656843e-91
PHYCA_511409568762041636827e-91
PHYRA_85631109792281656822e-90
PPTG_10635528561991656713e-89
PHYRA_84190720132061656653e-88
PPTG_10636109792461656685e-88
PYVX_18176568762011626601e-87
PPTG_10634720132081636593e-87
PHYSO_536424606911971666575e-87
PHYSO_507031586531971666575e-87
PHYCA_102852242061951656541e-86
PPTG_15264231281941676496e-86
PPTG_17366239131941676496e-86
PHYKE_7718109792201656517e-86
PPTG_10643457052501646452e-84
PYU1_G001741854041991656383e-84
PHYCA_102550457052681656383e-83
PYU1_G001742932042131636255e-82
PYVX_18174854042041646245e-82
PHYCA_102624720131951666192e-81
PYIR_25089854042621656113e-79
PYU1_G001744568762131636056e-79
PHALS_00498109791991656012e-78
PYIR_26626147522121895986e-78
PPTG_10048213141901665932e-77
PYVX_18173449665001656062e-75
PYU1_G001740147522061635743e-74
PHYSO_499978231281741655541e-71
PHYSO_501575820771741655541e-71
PHALS_03284309411881655384e-69
PYU1_G001739932032661635254e-66
PPTG_0882086622501705211e-65
PITG_13520109791711345035e-64
PPTG_14255469372681655091e-63
PHYSO_343376532371721314983e-63
PHYCA_510817445761881684969e-63
PPTG_14254445761881664899e-62
PHYSO_254168462841701494792e-60
PYAP_22278932042891704892e-60
PHYKE_9185445762811684883e-60
PHYSO_417649445761851684793e-60
PYIW_18791854041941654752e-59
PYAR_24096932032271654703e-58
PHYSO_262732469371881674645e-58
PITG_1049986623231604757e-58
PYAP_22279854042231654642e-57
PHYCA_53693413059831665003e-57
PYAP_22273932032681654585e-56
PHYSO_341596528562311264539e-56
PHYCA_14368528562191634442e-54
PYIR_26546866052391674252e-51
PHYSO_246676457051871654177e-51
PHYSO_527908600641741544072e-49
PYU1_G001738534612261613886e-46
PPTG_17123147532011613858e-46
HYAP_07096534612511603853e-45
PHYCA_537323449662001613743e-44
PHYRA_81105534612011593641e-42
PHYSO_353401534611461393572e-42
PITG_18452147538561603875e-42
PHYSO_340369526762001653492e-40
PYIW_18788932032441633453e-39
PYAP_18131991722261113042e-33
PYIW_18792932041251012868e-32
PYVX_18179534611471642852e-31
PHYRA_78625541464341662779e-28
PHYRA_78626578954731662771e-27
PYIR_1644442341821692594e-27
PHYSO_342364529831941792596e-27
PYIR_1643542333041272649e-27
PYVX_18175147521471672495e-26
PYIW_19151831912481302549e-26
PHYCA_13036542352661772532e-25
PHYSO_438103557212381792512e-25
PYU1_G007476539131951322473e-25
PHYKE_81047713586632376e-25
PYIR_16443823992751702506e-25
PHYRA_7358242353261772528e-25
PYIW_187905687686782368e-25
PPTG_0461842353261772529e-25
PYAP_246891014392521742489e-25
PYAP_18709943552351692461e-24
PYU1_G005324845341911332412e-24
PYU1_G005326463491911332412e-24
PYU1_G00532842331911332412e-24
PHYRA_7868968382961792473e-24
PHYCA_12727044782791792445e-24
PYU1_G005325943562071312396e-24
PHYSO_48395542353201782457e-24
H310_0636217301971262388e-24
PITG_0494942353371772458e-24
PITG_0527144782781792421e-23
PYIW_27477823991801632351e-23
PYAP_18711943562101712362e-23
PITG_1981815643147622303e-23
H257_1355017302661422383e-23
PHYSO_340333526712841792393e-23
PHYSO_34033244782951792394e-23
PHYSO_533682604462781792384e-23
PYVX_14662510865401412455e-23
PHYKE_600144782891792376e-23
PHYRA_74651699693441342398e-23
PHYCA_534296526713091362371e-22
PYU1_G01469042342951272361e-22
PHYCA_12942213313531772362e-22
PYU1_G005323943552511322313e-22
PYAR_14260845342121312275e-22
PHYSO_533903604652081812266e-22
PHYKE_6002526711971682256e-22
PHYKE_10578778802391812277e-22
PHYRA_73607194343431342328e-22
PHYRA_8615172836170842221e-21
PYAR_2411397811921742231e-21
PHYRA_8794174106157842201e-21
PHALS_0317644782071372204e-21
PPTG_04622696962731342244e-21
PYAR_14256943551991302195e-21
PPTG_1422144782751792227e-21
PPTG_0750738072991822238e-21
SPRG_077961259803221782231e-20
PYU1_G007364851643161322202e-20
PHYRA_85794726192301812154e-20
PPTG_07509718142991822184e-20
PYIW_242891643031961782124e-20
PHYKE_771752856568452234e-20
PHYRA_77971705552301812145e-20
PYIR_19612831912601752156e-20
PHYKE_2809752822911232166e-20
PHYRA_7358442332871342166e-20
PHALS_0539242353671262187e-20
SDRG_165351259803131802161e-19
PPTG_04647194343271302161e-19
PYIR_23585845342401302121e-19
SPRG_19916161733051842151e-19
PITG_0494842342321232111e-19
PHYRA_73606571983661342161e-19
PPTG_03153597733141782151e-19
PHYRA_7914038074241062172e-19
PHYCA_531163194343141342142e-19
PYVX_16138786195591332182e-19
PYAP_222571003612471822112e-19
PYIW_254631650392161812092e-19
PHALS_04411944962621792112e-19
PYIR_2048117292771302122e-19
PHYSO_459106194342231342092e-19
SPRG_2216117303001842123e-19
PHYCA_534473423310501342173e-19
PHALS_03177526712591792103e-19
PPTG_0461942342761332103e-19
PYU1_G005985820772001862064e-19
PHYKE_2937571983661342134e-19
PHYKE_6077188563221322114e-19
PPTG_0462042333421342125e-19
PHYSO_48552442342781232087e-19
PYIR_2213497753001832097e-19
PHYRA_83500718143941062118e-19
PHALS_03179308833721372119e-19
PHYCA_97965401872881822081e-18
PITG_0494742332981332071e-18
PYIW_1552617302561802052e-18
PYU1_G00151997822651782052e-18
PHYCA_12943369712871822062e-18
PHYRA_7729317293021252044e-18
PHYSO_488921574612961842044e-18
SDRG_17317161731221041934e-18
PITG_1193697753331802054e-18
PHYKE_391342343211022045e-18
PHYSO_329293510323101842045e-18
PPTG_0315697874451212065e-18
PYU1_G00586817292671272025e-18
PHYSO_533747604512061781986e-18
PHYRA_8075044782751742016e-18
PHALS_0539442342881232026e-18
PHYRA_7358342346301342067e-18
PHYRA_86016727462361081997e-18
PYIW_242881643022011851977e-18
SDRG_165341259793201762038e-18
PPTG_0752038142941432028e-18
PPTG_07516464352941432019e-18
PYU1_G005866574611941811969e-18
PYIR_24421899032131361971e-17
PHYCA_98479819502761102001e-17
PYU1_G005873510322141811971e-17
SPRG_077951259793351732021e-17
PYAP_22462820772101771961e-17
PHYRA_78161375713731902012e-17
PYAP_1858417292101871952e-17
PYIR_15187820772071821952e-17
PYAP_1871342341841651932e-17
PHYRA_86752732363001081992e-17
PHYKE_1029517292921271982e-17
PYIW_2557397812791731982e-17
PHYSO_26284417292761291973e-17
PHYRA_7358169693293821983e-17
PYAR_206171040482541661963e-17
PHYRA_78176597733121761983e-17
PHYKE_607897753171831983e-17
PPTG_04803375052681341973e-17
SPRG_199171339462411411953e-17
SDRG_075651244122781801964e-17
PHYSO_484051571982851291964e-17
PPTG_0316097913791371994e-17
SDRG_081371363342821791964e-17
SDRG_173181339462411781944e-17
CCI4738117292111371934e-17
PHYSO_524101597733081321974e-17
PHYCA_69583463492241311934e-17
PYIW_2196497752651841954e-17
SDRG_0878217304501841994e-17
PYU1_G001514188574691221986e-17
PPTG_18166242064451851986e-17
PHYKE_1913732362801801956e-17
SPRG_077971259813181321967e-17
PPTG_03138188562941821957e-17
PHYRA_83494464352241111927e-17
SDRG_081291363312181801919e-17
PPTG_0114817292951271949e-17
PYIR_2254997812551761921e-16
PHYCA_112615308831961671891e-16
CCA1717917291851041881e-16
PPTG_0313997753201801941e-16
PYU1_G00152597813121781941e-16
PYU1_G005871944962841841931e-16
PHYSO_37451853913116971831e-16
PYU1_G005872161732971841931e-16
SDRG_154261258855231401952e-16
PYIW_168101650732161781892e-16
PYIR_24743851643571791942e-16
PYAP_24691101441145701832e-16
SPRG_076271258855361831943e-16
PYAP_236721009052571781893e-16
PHYCA_14560574613001251913e-16
PHYKE_574938073001801913e-16
PHYCA_103479510323141251913e-16
PHYCA_1865738072951811903e-16
PPTG_07521450302811101893e-16
PHYCA_122958161732601791884e-16
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYSO_284086

Length=205
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYSO_284086                                                          354        3e-125
PHYCA_129425                                                          312        1e-108
PPTG_17122                                                            310        1e-107
PHYKE_8389                                                            296        1e-102
PITG_18450                                                            295        9e-102
PHYRA_81106                                                           284        1e-97 
PHYKE_8388                                                            273        2e-93 
PHYSO_477820                                                          271        1e-92 
PPTG_17121                                                            270        4e-92 
PHYRA_81107                                                           268        2e-91 
PHYSO_341599                                                          268        2e-91 
PHYCA_14369                                                           270        2e-91 
PHYKE_3446                                                            268        2e-91 
PHYRA_82864                                                           268        3e-91 
PHYCA_511409                                                          267        7e-91 
PHYRA_85631                                                           267        2e-90 
PPTG_10635                                                            263        3e-89 
PHYRA_84190                                                           260        3e-88 
PPTG_10636                                                            261        5e-88 
PYVX_18176                                                            258        1e-87 
PPTG_10634                                                            258        3e-87 
PHYSO_536424                                                          257        5e-87 
PHYSO_507031                                                          257        5e-87 
PHYCA_102852                                                          256        1e-86 
PPTG_15264                                                            254        6e-86 
PPTG_17366                                                            254        6e-86 
PHYKE_7718                                                            255        7e-86 
PPTG_10643                                                            253        2e-84 
PYU1_G001741                                                          250        3e-84 
PHYCA_102550                                                          250        3e-83 
PYU1_G001742                                                          245        5e-82 
PYVX_18174                                                            244        5e-82 
PHYCA_102624                                                          243        2e-81 
PYIR_25089                                                            239        3e-79 
PYU1_G001744                                                          237        6e-79 
PHALS_00498                                                           236        2e-78 
PYIR_26626                                                            234        6e-78 
PPTG_10048                                                            233        2e-77 
PYVX_18173                                                            238        2e-75 
PYU1_G001740                                                          225        3e-74 
PHYSO_499978                                                          218        1e-71 
PHYSO_501575                                                          218        1e-71 
PHALS_03284                                                           211        4e-69 
PYU1_G001739                                                          206        4e-66 
PPTG_08820                                                            205        1e-65 
PITG_13520                                                            198        5e-64 
PPTG_14255                                                            200        1e-63 
PHYSO_343376                                                          196        3e-63 
PHYCA_510817                                                          195        9e-63 
PPTG_14254                                                            192        9e-62 
PHYSO_254168                                                          189        2e-60 
PYAP_22278                                                            192        2e-60 
PHYKE_9185                                                            192        3e-60 
PHYSO_417649                                                          189        3e-60 
PYIW_18791                                                            187        2e-59 
PYAR_24096                                                            185        3e-58 
PHYSO_262732                                                          183        5e-58 
PITG_10499                                                            187        7e-58 
PYAP_22279                                                            183        2e-57 
PHYCA_536934                                                          197        3e-57 
PYAP_22273                                                            181        5e-56 
PHYSO_341596                                                          179        9e-56 
PHYCA_14368                                                           175        2e-54 
PYIR_26546                                                            168        2e-51 
PHYSO_246676                                                          165        7e-51 
PHYSO_527908                                                          161        2e-49 
PYU1_G001738                                                          154        6e-46 
PPTG_17123                                                            152        8e-46 
HYAP_07096                                                            152        3e-45 
PHYCA_537323                                                          148        3e-44 
PHYRA_81105                                                           144        1e-42 
PHYSO_353401                                                          142        2e-42 
PITG_18452                                                            153        5e-42 
PHYSO_340369                                                          139        2e-40 
PYIW_18788                                                            137        3e-39 
PYAP_18131                                                            121        2e-33 
PYIW_18792                                                            114        8e-32 
PYVX_18179                                                            114        2e-31 
PHYRA_78625                                                           111        9e-28 
PHYRA_78626                                                           111        1e-27 
PYIR_16444                                                            104        4e-27 
PHYSO_342364                                                          104        6e-27 
PYIR_16435                                                            106        9e-27 
PYVX_18175                                                            100        5e-26 
PYIW_19151                                                            102        9e-26 
PHYCA_130365                                                          102        2e-25 
PHYSO_438103                                                          101        2e-25 
PYU1_G007476                                                          99.8       3e-25 
PHYKE_8104                                                            95.9       6e-25 
PYIR_16443                                                            100        6e-25 
PHYRA_73582                                                           101        8e-25 
PYIW_18790                                                            95.5       8e-25 
PPTG_04618                                                            101        9e-25 
PYAP_24689                                                            100        9e-25 
PYAP_18709                                                            99.4       1e-24 
PYU1_G005324                                                          97.4       2e-24 
PYU1_G005326                                                          97.4       2e-24 
PYU1_G005328                                                          97.4       2e-24 
PHYRA_78689                                                           99.8       3e-24 
PHYCA_127270                                                          98.6       5e-24 
PYU1_G005325                                                          96.7       6e-24 
PHYSO_483955                                                          99.0       7e-24 
H310_06362                                                            96.3       8e-24 
PITG_04949                                                            99.0       8e-24 
PITG_05271                                                            97.8       1e-23 
PYIW_27477                                                            95.1       1e-23 
PYAP_18711                                                            95.5       2e-23 
PITG_19818                                                            93.2       3e-23 
H257_13550                                                            96.3       3e-23 
PHYSO_340333                                                          96.7       3e-23 
PHYSO_340332                                                          96.7       4e-23 
PHYSO_533682                                                          96.3       4e-23 
PYVX_14662                                                            99.0       5e-23 
PHYKE_6001                                                            95.9       6e-23 
PHYRA_74651                                                           96.7       8e-23 
PHYCA_534296                                                          95.9       1e-22 
PYU1_G014690                                                          95.5       1e-22 
PHYCA_12942                                                           95.5       2e-22 
PYU1_G005323                                                          93.6       3e-22 
PYAR_14260                                                            92.0       5e-22 
PHYSO_533903                                                          91.7       6e-22 
PHYKE_6002                                                            91.3       6e-22 
PHYKE_10578                                                           92.0       7e-22 
PHYRA_73607                                                           94.0       8e-22 
PHYRA_86151                                                           90.1       1e-21 
PYAR_24113                                                            90.5       1e-21 
PHYRA_87941                                                           89.4       1e-21 
PHALS_03176                                                           89.4       4e-21 
PPTG_04622                                                            90.9       4e-21 
PYAR_14256                                                            89.0       5e-21 
PPTG_14221                                                            90.1       7e-21 
PPTG_07507                                                            90.5       8e-21 
SPRG_07796                                                            90.5       1e-20 
PYU1_G007364                                                          89.4       2e-20 
PHYRA_85794                                                           87.4       4e-20 
PPTG_07509                                                            88.6       4e-20 
PYIW_24289                                                            86.3       4e-20 
PHYKE_7717                                                            90.5       4e-20 
PHYRA_77971                                                           87.0       5e-20 
PYIR_19612                                                            87.4       6e-20 
PHYKE_2809                                                            87.8       6e-20 
PHYRA_73584                                                           87.8       6e-20 
PHALS_05392                                                           88.6       7e-20 
SDRG_16535                                                            87.8       1e-19 
PPTG_04647                                                            87.8       1e-19 
PYIR_23585                                                            86.3       1e-19 
SPRG_19916                                                            87.4       1e-19 
PITG_04948                                                            85.9       1e-19 
PHYRA_73606                                                           87.8       1e-19 
PPTG_03153                                                            87.4       1e-19 
PHYRA_79140                                                           88.2       2e-19 
PHYCA_531163                                                          87.0       2e-19 
PYVX_16138                                                            88.6       2e-19 
PYAP_22257                                                            85.9       2e-19 
PYIW_25463                                                            85.1       2e-19 
PHALS_04411                                                           85.9       2e-19 
PYIR_20481                                                            86.3       2e-19 
PHYSO_459106                                                          85.1       2e-19 
SPRG_22161                                                            86.3       3e-19 
PHYCA_534473                                                          88.2       3e-19 
PHALS_03177                                                           85.5       3e-19 
PPTG_04619                                                            85.5       3e-19 
PYU1_G005985                                                          84.0       4e-19 
PHYKE_2937                                                            86.7       4e-19 
PHYKE_6077                                                            85.9       4e-19 
PPTG_04620                                                            86.3       5e-19 
PHYSO_485524                                                          84.7       7e-19 
PYIR_22134                                                            85.1       7e-19 
PHYRA_83500                                                           85.9       8e-19 
PHALS_03179                                                           85.9       9e-19 
PHYCA_97965                                                           84.7       1e-18 
PITG_04947                                                            84.3       1e-18 
PYIW_15526                                                            83.6       2e-18 
PYU1_G001519                                                          83.6       2e-18 
PHYCA_12943                                                           84.0       2e-18 
PHYRA_77293                                                           83.2       4e-18 
PHYSO_488921                                                          83.2       4e-18 
SDRG_17317                                                            79.0       4e-18 
PITG_11936                                                            83.6       4e-18 
PHYKE_3913                                                            83.2       5e-18 
PHYSO_329293                                                          83.2       5e-18 
PPTG_03156                                                            84.0       5e-18 
PYU1_G005868                                                          82.4       5e-18 
PHYSO_533747                                                          80.9       6e-18 
PHYRA_80750                                                           82.0       6e-18 
PHALS_05394                                                           82.4       6e-18 
PHYRA_73583                                                           84.0       7e-18 
PHYRA_86016                                                           81.3       7e-18 
PYIW_24288                                                            80.5       7e-18 
SDRG_16534                                                            82.8       8e-18 
PPTG_07520                                                            82.4       8e-18 
PPTG_07516                                                            82.0       9e-18 
PYU1_G005866                                                          80.1       9e-18 
PYIR_24421                                                            80.5       1e-17 
PHYCA_98479                                                           81.6       1e-17 
PYU1_G005873                                                          80.5       1e-17 
SPRG_07795                                                            82.4       1e-17 
PYAP_22462                                                            80.1       1e-17 
PHYRA_78161                                                           82.0       2e-17 
PYAP_18584                                                            79.7       2e-17 
PYIR_15187                                                            79.7       2e-17 
PYAP_18713                                                            79.0       2e-17 
PHYRA_86752                                                           81.3       2e-17 
PHYKE_10295                                                           80.9       2e-17 
PYIW_25573                                                            80.9       2e-17 
PHYSO_262844                                                          80.5       3e-17 
PHYRA_73581                                                           80.9       3e-17 
PYAR_20617                                                            80.1       3e-17 
PHYRA_78176                                                           80.9       3e-17 
PHYKE_6078                                                            80.9       3e-17 
PPTG_04803                                                            80.5       3e-17 
SPRG_19917                                                            79.7       3e-17 
SDRG_07565                                                            80.1       4e-17 
PHYSO_484051                                                          80.1       4e-17 
PPTG_03160                                                            81.3       4e-17 
SDRG_08137                                                            80.1       4e-17 
SDRG_17318                                                            79.3       4e-17 
CCI47381                                                              79.0       4e-17 
PHYSO_524101                                                          80.5       4e-17 
PHYCA_69583                                                           79.0       4e-17 
PYIW_21964                                                            79.7       4e-17 
SDRG_08782                                                            81.3       4e-17 
PYU1_G001514                                                          80.9       6e-17 
PPTG_18166                                                            80.9       6e-17 
PHYKE_1913                                                            79.7       6e-17 
SPRG_07797                                                            80.1       7e-17 
PPTG_03138                                                            79.7       7e-17 
PHYRA_83494                                                           78.6       7e-17 
SDRG_08129                                                            78.2       9e-17 
PPTG_01148                                                            79.3       9e-17 
PYIR_22549                                                            78.6       1e-16 
PHYCA_112615                                                          77.4       1e-16 
CCA17179                                                              77.0       1e-16 
PPTG_03139                                                            79.3       1e-16 
PYU1_G001525                                                          79.3       1e-16 
PYU1_G005871                                                          79.0       1e-16 
PHYSO_374518                                                          75.1       1e-16 
PYU1_G005872                                                          79.0       1e-16 
SDRG_15426                                                            79.7       2e-16 
PYIW_16810                                                            77.4       2e-16 
PYIR_24743                                                            79.3       2e-16 
PYAP_24691                                                            75.1       2e-16 
SPRG_07627                                                            79.3       3e-16 
PYAP_23672                                                            77.4       3e-16 
PHYCA_14560                                                           78.2       3e-16 
PHYKE_5749                                                            78.2       3e-16 
PHYCA_103479                                                          78.2       3e-16 
PHYCA_18657                                                           77.8       3e-16 
PPTG_07521                                                            77.4       3e-16 
PHYCA_122958                                                          77.0       4e-16 
PYVX_21297                                                            77.0       4e-16 
PHYKE_2454                                                            78.2       4e-16 
PHYRA_84947                                                           77.0       5e-16 
PHYSO_255056                                                          77.0       5e-16 
PYU1_G001528                                                          77.0       5e-16 
PHYCA_562062                                                          76.3       6e-16 
PPTG_10186                                                            76.6       6e-16 
PITG_01966                                                            77.4       7e-16 
PHYRA_86241                                                           75.1       7e-16 
PHYCA_19598                                                           77.8       8e-16 
PHYRA_83499                                                           77.8       8e-16 
PYU1_G007254                                                          74.7       8e-16 
PITG_11937                                                            76.6       9e-16 
PHYSO_476077                                                          76.3       9e-16 
PHYSO_472009                                                          76.3       9e-16 
PHYRA_84732                                                           76.3       9e-16 
PHYSO_324715                                                          75.9       1e-15 
PHYSO_318683                                                          76.6       1e-15 
PHYCA_18729                                                           77.0       1e-15 
HYAP_01683                                                            76.6       1e-15 
PHYCA_19611                                                           77.0       2e-15 
PYIW_24287                                                            76.3       2e-15 
PYAP_18221                                                            74.7       2e-15 
PYVX_20783                                                            75.5       2e-15 
PYVX_24563                                                            75.1       2e-15 
PYIR_25999                                                            76.3       2e-15 
H310_05432                                                            75.9       2e-15 
PYU1_G001524                                                          75.5       2e-15 
PHYRA_78175                                                           75.5       3e-15 
HYAP_14170                                                            75.1       3e-15 
PYIW_19601                                                            74.3       3e-15 
PYAP_19707                                                            74.3       3e-15 
PYU1_G001517                                                          75.1       3e-15 
PYAR_24818                                                            73.6       3e-15 
PHYKE_6079                                                            75.1       3e-15 
PYIR_25334                                                            74.7       4e-15 
PYAP_16338                                                            74.7       4e-15 
PHYKE_7445                                                            75.5       4e-15 
PYAR_16493                                                            74.3       4e-15 
PHALS_02044                                                           73.9       4e-15 
PHYKE_2379                                                            74.7       4e-15 
PPTG_04617                                                            75.9       4e-15 
PYAR_25093                                                            73.2       4e-15 
PHYRA_77290                                                           74.7       5e-15 
PHYKE_2539                                                            73.9       5e-15 
PYVX_20789                                                            74.7       5e-15 
PYU1_G001527                                                          74.3       5e-15 
PYU1_G001523                                                          74.3       5e-15 
PYU1_G007250                                                          72.4       6e-15 
PYIR_25571                                                            74.3       6e-15 
PHYSO_246481                                                          74.3       7e-15 
PHYRA_78172                                                           75.1       7e-15 
H257_11264                                                            73.9       8e-15 
PHYRA_93650                                                           73.2       8e-15 
PYU1_G001520                                                          74.7       9e-15 
PYIW_16208                                                            73.2       9e-15 
HYAP_11923                                                            74.7       1e-14 
PYU1_G007242                                                          73.2       1e-14 
PYVX_21643                                                            73.2       1e-14 
PYVX_19277                                                            73.9       1e-14 
PHYRA_86751                                                           71.2       1e-14 
PHYCA_120062                                                          72.0       1e-14 
H257_11265                                                            73.2       1e-14 
PHYCA_132255                                                          70.1       1e-14 
PYAR_21940                                                            72.4       2e-14 
PHYSO_255975                                                          71.2       2e-14 
PPTG_03140                                                            73.2       2e-14 
PITG_20312                                                            72.4       2e-14 
PYU1_G001526                                                          73.2       2e-14 
SPRG_07825                                                            73.2       2e-14 
PITG_20631                                                            72.4       2e-14 
SDRG_17448                                                            72.4       2e-14 
PPTG_01153                                                            72.8       2e-14 
PYAR_15391                                                            70.5       3e-14 
PHYKE_10296                                                           73.6       3e-14 
SPRG_07826                                                            72.8       4e-14 
PYAP_19712                                                            72.0       4e-14 
PYIR_14463                                                            72.8       4e-14 
PITG_08202                                                            70.5       4e-14 
SDRG_00972                                                            72.4       4e-14 
PYVX_22510                                                            72.8       4e-14 
PHYCA_19612                                                           72.8       4e-14 
PYAP_18138                                                            71.6       5e-14 
PPTG_10073                                                            70.1       6e-14 
PHYKE_3912                                                            70.9       7e-14 
PYAP_18226                                                            70.5       8e-14 
SPRG_04679                                                            70.1       8e-14 
H257_11271                                                            71.6       9e-14 
PPTG_03143                                                            71.6       9e-14 
PYAR_22058                                                            69.3       1e-13 
PHYKE_8390                                                            67.8       1e-13 
PYAR_17166                                                            67.0       1e-13 
PHYKE_6076                                                            70.5       1e-13 
PYU1_G005867                                                          68.9       1e-13 
PYVX_22511                                                            70.5       2e-13 
PHYSO_318693                                                          71.2       2e-13 
PHYKE_6066                                                            70.1       2e-13 
H257_11258                                                            70.9       2e-13 
PHALS_05110                                                           68.6       2e-13 
PYIR_20483                                                            69.7       2e-13 
PHYRA_78162                                                           70.5       2e-13 
PPTG_03161                                                            70.5       3e-13 
PHYCA_123316                                                          70.1       3e-13 
PYIW_18065                                                            69.7       3e-13 
PYVX_22508                                                            69.3       4e-13 
PYU1_G005869                                                          68.9       4e-13 
PYAR_18165                                                            68.9       4e-13 
PYU1_G006405                                                          69.3       4e-13 
PHYRA_86201                                                           69.3       4e-13 
PYAP_23673                                                            69.3       5e-13 
PHALS_02041                                                           68.6       5e-13 
PHALS_10635                                                           68.9       6e-13 
PYAP_16347                                                            67.4       6e-13 
PHYCA_15126                                                           68.9       6e-13 
PYAR_17163                                                            65.5       6e-13 
PHYSO_375794                                                          65.5       6e-13 
PHYRA_78177                                                           68.9       7e-13 
PPTG_04801                                                            68.2       8e-13 
PHYRA_77292                                                           67.0       8e-13 
PPTG_09880                                                            67.0       9e-13 
PHYRA_78164                                                           68.2       9e-13 
PYVX_16673                                                            68.9       1e-12 
PHYCA_552912                                                          68.9       1e-12 
PHYSO_525076                                                          68.6       1e-12 
PYIR_23622                                                            67.8       1e-12 
PPTG_07511                                                            66.2       1e-12 
PYVX_23997                                                            66.6       1e-12 
PHYRA_80632                                                           68.2       1e-12 
PYIR_17978                                                            67.4       1e-12 
SPRG_07799                                                            68.2       1e-12 
SDRG_00948                                                            68.2       1e-12 
PHYSO_374025                                                          67.8       1e-12 
PYU1_G006672                                                          62.8       1e-12 
PPTG_18176                                                            67.4       2e-12 
PYVX_21174                                                            63.5       2e-12 
PHYKE_6069                                                            67.4       2e-12 
PYIR_22133                                                            67.8       2e-12 
PHALS_08575                                                           67.0       2e-12 
PHYRA_78169                                                           67.4       3e-12 
PHYCA_10471                                                           66.6       3e-12 
PYAP_16994                                                            66.2       4e-12 
PPTG_20376                                                            65.1       4e-12 
PYAP_20077                                                            65.9       4e-12 
PHYSO_337515                                                          66.6       5e-12 
PHYRA_78174                                                           65.9       6e-12 
PYIR_20482                                                            63.5       7e-12 
PYVX_21438                                                            65.5       7e-12 
PYAR_14261                                                            63.5       7e-12 
PHYRA_80631                                                           65.9       8e-12 
PHYKE_7446                                                            66.2       8e-12 
PITG_08892                                                            65.5       1e-11 
PHYKE_9023                                                            65.1       1e-11 
PYIW_18794                                                            64.7       1e-11 
PYIW_21963                                                            65.5       1e-11 
PPTG_01147                                                            64.7       1e-11 
PYAR_21271                                                            64.3       1e-11 
PPTG_06256                                                            65.1       1e-11 
PYVX_24274                                                            64.3       1e-11 
PYIR_26867                                                            62.8       2e-11 
PYAR_25949                                                            63.2       2e-11 
PYIR_22136                                                            64.7       2e-11 
PHYSO_454780                                                          63.2       2e-11 
PITG_08895                                                            63.2       2e-11 
PYIR_16375                                                            64.3       2e-11 
PHYCA_14559                                                           63.9       2e-11 
PPTG_03148                                                            63.9       3e-11 
PHYCA_6388                                                            63.9       3e-11 
PHYRA_77291                                                           63.5       3e-11 
PHYCA_19608                                                           63.9       3e-11 
PHYSO_426658                                                          62.8       3e-11 
PHALS_02037                                                           64.3       3e-11 
PHALS_01293                                                           64.3       3e-11 
PYIR_16437                                                            63.5       3e-11 
PHYKE_9024                                                            63.9       4e-11 
PHYSO_488139                                                          63.2       4e-11 
PYU1_G001475                                                          63.2       5e-11 
PITG_11942                                                            63.2       5e-11 
PYAP_23455                                                            63.5       5e-11 
PYIR_23689                                                            62.4       6e-11 
PPTG_06253                                                            63.2       6e-11 
H310_05433                                                            63.2       7e-11 
PHYCA_15125                                                           63.2       8e-11 
PYIW_14247                                                            62.4       8e-11 
PHYKE_7443                                                            62.8       9e-11 
PHYCA_538650                                                          62.4       1e-10 
PYAR_15784                                                            61.2       1e-10 
PHYSO_256017                                                          60.1       1e-10 
PYIW_15528                                                            62.4       1e-10 
PYAP_14265                                                            62.4       1e-10 
PHYRA_78165                                                           62.4       1e-10 
PYAP_16337                                                            61.6       2e-10 
PHYRA_78168                                                           62.0       2e-10 
PHYCA_10470                                                           62.0       2e-10 
PYU1_G005878                                                          57.8       2e-10 
PPTG_06249                                                            62.0       2e-10 
PHYCA_15124                                                           62.0       2e-10 
PHYCA_123476                                                          62.0       2e-10 
PITG_11951                                                            60.1       2e-10 
PPTG_01152                                                            61.2       2e-10 
PPTG_03144                                                            61.6       2e-10 
PHYCA_12944                                                           60.1       2e-10 
PITG_01969                                                            61.2       2e-10 
PYIR_22634                                                            61.2       3e-10 
PYU1_G006404                                                          61.2       3e-10 
PPTG_03145                                                            61.2       3e-10 
H257_11306                                                            61.2       4e-10 
PYAR_24939                                                            58.9       4e-10 
PHYRA_78167                                                           60.1       6e-10 
PPTG_13879                                                            60.5       6e-10 
PHYSO_525121                                                          59.3       7e-10 
PYAR_13902                                                            58.2       7e-10 
PYAP_24338                                                            59.7       8e-10 
PITG_11944                                                            60.1       8e-10 
PHYCA_122138                                                          58.9       9e-10 
PITG_04404                                                            58.9       1e-09 
PYU1_G001518                                                          59.7       1e-09 
PYIW_23030                                                            59.3       1e-09 
PHYCA_19599                                                           59.7       1e-09 
PYAR_15390                                                            58.2       1e-09 
PHALS_02295                                                           59.3       1e-09 
PYIR_24935                                                            58.9       1e-09 
H310_05438                                                            59.3       1e-09 
PHYRA_75781                                                           58.5       1e-09 
PHYRA_95184                                                           59.7       2e-09 
PYVX_22512                                                            58.2       2e-09 
HYAP_01682                                                            58.9       2e-09 
PHYSO_525490                                                          59.3       2e-09 
PHYSO_339832                                                          58.2       2e-09 
PYAP_25026                                                            57.8       3e-09 
PYIR_25001                                                            57.4       3e-09 
PYU1_G001516                                                          58.2       3e-09 
PYIR_20304                                                            57.0       4e-09 
PHYCA_19606                                                           58.2       4e-09 
PYVX_21644                                                            57.0       4e-09 
PYIW_20715                                                            57.4       5e-09 
PITG_11957                                                            57.8       5e-09 
PYIW_26655                                                            57.4       5e-09 
PPTG_03147                                                            57.8       5e-09 
PYIR_22135                                                            57.0       9e-09 
PYU1_G005862                                                          55.8       9e-09 
PHYSO_489485                                                          54.7       1e-08 
PITG_11943                                                            55.1       1e-08 
PHALS_01460                                                           56.2       1e-08 
PITG_21641                                                            56.2       2e-08 
PHALS_02296                                                           55.8       2e-08 
PPTG_00482                                                            54.3       2e-08 
PYAP_18982                                                            54.7       2e-08 
PYAP_18307                                                            55.5       2e-08 
PYAR_26311                                                            54.3       2e-08 
PHYCA_97699                                                           55.1       3e-08 

>PHYSO_284086
Length=204

 Score = 354 bits (909),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%), Gaps = 0/204 (0%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPSFLSSLSAAALLSSAALLAPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET
Sbjct  1    MAPSFLSSLSAAALLSSAALLAPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHD  120
            VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHD
Sbjct  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHD  120

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYK  180
            GPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYK
Sbjct  121  GPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYK  180

Query  181  ACVPLSTsarrleaaanesaalEF  204
            ACVPLSTSARRLEAAANESAALEF
Sbjct  181  ACVPLSTSARRLEAAANESAALEF  204

>PHYCA_129425
Length=204

 Score = 312 bits (799),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 187/204 (92%), Gaps = 0/204 (0%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPS LSSL+ AA LSSAALLAPTADAHQVVLLPAPTYTTD+K TKYAPLAFLE+QG++T
Sbjct  1    MAPSLLSSLTVAAALSSAALLAPTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHD  120
            VEDFN WRR  GYKTLRAFMDGA YTV DGADYYCGFT+ K   QPIPDGTMRSTGYTHD
Sbjct  61   VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHD  120

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYK  180
            GPCEVWLD+TRVLQSDNCHETF GKTY+LDYSSCKGSC LRWYWLG RFLKNE+SWQVYK
Sbjct  121  GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180

Query  181  ACVPLSTsarrleaaanesaalEF  204
            AC+PLS+SARRLE AANESAA+EF
Sbjct  181  ACIPLSSSARRLEGAANESAAIEF  204

>PPTG_17122
Length=204

 Score = 310 bits (793),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 169/186 (91%), Gaps = 0/186 (0%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPS LSSLS AA+LSSAALLAPT++AHQVVLLPAPTYTTD+K TKYAPLAFLENQGYET
Sbjct  1    MAPSLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHD  120
            VEDFN WRR+ GYKTLR FMD A YTV DGADYYCGFT++    QPIPDGTMRSTGYTHD
Sbjct  61   VEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHD  120

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYK  180
            GPCEVWLDT RVLQSDNCHET SGKTY+LDYSSC G+CTLRWYWLGVR+LKN YSWQ+YK
Sbjct  121  GPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYK  180

Query  181  ACVPLS  186
            AC+PLS
Sbjct  181  ACIPLS  186

>PHYKE_8389
Length=204

 Score = 296 bits (759),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 161/183 (88%), Gaps = 1/183 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQVVLLPAPTYTTDDK TKYAPLAFLENQG+ETV+DFNAWRR+ GYKTLRAFMDG
Sbjct  22   PTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG  81

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTV DGADY+CGFT+     Q IP G  MRSTGYTHDGPCEVWLDTTRVL  DNCHE 
Sbjct  82   AKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTsarrleaaanesaa  201
             SGK Y +DYSSC G+CTLRWYWLGVRFLKNEYSWQVYKACVPLS SARRL+ AANESAA
Sbjct  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAA  201

Query  202  lEF  204
            +EF
Sbjct  202  IEF  204

>PITG_18450
Length=203

 Score = 295 bits (754),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 161/186 (87%), Gaps = 3/186 (2%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPS  SSL  AA+LSS  LLAPTA AHQVVLLP+PTYTTDDK TKYAPL FLE QGYET
Sbjct  1    MAPSVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYET  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHD  120
            VEDFN WRR+ GYKTLR FM+   YTVADGADYYCGFT++    QP PDG MRSTGYTHD
Sbjct  61   VEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHD  117

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYK  180
            GPCEVWLD+TRVLQSDNCHET  GKTY+LDYSSCKG+CTLRWYWLGVRFLKN YSWQ+YK
Sbjct  118  GPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYK  177

Query  181  ACVPLS  186
            AC+PLS
Sbjct  178  ACIPLS  183

>PHYRA_81106
Length=202

 Score = 284 bits (727),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 140/165 (85%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P  DAHQVVLLPAPTYTTD K TKYAPLAFLENQG+ETV DFNAWRR  GYKTLRAFMDG
Sbjct  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTVADGADYYCGFT+     Q IPDG  MRSTGYTHDGPCEVWLDTTRVL  DNCHE 
Sbjct  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             SGK Y +DYSSC G+CTL WYW+GVR+LKN YSWQVYKACVPLS
Sbjct  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187

>PHYKE_8388
Length=205

 Score = 273 bits (699),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 159/187 (85%), Gaps = 1/187 (1%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            M PSF SSL  AA+LSSAAL+AP A+AHQVVLLP+PTYTTDDKATKYAPLAFLE+QG+ T
Sbjct  1    MTPSFASSLLVAAVLSSAALIAPIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFST  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTH  119
             EDF AWR D GY +LRAF D ASYTV+DGAD+ CGFTDI G AQPIP D  MRSTGYTH
Sbjct  61   QEDFTAWRSDNGYASLRAFNDDASYTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTH  120

Query  120  DGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            DGPCEVWLD T V+Q +NCH++ SGK Y +DYSSC  +CTL W+W+GVR+LKNEYSWQVY
Sbjct  121  DGPCEVWLDDTMVMQYNNCHDSISGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVY  180

Query  180  KACVPLS  186
            KACVPLS
Sbjct  181  KACVPLS  187

>PHYSO_477820
Length=202

 Score = 271 bits (694),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 139/164 (85%), Gaps = 1/164 (1%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            A AHQVVLLPAPTYTTDDKATKYAPLAFLE+QG+ T EDF AWR D GY +LRAF DGAS
Sbjct  22   AGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS  81

Query  85   YTVADGADYYCGFTDIKGVAQPIPD-GTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            YTVADGAD+ CGFT+  G  QPIPD   MRSTGYTHDGPCEVWLD T V+Q DNCHE+ S
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            GK Y +DYSSC  +CTL W+WLGVR+LKNEYSWQ+YKACVPLST
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLST  185

>PPTG_17121
Length=202

 Score = 270 bits (691),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 139/164 (85%), Gaps = 1/164 (1%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            A+AHQVVLL APTYTTDDK TKYAPLAFLE+QG+ T EDF AWR+D GY +LRAF DGAS
Sbjct  22   ANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS  81

Query  85   YTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            YTV+DGAD  CGFT+I G  QPIPDG  MRSTGYTHDGPCEVWLD T V+Q DNCHE  S
Sbjct  82   YTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  141

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            GK Y +DYSSC  +CTL W+WLGVR+LKNEYSWQ+YKACVPLST
Sbjct  142  GKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLST  185

>PHYRA_81107
Length=202

 Score = 268 bits (686),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 137/163 (84%), Gaps = 1/163 (1%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            ADAHQVVLLPAPTYTTDDKATKYAPLAFLE+QG+ T EDF AWR + GY +LRAF DGAS
Sbjct  22   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGAS  81

Query  85   YTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            YTV+DGAD+ CGFTDI G  Q IPDG  MRSTGYTHDGPCEVWLD T V+Q DNCHE  S
Sbjct  82   YTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVIS  141

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            GK Y +DYSSC  +CTL W+W+GVR+L N YSWQVYKACVPLS
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLS  184

>PHYSO_341599
Length=185

 Score = 268 bits (685),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 139/166 (84%), Gaps = 1/166 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLLP P +TT+DK TKY PLAFLENQG++T EDF AWR++ GYK+LR FMD 
Sbjct  6    PTADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR  65

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            F GK Y +DYSSCKG+CTLRWYWLGVRFLKN+YSWQVYKAC+PL++
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTS  171

>PHYCA_14369
Length=248

 Score = 270 bits (690),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 137/165 (83%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLLP P +TT+DK TKY PLAFLENQG++T +DF AWR + GYK+LR FMD 
Sbjct  23   PTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTV +GAD+ CGFTD KG  QPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  83   AKYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCKG+CTLRWYWLGVRFLKN YSWQVYKAC+PL+
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLA  187

>PHYKE_3446
Length=199

 Score = 268 bits (685),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 150/188 (80%), Gaps = 1/188 (1%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAP   S  +  A LS AA++AP  DAHQ+VLLP P + TD K  KY PLAFLENQG+ T
Sbjct  1    MAPPLASVFTVVAALSGAAVIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFAT  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDG-TMRSTGYTH  119
             ED NAWRRD GYKTLRAFMD A Y V +GADY+CG+TD  G AQPIP+G  MRSTGYTH
Sbjct  61   QEDANAWRRDNGYKTLRAFMDMAKYQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTH  120

Query  120  DGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            DGPCEVW+D TRVL+S NCHET +GK Y +DYS+C+G+C LRWYWLGVRFLKN YSWQVY
Sbjct  121  DGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVY  180

Query  180  KACVPLST  187
            KAC+PL++
Sbjct  181  KACIPLTS  188

>PHYRA_82864
Length=193

 Score = 268 bits (684),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 135/165 (82%), Gaps = 0/165 (0%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQVVLLP P +TTD+K TKY PLAFLE QG+ T  DFNAWRRD GYKTLR FMD 
Sbjct  23   PTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
            A YTV +GADY+CG+TD  G  QPIP G MRSTGYTHDGPCEVWLD TRVLQ DNCHE F
Sbjct  83   AKYTVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQF  142

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
              K Y +DYSSCKG+CTL WYW+GVRFLKN YSWQVYK C+ L++
Sbjct  143  PDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTS  187

>PHYCA_511409
Length=204

 Score = 267 bits (682),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 138/163 (85%), Gaps = 1/163 (1%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            ADAHQVVLLPAPTYTTDDKATKYAPLAFLE+QG+ T EDF AWR+D GY +LRAF DGAS
Sbjct  24   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGAS  83

Query  85   YTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            YTV+DGAD+ CGFT+  G  Q IPD   MRSTGYTHDGPCEVWLD T V+Q DNCHE  S
Sbjct  84   YTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAIS  143

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            GK Y +DYSSC  +CTL W+WLGVR+LKNEYSWQ+YKACVPLS
Sbjct  144  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  186

>PHYRA_85631
Length=228

 Score = 267 bits (682),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 136/165 (82%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQVVLLP P +TTDDK TKY PLAFLEN+G+ T EDF +WR + GYK+LR FMD 
Sbjct  23   PTADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y VADGAD+ CGFTD KG  QPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  83   AKYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCKG+CTLRWYWLG+RFLKN+YSWQVYK C+PL+
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLT  187

>PPTG_10635
Length=199

 Score = 263 bits (671),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 134/165 (81%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P ADAHQ+VLLP P +TT+DK TKY PLAFLENQG++T EDF +WR + GYK+LR FMD 
Sbjct  6    PMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR  65

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  66   AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCKGSCTLRWYWLGVRFLKN YSWQVYKAC+PL+
Sbjct  126  FPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLT  170

>PHYRA_84190
Length=206

 Score = 260 bits (665),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 134/165 (81%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLLP P +TTDDK TKY PLAFLEN+G+ T EDF AWR + GYK+LR FMD 
Sbjct  6    PTADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN  65

Query  83   ASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y+V +GAD+ CGFTD KG  QPIP D  MRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  66   AKYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  125

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCKG+CTLRWYW+GVRFLK  YSWQVYK C+PL+
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLT  170

>PPTG_10636
Length=246

 Score = 261 bits (668),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 134/165 (81%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P ADAHQ+VLLP P +TT+DK TKY PLAFLENQG++T EDF +WR +  YK+LR FMD 
Sbjct  23   PMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP G  MRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  83   AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCKG+CTLRWYWLG+RFLKN+YSWQVYKAC+PLS
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  187

>PYVX_18176
Length=201

 Score = 258 bits (660),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 0/162 (0%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            ADAHQ V+LPAPT+ TDDK   YAPLAFLE+QG+ T EDF AWR D GY +LRAFMDGAS
Sbjct  22   ADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS  81

Query  85   YTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSG  144
            YTV DGAD  CG+T+  G AQ +PDG MRSTGYTH GPCEVWLD T VLQ DNCH++ SG
Sbjct  82   YTVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISG  141

Query  145  KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            KTYDLDYSSC  +CTL W+W+GVR+L NEYSWQVYK CVPLS
Sbjct  142  KTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLS  183

>PPTG_10634
Length=208

 Score = 258 bits (659),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 133/163 (82%), Gaps = 1/163 (1%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83
            T DAHQ+VLLP P +TT+DK TKY PLAFLEN+G+ T EDF AWR++ GYK+LR F+D A
Sbjct  24   TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  83

Query  84   SYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             Y V DGAD+ CGFTD KG  QPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE F
Sbjct  84   KYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  143

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             GK Y +DYSSCKG+CTL WYWLGVRFLKN+YSWQVYKAC+PL
Sbjct  144  PGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PHYSO_536424
Length=197

 Score = 257 bits (657),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 134/166 (81%), Gaps = 1/166 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P    HQ+VLLP P +TT+DK TKY PLAFLEN+G+ T EDF AWR++ GYK+LR FMD 
Sbjct  18   PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  78   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            F GK Y +DYSSCKG+CTLRWYWLGVRFLKN+YSWQVYKAC+PL++
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTS  183

>PHYSO_507031
Length=197

 Score = 257 bits (657),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 134/166 (81%), Gaps = 1/166 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P    HQ+VLLP P +TT+DK TKY PLAFLEN+G+ T EDF AWR++ GYK+LR FMD 
Sbjct  18   PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  78   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            F GK Y +DYSSCKG+CTLRWYWLGVRFLKN+YSWQVYKAC+PL++
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTS  183

>PHYCA_102852
Length=195

 Score = 256 bits (654),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 134/165 (81%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLLP P +TT+DK TKY PLAFLEN+G+ T EDF AWR + GYK+LR FMD 
Sbjct  23   PTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V +GAD+ CGFTD  G  QPIP G  MRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  83   AKYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCKG+CTL W+WLGVRFLKN+YSWQVYKAC+PL+
Sbjct  143  FPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLT  187

>PPTG_15264
Length=194

 Score = 254 bits (649),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 3/167 (2%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83
            + DAHQ+VL P P +TTD+K  KY PLAFLE QG++T EDFNAWRRD GYKTLR FMD A
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  84   SYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             YTV +GADY+CG+TD KG  QPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+ 
Sbjct  81   KYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESI  140

Query  143  SGKTYDLDYSSC--KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
             GK Y +DYSSC  KG C LRWYWLGVRFLKN YSWQVYK C+PL+T
Sbjct  141  PGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTT  187

>PPTG_17366
Length=194

 Score = 254 bits (649),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 133/167 (80%), Gaps = 3/167 (2%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83
            + DAHQ+VL P P +TTD+K  KY PLAFLE QG++T EDFNAWRRD GYKTLR FMD A
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  84   SYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             YTV +GADY+CG+TD KG  QPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+ 
Sbjct  81   KYTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESI  140

Query  143  SGKTYDLDYSSC--KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
             GK Y +DYSSC  KG C LRWYWLGVRFLKN YSWQVYK C+PL+T
Sbjct  141  PGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTT  187

>PHYKE_7718
Length=220

 Score = 255 bits (651),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 132/165 (80%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P ADAHQ+VLLP PT+TTDDK TKY PLAFLE +G+   EDF AWR + GYK+LR FMD 
Sbjct  27   PIADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN  86

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y+V  GAD  CGFTD  G  QPIP+G  MRSTGYTHDGPCEVW+D T  + +DNCHE 
Sbjct  87   AKYSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEA  146

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYS+CKG+CTLRWYWLGVRFLKN YSWQVYKAC+PL+
Sbjct  147  FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  191

>PPTG_10643
Length=250

 Score = 253 bits (645),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 131/164 (80%), Gaps = 1/164 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PT DAHQ+VLLP P +TT+DK TKY PLAFLENQG++  EDF AW ++ GYK+LR FMD 
Sbjct  23   PTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFT+ KG  QPIP  G MRSTGYTHDGPCEV+LD T VLQ DNCHE 
Sbjct  83   AKYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            F GK   +DYSSCKG+CTLRWYWLG+RFLKN YSWQVYK C+PL
Sbjct  143  FPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PYU1_G001741
Length=199

 Score = 250 bits (638),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 136/165 (82%), Gaps = 1/165 (1%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD-G  82
            TADAHQ V+LPAPT+T   +A ++ PLAFLENQG+ET  DFNA+ + KGYKTLRAFMD  
Sbjct  23   TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDK  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             +YTVA GAD+ CG+T + G  Q IP GT+RSTGYTHDGPCEVWLD+TRV++ +NCH  F
Sbjct  83   KAYTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEF  142

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            +G T+ +DYSSCKGSCTLRWYW+G+RFLK EYSWQVYK CVP+ +
Sbjct  143  TGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGS  187

>PHYCA_102550
Length=268

 Score = 250 bits (638),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 132/165 (80%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTA AHQVVLLPAP + TD++ T++ PLAFLE+QG++T +DF AWR + GYK+LR FMD 
Sbjct  23   PTATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTV +GAD+ CG+TD  G  QPIP G  MRSTGYTHDGPCEVW+D T V++ DNCHE 
Sbjct  83   AKYTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYS CKG CTL WYWLGVRFLKN YSWQVYK C+PL+
Sbjct  143  FPGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLA  187

>PYU1_G001742
Length=213

 Score = 245 bits (625),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 1/163 (1%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-  82
            +ADAHQ V+LPAPT+T   +A ++ PLAFLENQGY+T  DFNA+ + KGYKTLRAFMD  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDP  83

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             +Y VA GAD+ CG+T + G  QPIP GT+RSTGYTHDGPCEVWLD+TRV++ +NCH  F
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEF  143

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             G T+ +DYSSCKGSCTLRWYW+G+RFLK +YSWQVYK CVP+
Sbjct  144  PGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PYVX_18174
Length=204

 Score = 244 bits (624),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 130/164 (79%), Gaps = 2/164 (1%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            ADAHQ V+LP PT+TT D+   YAPLAFLE+QG+ETVEDFNAWRR  GYKTLRAFMD AS
Sbjct  25   ADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS  84

Query  85   YTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSG  144
            YTV DGAD  CGFT+I G  QPIP    RSTGYTHDGPCE+WLD+TRV  +DNCHE  SG
Sbjct  85   YTVTDGADQTCGFTEIDGTPQPIP-ANFRSTGYTHDGPCEIWLDSTRVYANDNCHEAISG  143

Query  145  KTYDLDYS-SCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            K   +DYS    G+CTL WYW+GVR+L N YSWQVYK CVPLST
Sbjct  144  KDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLST  187

>PHYCA_102624
Length=195

 Score = 243 bits (619),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 1/166 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTA AHQVVLLP P + TD++ T++ PL FLE  G++T  DF AWR++ GYK+LR FMD 
Sbjct  23   PTATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V++GAD+ CGFTD  G  QPIP G  MRSTGYTHDGPCEVW+D T V++ DNCHE 
Sbjct  83   AKYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            F GK Y +DYS CKG CTL WYWLGVRFLKN YSWQVYK C+PL++
Sbjct  143  FPGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTS  188

>PYIR_25089
Length=262

 Score = 239 bits (611),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 2/165 (1%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83
            + DAHQ V+LPAPT+T   +A ++ PLAFLENQG++T  DF+A+ + KGYKTLRAFMD  
Sbjct  24   SVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDK  83

Query  84   S-YTVADGADYYCGFTDIKGVAQPIPDG-TMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            S Y VADGAD+ CG+T + G  QPIP   T+RSTGYTHDGPCEVWLD TRVL+  NCH  
Sbjct  84   SAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSE  143

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F G T+ +DYSSCKGSC LRWYW+G+RFLK +YSWQVYK CVP++
Sbjct  144  FPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVT  188

>PYU1_G001744
Length=213

 Score = 237 bits (605),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 1/163 (1%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD-G  82
            +ADAHQ V+LPAPT+T   +A ++ PLAFLENQG++T  DFNA+ + KGYK+LRAFMD  
Sbjct  24   SADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDK  83

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             +Y VA GAD+ CG+T + G  QPIP GT+RSTGYTHDGPCEVWLD T V++ +NCH  F
Sbjct  84   KAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEF  143

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             G T+ + Y+SCKGSCTLRWYW+G+RFLK +YSWQVYK CVP+
Sbjct  144  PGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PHALS_00498
Length=199

 Score = 236 bits (601),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 124/165 (75%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P   AHQ+VLLP P + T+DK T+Y PLAFLENQ ++T  D  A+ +   +KTLR FMD 
Sbjct  23   PNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDN  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTV  GAD  CGFTD  G  QPIP +  MRSTGYTHDGPCEVWL+ TRVL + NCHE 
Sbjct  83   AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEK  142

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYSSCK +C LRWYWLGVRFLK +YSWQVYKAC+PLS
Sbjct  143  FPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLS  187

>PYIR_26626
Length=212

 Score = 234 bits (598),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 2/189 (1%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPS + SL+ AA++SSAAL   + DAHQ V+LPAPT+T  DK   + PLAFLENQGY+T
Sbjct  1    MAPSVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60

Query  61   VEDFNAWRRDKGYKTLRAFMD-GASYTV-ADGADYYCGFTDIKGVAQPIPDGTMRSTGYT  118
              DFN + + KGYKTLRAFMD   +Y V A GA++ CG+T+I G  QPIP GT+RSTGYT
Sbjct  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120

Query  119  HDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQV  178
            HDGPCEVWLD T+V+   NC++ F GKT+ + Y+SCKGSCTLRWYW+G+RFLKN++SWQV
Sbjct  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180

Query  179  YKACVPLST  187
            YK CVP+ +
Sbjct  181  YKECVPIGS  189

>PPTG_10048
Length=190

 Score = 233 bits (593),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 130/166 (78%), Gaps = 1/166 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P  +AHQVVL PAP + TD++ T++ PLAFLE+QG++T EDF +WR   GYKTLR FM+ 
Sbjct  20   PLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH  79

Query  83   ASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTV +GAD+ CG+T+ KG  QPIP  G MRSTGYTH+GPCE+W+  T+V Q+DNCH +
Sbjct  80   AKYTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVS  139

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
              GK Y +DYS CKG+C L WYWLGVRFLKN YSWQVYK C+PL+T
Sbjct  140  LPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTT  185

>PYVX_18173
Length=500

 Score = 238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 126/165 (76%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P A AHQ+V+LPAPTYT + K  ++ PLAFLE Q + T +DF  +    G+ +LRAFMD 
Sbjct  230  PQAMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD  289

Query  83   AS-YTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
             S Y+V   AD+ CGFTD     QPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE 
Sbjct  290  DSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEV  349

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             SGKTYDLDYS+C GSCTL WYWLGVR+LK  YSWQVYKACVP+S
Sbjct  350  ISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 94/160 (59%), Gaps = 2/160 (1%)

Query  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYTV  87
            QVVL P P +  D    + +P+A+LE QG  T  +   W  ++GY TLRA MD    Y+V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146
             +   + CG T      QPIP +G+  ++GYT DGPCE+W+D T  L   NCH  F    
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            + +DYS C  SC + W+WLG+++    YSWQV+K C+ LS
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197

>PYU1_G001740
Length=206

 Score = 225 bits (574),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 126/163 (77%), Gaps = 2/163 (1%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD-G  82
             ADAHQ+V+LP PT+T   K  +++PLAFLENQGY+T  DFNA+ + KGYK+LRAFMD  
Sbjct  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
             +Y V   AD+ CG+T+  G  QPIP    R+TGYTHDGPCEVWLD T+VL   NCH+ F
Sbjct  84   KAYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDF  142

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             GKT+ + Y++CKGSCTLRWYW+G+RFLK ++SWQVYK CVPL
Sbjct  143  PGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PHYSO_499978
Length=174

 Score = 218 bits (554),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 129/165 (78%), Gaps = 1/165 (1%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPS +S+   A +LSSAALLAPTADAHQ+VL P P +TT+DK TKY PLAFLENQG+ T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDG-TMRSTGYTH  119
             +DF  WR   GYKTLR FMD   YTV  GAD+ CG+TD KG  QPIPDG  MRSTGYTH
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTH  120

Query  120  DGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYW  164
            DGPCEVW+D TRVLQ DNCHE  + K Y +DYS+CKG+CTLRWYW
Sbjct  121  DGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 218 bits (554),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 129/165 (78%), Gaps = 1/165 (1%)

Query  1    MAPsflsslsaaallssaallaPTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET  60
            MAPS +S+   A +LSSAALLAPTADAHQ+VL P P +TT+DK TKY PLAFLENQG+ T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDG-TMRSTGYTH  119
             +DF  WR   GYKTLR FMD   YTV  GAD+ CG+TD KG  QPIPDG  MRSTGYTH
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTH  120

Query  120  DGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYW  164
            DGPCEVW+D TRVLQ DNCHE  + K Y +DYS+CKG+CTLRWYW
Sbjct  121  DGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PHALS_03284
Length=188

 Score = 211 bits (538),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 116/165 (70%), Gaps = 1/165 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P   AHQ++LLP P + T+DK TKY PLAFLENQ + T  DF  + +   Y +LR F+  
Sbjct  9    PNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKR  68

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A+YTV +GAD  CGFTD  G  QPIP G  MR TGYTHDG CE+WLD T+VL   NCH  
Sbjct  69   ANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHND  128

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK   +DYSSCK +C + WYWL VR LKNEYSWQVYKAC+PL+
Sbjct  129  FPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLT  173

>PYU1_G001739
Length=266

 Score = 206 bits (525),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 115/163 (71%), Gaps = 2/163 (1%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-  84
            DAHQ+++ P P +  D K  ++ PLAFLENQG  T  D   + + KGY  LRA MD    
Sbjct  22   DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKL  81

Query  85   YTVADGADYYCGFTDIKGVAQPIPD-GTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            Y V   A + CG+TD    +QPIP  GT+RSTGYTHDGPCEVWLD  +V+  DNCH+ F 
Sbjct  82   YEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFP  141

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            GKT+ LDYSSCKGSCTLRWYWLGVR+LK  YSWQ+YK CV LS
Sbjct  142  GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184

>PPTG_08820
Length=250

 Score = 205 bits (521),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 122/170 (72%), Gaps = 7/170 (4%)

Query  24   TADAHQVVLLPAPTYT--TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD  81
            T DAHQ++L P P +    +D+ T++ PLAFLE+QG+    DFN WR   GYK LR FMD
Sbjct  24   TVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  83

Query  82   GASYT--VADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNC  138
             A YT  V  GAD  CG T++KG  +PIP DG M+STGYTHDGPC V+LD   VL+ DNC
Sbjct  84   RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNC  143

Query  139  HETFSGKTYDLDYSSC--KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            HE   GK+Y +DYSSC  KG CTL W+WLG+RF+K+ +SWQVYK CVPL+
Sbjct  144  HEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLT  193

>PITG_13520
Length=171

 Score = 198 bits (503),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 103/134 (77%), Gaps = 1/134 (1%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLLP P +TT DK TKY PLAFLENQG++T +DF AWR + GYK+LR FMD 
Sbjct  23   PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR  82

Query  83   ASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP  G MRSTGYTHDGPCEVWLD   VL  DNCHE 
Sbjct  83   AKYDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEK  142

Query  142  FSGKTYDLDYSSCK  155
            F GK Y +DYSSCK
Sbjct  143  FPGKDYTVDYSSCK  156

>PPTG_14255
Length=268

 Score = 200 bits (509),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 6/165 (4%)

Query  27   AHQVVLLPAPTYT-----TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD  81
            AHQVV +P+PT+T     + ++   + PL+FLE +GY T E+F  ++ D GYK+LR FMD
Sbjct  21   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  80

Query  82   GASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHE  140
             A Y+V DGAD  CG+TD KGV Q IP DGTMR++GYTHDGPCE+++  T  L   NCHE
Sbjct  81   NAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHE  140

Query  141  TFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            + + +T+ LDYS+C  SC L WYWLGVR+LK +YSWQVYK C+PL
Sbjct  141  SITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PHYSO_343376
Length=172

 Score = 196 bits (498),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 102/131 (78%), Gaps = 1/131 (1%)

Query  35   APTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYY  94
            A  +TT+DK TKY PLAFLENQG+ T +DF AWR   GYKTLR FMD   YTV  GAD+ 
Sbjct  33   AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFS  92

Query  95   CGFTDIKGVAQPIPDG-TMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSS  153
            CG+TD KG  QPIPDG  MRSTGYTHDGPCEVW+D TRVLQ DNCHE  + K Y +DYS+
Sbjct  93   CGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSA  152

Query  154  CKGSCTLRWYW  164
            CKG+CTLRWYW
Sbjct  153  CKGTCTLRWYW  163

>PHYCA_510817
Length=188

 Score = 195 bits (496),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 120/168 (71%), Gaps = 6/168 (4%)

Query  24   TADAHQVVLLPAPTYTTDDKATK-----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRA  78
            + +AHQVV +P+PT+T  +  +K     + PL+FLE +G++T E+F  ++ D GYK+LR 
Sbjct  19   STEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  78

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDN  137
            FM+ A Y V+DGAD  CG++D KG+ Q IP DGTMR++GYTHDGPCE+W+     L   N
Sbjct  79   FMEKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLN  138

Query  138  CHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            CHE+   +T+ LDYS C  SC L WYWLGVR LK +YSWQVYK C+PL
Sbjct  139  CHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PPTG_14254
Length=188

 Score = 192 bits (489),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYTTDDKATK-----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFM  80
            +AHQVV +PAPT+T  +  +K     + PL+FLE +G++T E+F  ++ D GYK+LR FM
Sbjct  21   EAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFM  80

Query  81   DGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCH  139
            D A Y V +GAD  CG+TD KG+ Q IP DGTMR+TGYTHDGPCE+++     L   NCH
Sbjct  81   DRAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  140

Query  140  ETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            E+   +T+ LDYS C  SC L WYWLGVR LK +YSWQVYK C+P+
Sbjct  141  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PHYSO_254168
Length=170

 Score = 189 bits (479),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 107/149 (72%), Gaps = 16/149 (11%)

Query  40   TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTD  99
             +DK TKY PLAFLE QG+ T E F+A RRD GYKTLR FMD   YTV  GADY+CG+T+
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTN  87

Query  100  IKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSC--KGS  157
             KG  QPIP    RSTGYTHDGPCE+WLD  RVL+          ++  +DYSSC  KG 
Sbjct  88   PKGTPQPIP----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGG  133

Query  158  CTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            CT+ WYWLGVRFLKN YSWQVYK C+PL+
Sbjct  134  CTMHWYWLGVRFLKNSYSWQVYKECIPLT  162

>PYAP_22278
Length=289

 Score = 192 bits (489),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 119/170 (70%), Gaps = 8/170 (5%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-  82
            + DAHQ V +PAPT+T +D+   + PLAFLENQG +  +D   + R KG KTLR +MD  
Sbjct  21   SVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNK  80

Query  83   ASYTV-ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQS--DNC  138
            A+Y + A GA + CG+T+  G  QPIP +G MRSTGYTHDGPCEVWLD TRVL S   NC
Sbjct  81   ANYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNC  140

Query  139  HETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFL-KNEYSWQVYKACVPL  185
            H     K  +Y +D+S CKG+C LRWYWLG R +   ++SWQ+YKACVPL
Sbjct  141  HRDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PHYKE_9185
Length=281

 Score = 192 bits (488),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 118/168 (70%), Gaps = 6/168 (4%)

Query  24   TADAHQVVLLPAPTYTTDDKATK-----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRA  78
            T +AHQVV +P+PT+T  +  +K     + PL+FLE +G +T E+F  ++ D  Y +LR 
Sbjct  21   TTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRD  80

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDN  137
            FMD A Y V+DGAD  CG+TD KG+ Q IP DGTMR++GYTHDGPCE+++     L   N
Sbjct  81   FMDKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  140

Query  138  CHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            CHE+ + +T+ LDYS+C  SC L WYWLGVR LK  YSWQ+YK C+PL
Sbjct  141  CHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PHYSO_417649
Length=185

 Score = 189 bits (479),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 6/168 (4%)

Query  24   TADAHQVVLLPAPTYT-----TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRA  78
            + +AHQVV +P+PT+T       ++   + PL+FLE +G++T E+F  ++ D GYK+LR 
Sbjct  17   SVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  76

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDN  137
            FM+ A Y + DGAD  CG+TD KG+ Q IP DGTMR++GYTHDGPCE+++     L   N
Sbjct  77   FMERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  136

Query  138  CHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            CHE+ + +T+ LDYS C  SC L WYWLGVR LK ++SWQVYK C+PL
Sbjct  137  CHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PYIW_18791
Length=194

 Score = 187 bits (475),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 116/165 (70%), Gaps = 4/165 (2%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS  84
            ADAHQ V +P P +T   KAT +APL+FLE  G +T E  + + +DKGY TLRA MD + 
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  85   Y--TVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
               T ++  ++ CG+TD    +Q IP D TMR+TGYTH GPCEVW+D  RV+  DNCHE 
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             S  T  +DYS+CKG CT+RWYWLG+R+LK ++SWQVYK C+ L+
Sbjct  139  VSNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PYAR_24096
Length=227

 Score = 185 bits (470),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 110/165 (67%), Gaps = 4/165 (2%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-AS  84
            +AHQ V LP   YT  ++ T + P A LE QGY+T  DFNA+ +   YKTLR FMD   +
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  85   YTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            Y    GA + CGFTD K  AQPIP DG  R++GYTH+GPCE+W+D  RV   DNCH   S
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  144  GKTY--DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
               +   +DYS+CKG+C L+WYWLG+R     YSWQ+YKAC+PLS
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PHYSO_262732
Length=188

 Score = 183 bits (464),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 114/167 (68%), Gaps = 20/167 (12%)

Query  25   ADAHQVVLLPAPTYT-----TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAF  79
            A+AHQVV +P+PT+T       ++   + PLAFLENQG++T               LR F
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDF  64

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNC  138
            MD A YTV +GAD  CG+TD KG+AQ IP DGTMR++GYTHDGPCE+++     L   NC
Sbjct  65   MDNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNC  124

Query  139  HETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            HE+ + +T+ LDYS C  SCTL WYWLGVRFL N+YSWQVYK C+P+
Sbjct  125  HESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PITG_10499
Length=323

 Score = 187 bits (475),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 115/160 (72%), Gaps = 7/160 (4%)

Query  34   PAPTYT--TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASY--TVAD  89
            P P +    +D+ T++ PLAFLE+QG+   EDFN WR   GYK LR FMD A Y  +V  
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  90   GADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYD  148
            GAD  CG T++KG  +PIP DG MRSTGYTHDGPC ++LD   V++ DNCHE+  G+TY 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  149  LDYSSC--KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            +D+SSC  KG CTL W+WLG+RF+K+ +SWQVYK C+ L+
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PYAP_22279
Length=223

 Score = 183 bits (464),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 114/165 (69%), Gaps = 8/165 (5%)

Query  28   HQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYT  86
            HQ + +PAPT TTD + T   PLAFLENQG +  +D   + R KG KTLR FMD  A+Y 
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  87   V-ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVL--QSDNCHETF  142
            V A GA + CG+TD  G  QPIP +G MRSTGYTHDGPCEVWLD TRVL   S +CH+  
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  143  SGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                 +Y +D+S CKG+C LRWYWL  R + +++SWQVYK CVPL
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PHYCA_536934
Length=983

 Score = 197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 117/166 (70%), Gaps = 6/166 (4%)

Query  26   DAHQVVLLPAPTYT-----TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFM  80
            +AHQVV +P+PT+T     + ++   + PL+FLE +GY T E+F  ++ D GYK LR FM
Sbjct  37   EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  96

Query  81   DGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCH  139
            D A Y V DGAD  CG++D  G+ Q IP DGTMR++GYTHDGPCE+W+     L   NCH
Sbjct  97   DNAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  156

Query  140  ETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            E+ + +T+ LDYS C  SC L WYWLGVR+LK +YSWQVYK C+PL
Sbjct  157  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PYAP_22273
Length=268

 Score = 181 bits (458),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 108/165 (65%), Gaps = 4/165 (2%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-AS  84
            +AHQ V  P   YT  D+ T + P A LENQGY+T +DFNA+    GYKTLR FMD   +
Sbjct  24   EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  83

Query  85   YTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            Y    GA   CG+TD     QPIP +G  R++GYTH+GPCE+W+D   V    NCH   S
Sbjct  84   YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  143

Query  144  GKTY--DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             K +   +DYS+CKG C L+WYWLG+R +  +YSWQ+YKAC+PL+
Sbjct  144  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PHYSO_341596
Length=231

 Score = 179 bits (453),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 94/126 (75%), Gaps = 9/126 (7%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLL        DK TKY PLAFLENQG+ET EDF +WR   GYK+LR FMD 
Sbjct  23   PTADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK  74

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDG-TMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A YTV  GAD+ CGFTD KG  QPIP G  MRSTGYTHDGPCEVWLD T+VL+ DNCHE 
Sbjct  75   AKYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEK  134

Query  142  FSGKTY  147
            F GK Y
Sbjct  135  FPGKDY  140

>PHYCA_14368
Length=219

 Score = 175 bits (444),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 102/163 (63%), Gaps = 44/163 (27%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83
            TA+AHQ+VLLP P +TT+DK TKY PLAFLENQG++T +DF +WR +  YK+LR FMD A
Sbjct  24   TAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNA  83

Query  84   SYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
             YTV DGAD+ CGFTD K                                          
Sbjct  84   KYTVTDGADFSCGFTDPKD-----------------------------------------  102

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
               Y +DYSSCKG+CTLRWYWLG+RFLKN+YSWQVYKAC+PLS
Sbjct  103  ---YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  142

>PYIR_26546
Length=239

 Score = 168 bits (425),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 5/167 (3%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQ-GYETVEDFNAWRRDKGYKTLRAFMDG  82
            TA AHQ+V+LP PT+T + K  ++ P+A+LE Q G+    DFN +   KG+KT+R FMD 
Sbjct  24   TARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDN  83

Query  83   AS-YTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCH-  139
               Y     AD+ CG+T + G  QPIP +  +R+TGYTH+GPCE+WLD  +V    NCH 
Sbjct  84   DKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHY  143

Query  140  ETFSGKTYD-LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            +  SG  +  LD+SSC G CT+ WYW+G+R      SWQ+YK C+PL
Sbjct  144  DVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYSO_246676
Length=187

 Score = 165 bits (417),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 100/165 (61%), Gaps = 39/165 (24%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            PTADAHQ+VLLP P +TT+DK TKY PLAFLENQG++T EDF AWR++ GY+TLR FMD 
Sbjct  6    PTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDK  65

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141
            A Y V  GAD+ CGFTD KG  QPIP+G  MRSTGYTHDG                    
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG--------------------  105

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
                              L    L +  +KN YSW+VYKAC+PLS
Sbjct  106  ------------------LVHASLVLDGMKNSYSWKVYKACIPLS  132

>PHYSO_527908
Length=174

 Score = 161 bits (407),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 102/154 (66%), Gaps = 6/154 (4%)

Query  24   TADAHQVVLLPAPTYTTDDKATK-----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRA  78
            + DAHQVV +P PT+T  +  +      + PLAFLE QG+ T  +F  +  D GYK+LR 
Sbjct  18   SVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRD  77

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDN  137
            FMD  +Y+V  GAD  CG+TD  G+ Q IP DGTMR++G+THD PCE+++     L   N
Sbjct  78   FMDNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPN  137

Query  138  CHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLK  171
            CHE+ + + + LDYS+C  SC L WYWLGVRF+K
Sbjct  138  CHESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PYU1_G001738
Length=226

 Score = 154 bits (388),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 95/161 (59%), Gaps = 2/161 (1%)

Query  27   AHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-Y  85
            A   VL P P Y  D    + AP+A LE QG +T  D + + + KGY  LRA +D    Y
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  86   TVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSG  144
             V   A   CG+TD    +QPIP      STGY  +GPCEVWLD  +V+   NCH  + G
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  145  KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
              + LDYSSCKGSC LRWYWLG++ +   YSWQVYK CV L
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PPTG_17123
Length=201

 Score = 152 bits (385),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 101/161 (63%), Gaps = 2/161 (1%)

Query  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87
            QVVL P P +  D    +   LA+L+ QG  T  +  +W +  GY +LRA +D  S Y V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146
             + A + CG T  +   QPIP + + +++GYT DGPCEVWLD T+V    NCH  F    
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            +++DYSSC  +CTL WYWLG+++++  YSWQVYK CV LST
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197

>HYAP_07096
Length=251

 Score = 152 bits (385),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 102/160 (64%), Gaps = 3/160 (2%)

Query  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87
            QVVL P+P +  DD   +   LA+L+ QG +T  +  +W+++ GY +LRA +D  S Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  88   ADGADYYCGFTDIKGVA-QPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  145
            +  A + CGFT +     Q IP +GT+ S+GYT DGPCEVW D T+V    NC   F   
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  146  TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             + +DYSSC  SCTLRWYWLG++++   YSWQVYK C+ L
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PHYCA_537323
Length=200

 Score = 148 bits (374),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 97/161 (60%), Gaps = 2/161 (1%)

Query  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87
            QVV  P P +  D    +   LA+L+ QG  T  +  +W    GY +LRA +D  S Y V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146
             + A + CG T  K   QPIP + + +++GYT DGPCEVWLD T+V    NCH  F    
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            + +DYSSC  SCTL WYWLG+++++  YSWQVYK CV L T
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGT  196

>PHYRA_81105
Length=201

 Score = 144 bits (364),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 95/159 (60%), Gaps = 2/159 (1%)

Query  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87
            Q+VL P P +  D    +   LA+L+ QG  T  +   W +  GY +LR+ +D  S Y V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146
             + A + CG T  K   Q IP + + +S+GYT DGPCEVWLD T+     NCH  F    
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            + +DYS+C  +C LRWYWLG+++++  YSWQVYK C+ L
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195

>PHYSO_353401
Length=146

 Score = 142 bits (357),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 2/139 (1%)

Query  50   LAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTVADGADYYCGFTDIKGVAQPIP  108
            LA+L+ QG  T  +  +W ++ GY +LRA +D  S Y V + A + CG T  K   QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  109  -DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGV  167
             + + +++GYT DGPCEVWLD T+V    NCH  F    +++DYS+C  SCTL WYWLG+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  168  RFLKNEYSWQVYKACVPLS  186
            ++++  YSWQVYK CV LS
Sbjct  123  KYVEGAYSWQVYKNCVALS  141

>PITG_18452
Length=856

 Score = 153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 2/160 (1%)

Query  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87
            Q+VL P P +  D    +   LA+L+ QG  T  +  +W + +GY +LRA +D  S Y V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146
             + A + CG T  +   QPIP + + +++GYT DGPCE+WLD T+V    NCH  F    
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            + +DYSSC GSC L WYWLG+++++  YSWQVYK CV LS
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

>PHYSO_340369
Length=200

 Score = 139 bits (349),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 94/165 (57%), Gaps = 20/165 (12%)

Query  27   AHQVVLLPAPTYT-----TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD  81
            A+QVV +PAPT+T     TD++   + PLA+ E+QG+ T  +F  W+   G+KTLR FMD
Sbjct  24   ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  83

Query  82   GASYTVADGADYYCGFTDIKGVAQPIPD-GTMRSTGYTHDGPCEVWLDTTRVLQSDNCHE  140
              +Y+V                 Q IPD   MR+ GYT DGPCE+WLD T    S +C  
Sbjct  84   NGNYSVTS--------------PQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLV  129

Query  141  TFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            +    TY LDYS C  SC + WY LGV      YSW+VYK C+PL
Sbjct  130  SLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PYIW_18788
Length=244

 Score = 137 bits (345),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 96/163 (59%), Gaps = 3/163 (2%)

Query  27   AHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-Y  85
            A+  V  P P +  D      A +A LE+Q   T  D   + + KGY +LRA +D  + Y
Sbjct  26   ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  85

Query  86   TVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSG  144
             V   + + CG+TD    +QPIP +G +R TGY  DGPCE+W+D  ++L S NC + F G
Sbjct  86   DVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145

Query  145  KTYDLDYSSCKGSCTLRWYWLGV-RFLKNEYSWQVYKACVPLS  186
             +  LDYSSCKG CTLRWY L V +     YSW+VYK CV LS
Sbjct  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

>PYAP_18131
Length=226

 Score = 121 bits (304),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 8/111 (7%)

Query  81   DGASYTV-ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSD--  136
            D A+Y V A GA + CG TD  G  QPIP +G MRSTG+THDG   VW+D TRVL S   
Sbjct  3    DKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSKLG  60

Query  137  NCHETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            NCH++      +Y +D+S CKG C +RWYWLG+R L  ++SWQVYKAC+P+
Sbjct  61   NCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

>PYIW_18792
Length=125

 Score = 114 bits (286),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 1/101 (1%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASY  85
            DAHQ V LPAPT+T   +A ++ PLAFLE QGY+   DF A+ + KGYK LR FMD    
Sbjct  22   DAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKA  81

Query  86   TVADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEV  125
               DG ++ CG++ +KG  QPIP  G +RSTGYTHDGP  +
Sbjct  82   YKVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PYVX_18179
Length=147

 Score = 114 bits (285),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 80/164 (49%), Gaps = 58/164 (35%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83
             ADAHQ V+LP PT+T++D    Y+PLAFLE+QG+ T EDFN+WR               
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRS--------------  69

Query  84   SYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
                A+G D    F D                                        +  S
Sbjct  70   ----ANGYDTLRAFMD----------------------------------------QAVS  85

Query  144  GKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            GK   +DYSSC GSCTL W+W+GVR+LK  YSWQVYK CVPLST
Sbjct  86   GKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLST  129

>PHYRA_78625
Length=434

 Score = 111 bits (277),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 84/166 (51%), Gaps = 49/166 (30%)

Query  25   ADAHQVVLLPAPTYTTDDKATK-----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRAF  79
            A+AHQVV +P+PT+T  + ++      + PL+FLE +G+ET E+F  ++ D GY +LR F
Sbjct  238  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  297

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCH  139
            +D A Y +A                                            L   NCH
Sbjct  298  LDKAKYKLA--------------------------------------------LSYLNCH  313

Query  140  ETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            E+ + +T+ LDYS C  SC L WYWLG R+LK  YSWQVYK C+ L
Sbjct  314  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYRA_78626
Length=473

 Score = 111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 84/166 (51%), Gaps = 49/166 (30%)

Query  25   ADAHQVVLLPAPTYTTDDKATK-----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRAF  79
            A+AHQVV +P+PT+T  + ++      + PL+FLE +G+ET E+F  ++ D GY +LR F
Sbjct  277  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  336

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCH  139
            +D A Y +A                                            L   NCH
Sbjct  337  LDKAKYKLA--------------------------------------------LSYLNCH  352

Query  140  ETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            E+ + +T+ LDYS C  SC L WYWLG R+LK  YSWQVYK C+ L
Sbjct  353  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PYIR_16444
Length=182

 Score = 104 bits (259),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 90/169 (53%), Gaps = 16/169 (9%)

Query  23   PTADAHQVVLLPAPTYT--TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFM  80
            P  DAH  V +P   +   T + +          +  ++  ++F    + KG+ TLR+++
Sbjct  21   PQVDAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPKNFAKVAKQKGFPTLRSYI  80

Query  81   DGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQSDNC  138
            +        GA   CG T+ K   +PIP DG +  S    H GPCE+WLD  RV Q+DNC
Sbjct  81   EN------KGA--ICGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELWLDNKRVYQNDNC  132

Query  139  HETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
               F  K   + +D+SSCKG+C LR++WLG++       WQVYK CVP+
Sbjct  133  EGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVPV  179

>PHYSO_342364
Length=194

 Score = 104 bits (259),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 93/179 (52%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKA--TKYAPLAFLENQGY----ETVEDFNAWRRDKGYKTL  76
            P ADAH  + +P   +   + +  +   P  +  N  Y    ++V+ FN+ +    YK L
Sbjct  19   PGADAHGYIYVPQSQFFGGENSQWSVQIPPVWPSNDWYGNTQKSVQVFNSLKTSHNYKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIPDG--TMRSTGYTHDGPCEVWLDTTRVLQ  134
            R  +D    T   G +  CG+T+  G  QPIP     + S G  H GPCE+WLD  +V+ 
Sbjct  79   RTLLDN---TAVYGPN--CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDDKKVMA  133

Query  135  SDNC-----HETFSGKT-YDLDYSSCK--GSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            +D+C     H   + KT + +DYS CK  G C +R+YWLG + L  +  WQ YK C+PL
Sbjct  134  ADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPL  192

>PYIR_16435
Length=304

 Score = 106 bits (264),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 76/127 (60%), Gaps = 14/127 (11%)

Query  63   DFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHD  120
            +F    ++KGY TLR++++             CG T+     + IP D T++ S    H 
Sbjct  66   NFATVSKEKGYSTLRSYIEDKGT--------LCGRTNPDATPKAIPSDNTVKFSRAIVHP  117

Query  121  GPCEVWLDTTRVLQSDNCHETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+WLD  RV+Q DNC  TF  K  T+ +D+SSCKGSC LRW+WLG++   +   WQV
Sbjct  118  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQV  175

Query  179  YKACVPL  185
            YK CVPL
Sbjct  176  YKNCVPL  182

>PYVX_18175
Length=147

 Score = 100 bits (249),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 79/167 (47%), Gaps = 63/167 (38%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            P ADAHQ V+LP P++TT D+   Y+PLAFLENQ               G+KT   F   
Sbjct  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDF---  64

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142
            +++  A+G      F D                                           
Sbjct  65   SAWRRANGYKTLRSFMD-------------------------------------------  81

Query  143  SGKTYD--LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            SGK  D  +DYSSCKGSCTL WYW+GVR+LK  YSWQVYK CVPLST
Sbjct  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLST  128

>PYIW_19151
Length=248

 Score = 102 bits (254),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 85/130 (65%), Gaps = 14/130 (11%)

Query  62   EDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTH  119
            ++F A  ++KG+ TLR++++        GA   CGFTD K   + IP D T+R S    H
Sbjct  59   KNFAAAAKEKGFSTLRSYLED------KGA--VCGFTDPKVSPRAIPADRTIRFSRDIPH  110

Query  120  DGPCEVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQ  177
             GPCE+++D TRV Q+D+C   F+G   ++D+D+S CKG C +R+YWLG++   +   WQ
Sbjct  111  PGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQ  168

Query  178  VYKACVPLST  187
            VYK+CVP+S+
Sbjct  169  VYKSCVPVSS  178

>PHYCA_130365
Length=266

 Score = 102 bits (253),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 88/177 (50%), Gaps = 22/177 (12%)

Query  27   AHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYE-TVEDFNAWRRDKGYKTLRAF  79
            AH  +  P P++    T D   +  P     + E++G E  +  F        YK +R+ 
Sbjct  22   AHGYIAKPEPSWKGKKTSDWVVEIEPQWKGGWDESKGDEGLLATFKELAASNNYKDVRSM  81

Query  80   MDGASYTVADGADYYCGFTDIKGV-AQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQSDN  137
            MDG S    D     CGFTD  G    P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  82   MDGNSVYGED-----CGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  136

Query  138  CHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            C   +   T D       +DYSSC  G C LR+YWLG++ L  +  WQ YK C+PL+
Sbjct  137  CQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAYKNCIPLT  193

>PHYSO_438103
Length=238

 Score = 101 bits (251),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 88/179 (49%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P+ADAH  +L+P   +T    +     +  +      +     +VE F + +    +K L
Sbjct  18   PSADAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDL  77

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S    D     CGFTD  G  QPIP DG    S    H GPCE+WLD T+VL 
Sbjct  78   KTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLY  132

Query  135  SDNCHETFSGKTYDL------DYSSCK-GSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  +  D+      DYSSC  G C  +R+YWL  + L ++  WQ YK C+PL
Sbjct  133  EDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PYU1_G007476
Length=195

 Score = 99.8 bits (247),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 72/132 (55%), Gaps = 17/132 (13%)

Query  61   VEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM----RST  115
            + DF    + KGYKTLR+F++    +        CG+T+     + IP DG +     + 
Sbjct  63   MNDFARISKQKGYKTLRSFLENKGAS--------CGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNE  173
            G+ H GPCE+WLD   +L  DNC + F G      +D+SSCKG+C LR YWLG  F    
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  174  YSWQVYKACVPL  185
              WQ YK CVP+
Sbjct  173  QRWQTYKYCVPV  184

>PHYKE_8104
Length=86

 Score = 95.9 bits (237),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)

Query  23  PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
           PTADAHQ+VLLP PT+TT+DK TKY PLAFLE +G+   EDF AWR + GYK+LR FMD 
Sbjct  23  PTADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN  82

Query  83  ASY  85
           A Y
Sbjct  83  AKY  85

>PYIR_16443
Length=275

 Score = 100 bits (250),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 91/170 (54%), Gaps = 23/170 (14%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLE-----NQGYETVEDFNAWRRDKGYKTLR  77
            P  +AH  + +P   +    K TKY     +E        ++  ++F    + KG++TLR
Sbjct  21   PQVNAHGFIEVPKSEFV---KGTKYPSEWIVEFPPPWEGNWKDPKNFATVSKQKGFETLR  77

Query  78   AFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR--STGYTHDGPCEVWLDTTRVLQS  135
            ++++        GA   CG T+     + IP  ++   S    H GPCE+WLD  RV+Q 
Sbjct  78   SYIEDK------GA--LCGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQD  129

Query  136  DNCHETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY-KAC  182
            DNC  TF  K  T+ +D+SSCKGSC LRW+WLG++   +   WQVY K+C
Sbjct  130  DNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PHYRA_73582
Length=326

 Score = 101 bits (252),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 91/177 (51%), Gaps = 23/177 (13%)

Query  27   AHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYETV-EDFNAWRRDKGYKTLRAF  79
            AH  +  PAPT+    T+D   + APL    + E++G + +   F        YK L+  
Sbjct  23   AHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTL  82

Query  80   MDGASYTVADGADYYCGFTDIKGV-AQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQSDN  137
            MDG  +    G D  CGFTD  G  + P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGPEF----GED--CGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  136

Query  138  CHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            C   +   T +       +DYS C  G C LR+YWL ++ L  +  WQ YK C+PL+
Sbjct  137  CQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPLT  193

>PYIW_18790
Length=86

 Score = 95.5 bits (236),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)

Query  31   VLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASYTVADG  90
            VLLP PT+T   +A ++ PLAFLENQG++T  DF A+ RDKGYKTLR FMD  +    DG
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVDG  64

Query  91   ADYYCGFTDIKGVAQPIP  108
             D+ CG++ +KG  QPIP
Sbjct  65   GDFECGWSTLKGTPQPIP  82

>PPTG_04618
Length=326

 Score = 101 bits (252),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 90/177 (51%), Gaps = 22/177 (12%)

Query  27   AHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYETV-EDFNAWRRDKGYKTLRAF  79
            AH  +  PAP++    T+D   +  P     + E++G E +   F        YK +R+ 
Sbjct  23   AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKDVRSL  82

Query  80   MDGASYTVADGADYYCGFTDIKGV-AQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQSDN  137
            MDG      D     CGFTD KG  ++P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGNPVYGED-----CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  138  CHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            C   +   T         +DYSSC  G C LR+YWL ++ L  +  WQ YK C+PL+
Sbjct  138  CQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLT  194

>PYAP_24689
Length=252

 Score = 100 bits (248),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 87/174 (50%), Gaps = 23/174 (13%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQG------YETVEDFNAWRRDKGYKTL  76
            P ADAH  V  P   +      TKY P +++   G        T   ++A R+  G KTL
Sbjct  21   PQADAHTYVSQPRAEFKP---GTKY-PSSWVAEFGPPWPGTIRTGAQYDAVRKKHGVKTL  76

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            RAF++             CG T+     +PIP DG ++  +   H GPCE+W D TRV  
Sbjct  77   RAFLESKGPV--------CGSTNPNAKRKPIPRDGLIKFGSSMEHPGPCEIWFDNTRVFV  128

Query  135  SDNCHETFSGKT-YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
              +C++ F   T + +DYS C+G C LR+YWLG++       WQ YK CVPL  
Sbjct  129  DADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYKNCVPLGN  180

>PYAP_18709
Length=235

 Score = 99.4 bits (246),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 91/169 (54%), Gaps = 16/169 (9%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLE---NQGYETVEDFNAWRRDKGYKTLRAFM  80
             AD H  V L  P       A+K + +A  +   +  ++T   + A    KG+K LR+F+
Sbjct  17   VADVHAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSFL  76

Query  81   DGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQSDNC  138
            +    T        CG +      +PIP DGT++ ++   H GPCEVWLD TR   +D+C
Sbjct  77   EDKGPT--------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRAFHNDDC  128

Query  139  HETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             + F S  ++ +D+ +CKGSC LR+YWLG++       WQ YK C+PL+
Sbjct  129  EKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PYU1_G005324
Length=191

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-ST  115
            + T   + A    KGYK L++F+D    T        CG T     A+ IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +TF S  ++ +D+S+CKG+C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLST  187
             WQ YK CVPL +
Sbjct  165  RWQSYKNCVPLKS  177

>PYU1_G005326
Length=191

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-ST  115
            + T   + A    KGYK L++F+D    T        CG T     A+ IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +TF S  ++ +D+S+CKG+C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLST  187
             WQ YK CVPL +
Sbjct  165  RWQSYKNCVPLKS  177

>PYU1_G005328
Length=191

 Score = 97.4 bits (241),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 76/133 (57%), Gaps = 13/133 (10%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-ST  115
            + T   + A    KGYK L++F+D    T        CG T     A+ IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +TF S  ++ +D+S+CKG+C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPLST  187
             WQ YK CVPL +
Sbjct  165  RWQSYKNCVPLKS  177

>PHYRA_78689
Length=296

 Score = 99.8 bits (247),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 89/179 (50%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P+ADAH  +L+P   +     +     +  +      +    ++V+ F + +    +K L
Sbjct  19   PSADAHGYMLIPESQFKGSASSAWVVQIDPVWTSDKWDGNNPQSVDTFKSLKTANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G  QPIP DG    S    H GPCE+WLD T+VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDDTKVLY  133

Query  135  SDNCHETFSGKTYDL------DYSSCK-GSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  +  D+      DYSSC  G C  +R+YWL  + L ++  WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>PHYCA_127270
Length=279

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P+ DAH  +L+P   +     +     +  +      +    ++V+ F + +    +K L
Sbjct  19   PSVDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNPQSVDTFKSLKAANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G  QPIP DG    S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDDKKVLY  133

Query  135  SDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  K  D+      DYSSC  G C  +R+YWL  + L  +  WQ YK C+PL
Sbjct  134  EDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKDCIPL  192

>PYU1_G005325
Length=207

 Score = 96.7 bits (239),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 13/131 (10%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-ST  115
            + T   + A    KGYK L++F+D    T        CG T     A+ IP DG ++ ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               H GPCE+WL  TR   +D+C +TF S  ++ +D+S+CKG+C LR+YWLG++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  175  SWQVYKACVPL  185
             WQ YK C+PL
Sbjct  165  RWQSYKNCIPL  175

>PHYSO_483955
Length=320

 Score = 99.0 bits (245),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 90/178 (51%), Gaps = 24/178 (13%)

Query  27   AHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYETV-EDFNAWRRDKGYKTLRAF  79
            AH  +  P P++    T+D   +  P     + E++G E +   F        YK +R+ 
Sbjct  23   AHGYIAKPEPSWKDKKTNDWVVEIEPQWKGGWDESKGDEGLLATFKELSAANNYKDVRSL  82

Query  80   MDGASYTVADGADYYCGFTDIKG--VAQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQSD  136
            MDG      D     CGFTD KG  VA P  DGT   S G  H GPCE+WLD   VLQ+D
Sbjct  83   MDGNPVYGED-----CGFTDPKGKPVAPPT-DGTATFSRGIVHAGPCEIWLDDKMVLQND  136

Query  137  NCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            +C   +   T +       +DYSSC  G C LR+YWL ++ L  +  WQ YK C+PL+
Sbjct  137  DCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLT  194

>H310_06362
Length=197

 Score = 96.3 bits (238),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 24/126 (19%)

Query  72   GYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM------RSTGY--THDGP  122
            G+KTLRA +D        G D  CG+T +   A+PIP DG +         G+  +H GP
Sbjct  51   GFKTLRAMLD------PHGPD--CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTGP  102

Query  123  CEVWLDTTRVLQSDNCHETFSGK---TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            CE+WLD TRV Q++NC   F  K      +D+SSC GSCT+R+YWL +    +E  WQVY
Sbjct  103  CEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLWQVY  158

Query  180  KACVPL  185
            K C PL
Sbjct  159  KNCAPL  164

>PITG_04949
Length=337

 Score = 99.0 bits (245),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 91/177 (51%), Gaps = 22/177 (12%)

Query  27   AHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYETV-EDFNAWRRDKGYKTLRAF  79
            AH  +  PAP++    T++   +  P     + E++G E +   F        +K +R+ 
Sbjct  23   AHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKDVRSL  82

Query  80   MDGASYTVADGADYYCGFTDIKG-VAQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQSDN  137
            MDG      +     CGFTD KG  ++P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGNPVFGEE-----CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  138  CHETFSGKTYD-------LDYSSCK-GSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            C   +   T         +DYSSC  G C LR+YWL ++ LK +  WQ YK C+PL+
Sbjct  138  CQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPLT  194

>PITG_05271
Length=278

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 88/179 (49%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKA---TKYAPLAFLEN---QGYETVEDFNAWRRDKGYKTL  76
            P+ DAH  +L+P   +     +    +  P+   E+       +V  F A +    +K L
Sbjct  19   PSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVNAFKALKTANKFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G AQPIP DG    S    H GPCE+WLD T+VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDDTKVLY  133

Query  135  SDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  +  D+      DYSSC  G C  +R+YWL  + +  +  WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PYIW_27477
Length=180

 Score = 95.1 bits (235),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 87/163 (53%), Gaps = 22/163 (13%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLE-----NQGYETVEDFNAWRRDKGYKTLRAFM  80
            +AH  V +P   + +    T Y     +E        ++   +F    ++KG++TLR   
Sbjct  1    NAHGFVEVPKSEFPS---GTSYPSEWIVEFAPPWEGSWKDPANFAKVSKEKGFETLR---  54

Query  81   DGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQSDNC  138
               SY    GA   CG TD    A+ IP D  ++ S    H GPCE+W+D TRV+Q DNC
Sbjct  55   ---SYIEDKGAK--CGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCELWIDDTRVMQDDNC  109

Query  139  HETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
             +TF  K  T+ +D+S+CKG C LRW+WLG++   +   WQVY
Sbjct  110  EKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PYAP_18711
Length=210

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 88/171 (51%), Gaps = 23/171 (13%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQG------YETVEDFNAWRRDKGYKTLRAF  79
            DAH  V  P   +      TKY P  ++   G      + T   ++A R+ +G K LRAF
Sbjct  21   DAHTYVKSPLAEFKA---GTKY-PSEWVAEFGPPWSGTFRTGAQYDAERKKRGIKNLRAF  76

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQSDN  137
            ++      + G +  CG T+     +PIP DG ++  +   H GPCEVW D T V    +
Sbjct  77   LE------SKGPE--CGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEVWFDNTLVFSEVD  128

Query  138  CHETFSGKT-YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            C + F   T + +DYS CKG+C LR+YWLG++       WQ YK CVP+ +
Sbjct  129  CEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIGS  177

>PITG_19818
Length=147

 Score = 93.2 bits (230),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)

Query  23  PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82
           PTADAHQ+VLLP P +TT DK TKY PLAFLENQG++  +DF AWR + GYK+LR FMD 
Sbjct  21  PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80

Query  83  AS  84
           A+
Sbjct  81  AN  82

>H257_13550
Length=266

 Score = 96.3 bits (238),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 80/142 (56%), Gaps = 27/142 (19%)

Query  59   ETVEDFNAWRRDK---GYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM--  112
            + V  FN   RD+   G+KTLRA +D        G D  CG++ +   A+PIP DG +  
Sbjct  90   KNVAAFNKAFRDQQATGFKTLRAMLD------PQGPD--CGYSKLDVPAKPIPSDGNVVW  141

Query  113  ----RSTGY--THDGPCEVWLDTTRVLQSDNCHETFSGKT---YDLDYSSCKGSCTLRWY  163
                   G+  +H GPCE+WLD TRV Q+D+C   F  K      +D++SC GSCT+R+Y
Sbjct  142  QNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFY  201

Query  164  WLGVRFLKNEYSWQVYKACVPL  185
            W+ +    ++  WQVYK C PL
Sbjct  202  WIAL----HQDLWQVYKNCAPL  219

>PHYSO_340333
Length=284

 Score = 96.7 bits (239),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P+ADAH  +L+P   +     +     +  +      +     +V+ F A +    +K L
Sbjct  19   PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G  QPIP DG    S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLY  133

Query  135  SDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  +  D+      DYSSC  G C  +R+YWL  + +  +  WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYSO_340332
Length=295

 Score = 96.7 bits (239),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P+ADAH  +L+P   +     +     +  +      +     +V+ F A +    +K L
Sbjct  19   PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G  QPIP DG    S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLY  133

Query  135  SDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  +  D+      DYSSC  G C  +R+YWL  + +  +  WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYSO_533682
Length=278

 Score = 96.3 bits (238),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 87/179 (49%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            PTADAH  +  PA  +     +     +  +      +     +VE F +++    +K L
Sbjct  19   PTADAHGYIAKPASQFKGAANSAWVVQIDPVWKSDKWDGNNPGSVEVFTSFKSVNNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S    D     CGFTD  G  QPIP DG    S G  H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRGLIHVGPCEIWLDDNKVLS  133

Query  135  SDNCHETFSGK------TYDLDYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C+  +         T+ +DYSSC  G C  +R Y LG + L ++  WQ YK C+PL
Sbjct  134  EDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTVWQSYKNCIPL  192

>PYVX_14662
Length=540

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 78/141 (55%), Gaps = 17/141 (12%)

Query  55   NQGYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR  113
            NQG  +V+ + +   +KG   +R+ +D  S    D     CGFTD  G AQ IP DG   
Sbjct  60   NQG--SVDTYKSLAAEKGVTEIRSLLDDTSIYGQD-----CGFTDPDGTAQDIPTDGKAT  112

Query  114  -STGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYD------LDYSSCK-GSCT-LRWYW  164
             S G  H GPCE+WLD T VL  D+C+ T+ G   D      +DYSSC  G C  +R+YW
Sbjct  113  FSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYW  172

Query  165  LGVRFLKNEYSWQVYKACVPL  185
            L  + +  +  WQVYK C+PL
Sbjct  173  LAFQGVDGDTVWQVYKNCIPL  193

>PHYKE_6001
Length=289

 Score = 95.9 bits (237),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKA---TKYAPLAFLEN---QGYETVEDFNAWRRDKGYKTL  76
            P ADAH  +L+P   +     +    +  P+   E+      ++V  FNA ++   Y  L
Sbjct  19   PRADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTAFNALKKANNYVDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G  QPIP DG    S    H GPCE+WLD   V  
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDDKMVFS  133

Query  135  SDNCHETFSGKTYD------LDYSSCKGSC--TLRWYWLGVRFLKNEYSWQVYKACVPL  185
             ++C+  +  +  D      +DYSSC G     +R+YWL  + +  +  WQ YK C+PL
Sbjct  134  DEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPL  192

>PHYRA_74651
Length=344

 Score = 96.7 bits (239),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 73/134 (54%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            + + +   GY  +R  +D  S T   GAD  CGFTD     +  P   D T  S G  H 
Sbjct  69   YTSLKESNGYSDIRTLLD--SDTSLYGAD--CGFTDPNATPKDPPSTGDATF-SRGMVHA  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKN  172
            GPCE+WLD T+VL +DNC   +   T +       +DYSSC  G CTLR+YWL  + L +
Sbjct  124  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  183

Query  173  EYSWQVYKACVPLS  186
               WQVYK CVPL+
Sbjct  184  STVWQVYKNCVPLT  197

>PHYCA_534296
Length=309

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 74/136 (54%), Gaps = 15/136 (11%)

Query  60   TVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGY  117
            +VE F + +    +K L+  MD  S   AD     CGFT+  G AQPIP DG    S   
Sbjct  36   SVETFKSLKSANNFKDLKTLMDDTSVYGAD-----CGFTNPSGTAQPIPTDGKATFSRAL  90

Query  118  THDGPCEVWLDTTRVLQSDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVRF  169
             H GPCE+WLD T+VL  D+C+  +  +  D+      DYSSC  G C  +R+YWL  + 
Sbjct  91   VHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQG  150

Query  170  LKNEYSWQVYKACVPL  185
            +  +  WQ YK C+PL
Sbjct  151  VDGKTVWQSYKDCIPL  166

>PYU1_G014690
Length=295

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 74/127 (58%), Gaps = 14/127 (11%)

Query  63   DFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP--DGTMRSTGYTHD  120
            +F    ++KG+ TLR++++        GA   CG TD     + IP  +    S    H 
Sbjct  62   NFAKVSKEKGFDTLRSYIED------KGA--LCGKTDPNATPKAIPSDNKVHFSRPIVHP  113

Query  121  GPCEVWLDTTRVLQSDNCHETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+WLD  RV+Q D+C  TF  +   +++D+SSCK +C LR++WLG++   +   WQV
Sbjct  114  GPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQV  171

Query  179  YKACVPL  185
            YK CVPL
Sbjct  172  YKNCVPL  178

>PHYCA_12942
Length=353

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 83/177 (47%), Gaps = 29/177 (16%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLR  77
            P ADAH  +  P PT+  D  + ++  +  ++N      G + V  F     ++G     
Sbjct  18   PNADAHGSLKQPKPTF--DGSSAEW--VTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKD  73

Query  78   AFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTR  131
              +D          D  CG+T      QPIP DG ++       G+TH GPCE+++D   
Sbjct  74   VILDMVK-------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKM  126

Query  132  VLQSDNCHETFSG---KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            VL  DNC E F G       +DYSSC G+C L  YWLG +  +    WQ Y  CVPL
Sbjct  127  VLHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PYU1_G005323
Length=251

 Score = 93.6 bits (231),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 13/132 (10%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-ST  115
            + T   + A    KGYK L++F++             CG +     A+PIP DG ++ ++
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV--------CGNSLPDAKAKPIPSDGVIKLAS  105

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               H GPCEVW D  R    D+C +TF S  ++ +D+S+CKGSC LR+YWLG++      
Sbjct  106  TIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGK  163

Query  175  SWQVYKACVPLS  186
             WQ YK C+PL+
Sbjct  164  RWQSYKNCIPLT  175

>PYAR_14260
Length=212

 Score = 92.0 bits (227),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 13/131 (10%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-ST  115
            ++T   + A    KG+K LR+F++    T        CG +      +PIP DG ++ ++
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT--------CGNSLSSAKPKPIPSDGMVKFAS  82

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               H GPCE+WLD T    SD+C + F S  +  +++S+CKGSC LR+YWLG++   +  
Sbjct  83   TLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGT  140

Query  175  SWQVYKACVPL  185
             WQ YK CVPL
Sbjct  141  RWQSYKNCVPL  151

>PHYSO_533903
Length=208

 Score = 91.7 bits (226),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 93/181 (51%), Gaps = 22/181 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPL--AFLENQGY----ETVEDFNAWRRDKGYKTL  76
            P  DAH  + +P   +   + +     +   +  +  Y    ++VE F + +    +K L
Sbjct  20   PGVDAHGYIYVPQSQFKGGENSQWLVQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDL  79

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DG-TMRSTGYTHDGPCEVWLDTTRVLQ  134
            +  +D  S    D     CGFTD  G  QPIP DG  + S G  H GPCE WLD  +VL 
Sbjct  80   KTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  135  SDNC-----HETFSGKT-YDLDYSSCK-GSC-TLRWYWLGVRFLKNEYS-WQVYKACVPL  185
            +D+C     H   + KT + +DYSSC+ G C  +R+YWLG + L ++ + WQ YK C+PL
Sbjct  135  ADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYKDCIPL  194

Query  186  S  186
             
Sbjct  195  Q  195

>PHYKE_6002
Length=197

 Score = 91.3 bits (225),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 85/168 (51%), Gaps = 18/168 (11%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P  +AH  +L+P   +  D  +     +A +      +    ++V  F++ ++   +  L
Sbjct  19   PQVNAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G  QPIP DG    S    H GPCE+WLD+T+   
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFS  133

Query  135  SDNCHETFSGKTYDLDYSSCK-GSCT-LRWYWLGVRFLKNEYSWQVYK  180
             DNC +    +T+ +DYSSC  G C  +R+YWL  + L ++  WQ Y+
Sbjct  134  KDNCADM---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PHYKE_10578
Length=239

 Score = 92.0 bits (227),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 86/181 (48%), Gaps = 32/181 (18%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLRAF  79
            ADAH  + +P PT+      + +  L  ++N      G + V  F     +KG       
Sbjct  20   ADAHGALKVPEPTFEQGASHSNWVTL--VDNYWDIGSGGDQVGKFKTMATEKGMSVKDVI  77

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM-----RSTGYTHDGPCEVWLDTTRVL  133
            +D          D  CGFT      QP+P DG +      + G+TH GPCEV++D   VL
Sbjct  78   LDMVK-------DKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVL  130

Query  134  QSDNCHETF------SGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
              DNC + +      SGK  ++  DYSSC G C L +YWLG    +NE  WQ Y  CVPL
Sbjct  131  HGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLG---FQNE-QWQSYVNCVPL  186

Query  186  S  186
            +
Sbjct  187  T  187

>PHYRA_73607
Length=343

 Score = 94.0 bits (232),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 74/134 (55%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +++ +   GY  +R  +D  S T   GAD  CGFT+    A+  P   D T  S G  H 
Sbjct  69   YSSLKSSNGYSDIRTLLD--SDTSLYGAD--CGFTNPDATAKDPPTTGDATF-SRGMVHV  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKN  172
            GPCE+WLD T+VL +DNC   +   T D       +DYSSC  S C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  EYSWQVYKACVPLS  186
               WQVYK CVPL+
Sbjct  184  SMVWQVYKNCVPLT  197

>PHYRA_86151
Length=170

 Score = 90.1 bits (222),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 1/84 (1%)

Query  40   TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTD  99
            T+  A +   L+FLE +G+ET E+F  ++ D GY +LR F+D A Y V+DGAD  CG++D
Sbjct  19   TNVDAIQLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSD  78

Query  100  IKGVAQPIP-DGTMRSTGYTHDGP  122
             KG+ Q IP DGTM  +GYTHD P
Sbjct  79   PKGIPQQIPEDGTMSPSGYTHDAP  102

>PYAR_24113
Length=192

 Score = 90.5 bits (223),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 82/174 (47%), Gaps = 19/174 (11%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYET--------VEDFNAWRRDKGYKTLR  77
            DAH  ++ PAP YTT+   +    +  L+    +T           FNA  ++  YK+L+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  78   AFMDGASYTVADGADYYCGFTDIKGVA-QPIPDGTM--RSTGYTHDGPCEVWLDTTRVLQ  134
              +   +  V+ GA   CGF  + G   QP+PD       TG +H GPCEVW D     Q
Sbjct  80   ELVL-QNQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTG-SHTGPCEVWCDNNLAFQ  137

Query  135  SDNCHETFSGKTYDLDYS--SCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             DNC +   G    L+Y   +C G+  L  YW+ +   +    WQVY  C PLS
Sbjct  138  DDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAPLS  187

>PHYRA_87941
Length=157

 Score = 89.4 bits (220),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 1/84 (1%)

Query  40   TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTD  99
            T+  A +   L+FLE +G+ET E+F  ++ D GY +LR F+D A Y V+DGAD  CG++D
Sbjct  6    TNVDAIQLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSD  65

Query  100  IKGVAQPIP-DGTMRSTGYTHDGP  122
             KG+ Q IP DGTM  +GYTHD P
Sbjct  66   PKGIPQQIPEDGTMSPSGYTHDAP  89

>PHALS_03176
Length=207

 Score = 89.4 bits (220),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 73/137 (53%), Gaps = 16/137 (12%)

Query  59   ETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STG  116
            ++V+ F   +    +K L+  MD    T A GA   CGF+D KG  QPIP DG    S  
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMD----TSAFGAK--CGFSDPKGKPQPIPKDGKATFSRA  114

Query  117  YTHDGPCEVWLDTTRVLQSDNCHETFSG------KTYDLDYSSC-KGSCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C+  +          + +DYSSC  G C  +R+YWL  +
Sbjct  115  IVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQ  174

Query  169  FLKNEYSWQVYKACVPL  185
             +  +  WQ YK C+PL
Sbjct  175  GVNGKTVWQSYKNCIPL  191

>PPTG_04622
Length=273

 Score = 90.9 bits (224),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 73/134 (54%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            + + +   GY  +RA +D  S T   GA+  CGFTD     +  P   D T  S G  H 
Sbjct  69   YTSLKESNGYSDIRALLD--SDTDLYGAN--CGFTDPDATPKDPPTTGDATF-SRGMVHA  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCK-GSCTLRWYWLGVRFLKN  172
            GPCE+WLD T VL +D+C   +   T D       +DYSSC  G C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDS  183

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK CVPL+
Sbjct  184  KMVWQVYKDCVPLT  197

>PYAR_14256
Length=199

 Score = 89.0 bits (219),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (55%), Gaps = 12/130 (9%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-STG  116
            + T   + A   DKG+K LRAF++    T        CG T      +P     ++ ++ 
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGPT--------CGNTLPNAKPKPXXXXLIKLAST  102

Query  117  YTHDGPCEVWLDTTRVLQSDNCHETF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYS  175
              H GPCE+WLD +     D+C + F S  ++ +D+S+CKGSC LR+YWLG++   +   
Sbjct  103  IEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKR  160

Query  176  WQVYKACVPL  185
            WQ YK C+PL
Sbjct  161  WQSYKNCIPL  170

>PPTG_14221
Length=275

 Score = 90.1 bits (222),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 21/179 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFL------ENQGYETVEDFNAWRRDKGYKTL  76
            P+ +AH  +L+P   +     +     +  +      +    ++V+ F + +    +K L
Sbjct  19   PSVEAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNPKSVDTFKSLKAANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFT+  G  QPIP DG    S    H GPC +WLD   VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTNPNGTPQPIPTDGKATFSRALVHHGPCGIWLDDKMVLY  133

Query  135  SDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C   +  +  D+      DYSSC  G C  +R+YWL  + L  +  WQ YK C+PL
Sbjct  134  EDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSYKDCIPL  192

>PPTG_07507
Length=299

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 83/182 (46%), Gaps = 32/182 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLR  77
            PTADAH  +  P  T+  +D A     +  ++N      G + V  F    ++KG     
Sbjct  17   PTADAHGNLKEPPATF--EDGAPTVEWVTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  74

Query  78   AFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTR  131
              +D          D  CG+T      +PIP DG ++       G+TH GPCE+++D   
Sbjct  75   VVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  132  VLQSDNCHETFSG--------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VL  DNC E F G            +D+SSC G CTL  YWLG +  +    WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCV  183

Query  184  PL  185
            PL
Sbjct  184  PL  185

>SPRG_07796
Length=322

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 86/178 (48%), Gaps = 25/178 (14%)

Query  25   ADAHQVVLLPAPTYT-----------TDDKATKYAPLAFLENQGYETVEDFNAWRRDKGY  73
            AD H  ++ P PT+            T D  T     ++ ++  + T++ F    +   +
Sbjct  16   ADGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQ-FTTQFKASPF  74

Query  74   KTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----THDGPCEVWLD  128
            +TL AF+D  S  VA      CG T+  G AQP+P     + G      +H+GPCEVW D
Sbjct  75   RTLAAFVD--SQNVASCGR--CGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCD  130

Query  129  TTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            +TRV Q+DNC          +D + C G+  LR  WL +    +  SWQVY  CVPLS
Sbjct  131  STRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPLS  184

>PYU1_G007364
Length=316

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 70/132 (53%), Gaps = 23/132 (17%)

Query  66   AWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRS-------TGY-  117
            A++    Y +LR  + G       G D  CG T +    +PIP   M S        G+ 
Sbjct  82   AFQASGKYASLRDLLQG------HGED--CGNTKLDATPKPIPSDGMVSWQNPDTNEGFV  133

Query  118  -THDGPCEVWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEY  174
             +H GPCE+WLD T VL+ +NC   F G    +  D+SSC G C +R+YWL ++    E 
Sbjct  134  PSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EP  189

Query  175  SWQVYKACVPLS  186
            +WQ+YK C+PL+
Sbjct  190  AWQIYKNCIPLA  201

>PHYRA_85794
Length=230

 Score = 87.4 bits (215),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 80/181 (44%), Gaps = 31/181 (17%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLRAF  79
            A+AH  +  P PT+   D A+    +  ++N      G + V  +     +KG       
Sbjct  20   AEAHGHLNQPQPTF--QDGASTVNWVVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVV  77

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR------STGYTHDGPCEVWLDTTRVL  133
            +D        GAD  CGFT      QP+P             GYTH GPCE+++D   VL
Sbjct  78   LDMV------GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVL  131

Query  134  QSDNCHETFSGKTYD--------LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             SDNC   + G   D        +DYSSC G CT   YWLG +  +    WQ Y  CVPL
Sbjct  132  HSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

Query  186  S  186
            S
Sbjct  188  S  188

>PPTG_07509
Length=299

 Score = 88.6 bits (218),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 82/182 (45%), Gaps = 32/182 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLR  77
            P ADAH  +  P  T+  +D A     +  ++N      G + V  F    ++KG     
Sbjct  17   PIADAHGNLKEPPATF--EDGAPTVEWVTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  74

Query  78   AFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTR  131
              +D          D  CG+T      +PIP DG ++       G+TH GPCE+++D   
Sbjct  75   VVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  132  VLQSDNCHETFSG--------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VL  DNC E F G            +D+SSC G CTL  YWLG +  +    WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCV  183

Query  184  PL  185
            PL
Sbjct  184  PL  185

>PYIW_24289
Length=196

 Score = 86.3 bits (212),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 76/178 (43%), Gaps = 23/178 (13%)

Query  26   DAHQVVLLPAPTYTTDDK-----ATKYAP--LAFLENQGYETVEDFNAWRRDKG------  72
            D H  + +P PT+TT        AT   P  L   E   Y    + NA            
Sbjct  24   DGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTAFSSQTD  83

Query  73   ---YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDT  129
               Y+ LR  +D  +   A G D  CGFT++    QP+          TH GPCE+W D 
Sbjct  84   SIKYRNLRDLIDTKAVFSA-GTDKECGFTNVTSAKQPLSAHATGGFTPTHQGPCEIWCDR  142

Query  130  TRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
              V Q+DNC + +      L Y  S C G+  L++YWL V  +K    W+ Y  C PL
Sbjct  143  VLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

>PHYKE_7717
Length=568

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)

Query  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            F GK Y +DYS+CKG+CTLRWYWLGVRFLKN YSWQVYKAC+PL+
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>PHYRA_77971
Length=230

 Score = 87.0 bits (214),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 80/181 (44%), Gaps = 31/181 (17%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLRAF  79
            A+AH  +  P PT+   D A+    +  ++N      G + V  +     +KG       
Sbjct  20   AEAHGHLDQPQPTF--QDGASTVNWVVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVV  77

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR------STGYTHDGPCEVWLDTTRVL  133
            +D        GAD  CGFT      QP+P             GYTH GPCE+++D   VL
Sbjct  78   LDMV------GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVL  131

Query  134  QSDNCHETFSGKTYD--------LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             SDNC   + G   D        +DYSSC G CT   YWLG +  +    WQ Y  CVPL
Sbjct  132  HSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

Query  186  S  186
            S
Sbjct  188  S  188

>PYIR_19612
Length=260

 Score = 87.4 bits (215),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 91/175 (52%), Gaps = 21/175 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQG-YETVEDFNAWRRDKGYKTLRAFMD  81
            P  DAH  ++ P     +      +  +      G ++  ++F    ++KG+ TLR++++
Sbjct  21   PQVDAHGYIISPKAQTNSKGHPGTFVIVYPPPWAGSWKDPKNFATAAKEKGFATLRSYLE  80

Query  82   GASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQSDNCH  139
                T        CGFTD     + IP D  +R S   +H GPCE+W+D  RV Q+D+C 
Sbjct  81   DKGAT--------CGFTDPNVAPRAIPADRKVRFSRDISHPGPCELWIDDKRVYQNDDCE  132

Query  140  ETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA------CVPLS  186
              F+G   ++D+D++ C G C +R+YWL ++   +   WQVY++      CVP+S
Sbjct  133  SAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQVYRSELTRDLCVPVS  185

>PHYKE_2809
Length=291

 Score = 87.8 bits (216),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 14/123 (11%)

Query  74   KTLRAFMDGASYTVADGADYYCGFTDIKGVAQ-PIPDGTMR-STGYTHDGPCEVWLDTTR  131
            K +R  +D  S T   G D  CGFTD K   + P  DG    S G  H GPCE+WLD   
Sbjct  64   KDIRTMLD--SDTKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  132  VLQSDNCHETFSGKTYD-------LDYSSCK-GSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VLQ+D+C   +   T +       +DYSSC  G C  R+YWL ++ L  +  WQVYK CV
Sbjct  120  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  179

Query  184  PLS  186
            PLS
Sbjct  180  PLS  182

>PHYRA_73584
Length=287

 Score = 87.8 bits (216),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 75/134 (56%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +++ ++  GY  +R  +D  S T   GA+  CGFT+    A+  P   D T  S G  H 
Sbjct  66   YSSLKKSNGYSDIRTLLD--SDTTLYGAN--CGFTNPDATAKDPPTTGDATF-SRGMVHA  120

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKN  172
            GPCE+WLD T VL +D+C   +   + +       +DYSSC  S C LR+YWL  + + +
Sbjct  121  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  180

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK CVPL+
Sbjct  181  KTVWQVYKDCVPLT  194

>PHALS_05392
Length=367

 Score = 88.6 bits (218),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  71   KGYKTLRAFMDGASYTVADGADYYCGFTDIKG--VAQPIPDGTMRSTGYTHDGPCEVWLD  128
              +K +R+ MDG      D     CG+TD  G  VA P       S G  H GPCE+WLD
Sbjct  157  NNFKDVRSLMDGNPVYGED-----CGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLD  211

Query  129  TTRVLQSDNCHETFSGKTYD-------LDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYK  180
               VLQ+D+C   +   T +       +DYSSC    C LR+YWL ++ L  +  WQ YK
Sbjct  212  DKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYK  271

Query  181  ACVPLS  186
             C+PL+
Sbjct  272  NCIPLN  277

>SDRG_16535
Length=313

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 81/180 (45%), Gaps = 25/180 (14%)

Query  23   PTADAHQVVLLPAPTYT-TDDKATKY-----APLAFLENQGYE-----TVEDFNAWRRDK  71
            P  + H  ++ P PT+   +   TKY      P+  L    Y          F    R  
Sbjct  13   PFVNGHGFLINPTPTFNELNGDRTKYCGTIDGPVV-LPGSSYNQDPAWNTRQFTMQFRAS  71

Query  72   GYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----THDGPCEVW  126
             ++TL +F+D  S+         CG T+  G  QP+P     + G      +H+GPCEVW
Sbjct  72   KFQTLASFVDDPSFAPCG----TCGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVW  127

Query  127  LDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
             D+TRV Q+DNC          +D + C G+  LR  WL +    +  SWQVY  CVPLS
Sbjct  128  CDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPLS  183

>PPTG_04647
Length=327

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 71/130 (55%), Gaps = 16/130 (12%)

Query  68   RRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHDGPCE  124
            +   GY  +R  +D  S T   GAD  CG+T+    A+  P   D T  S G  H GPCE
Sbjct  72   KSSNGYSDIRTLLD--SDTDLYGAD--CGYTNPDATAKDPPTTGDATF-SRGMVHVGPCE  126

Query  125  VWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKNEYSW  176
            +WLD T VL +DNC   +   T D       +DYSSC  S C LR+YWL  + + ++  W
Sbjct  127  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  186

Query  177  QVYKACVPLS  186
            QVYK CVPL+
Sbjct  187  QVYKDCVPLT  196

>PYIR_23585
Length=240

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 69/130 (53%), Gaps = 14/130 (11%)

Query  60   TVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGY  117
            +  DF      KG+ T RAF++    T        CG T      +PIP D T++ S   
Sbjct  58   SAADFAKTAPGKGFATTRAFLESRGPT--------CGNTLANASPKPIPSDNTVKFSRAI  109

Query  118  THDGPCEVWLDTTRVLQSDNCHETFSGK--TYDLDYSSCKGSCTLRWYWLGVRFLKNEYS  175
             H GPCE+W+D TRV  +D+C   F     T+ +D+S+CKGSC LR+YWLG++       
Sbjct  110  VHPGPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGAR  167

Query  176  WQVYKACVPL  185
            +Q Y  C+ L
Sbjct  168  FQSYSKCLAL  177

>SPRG_19916
Length=305

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 86/184 (47%), Gaps = 34/184 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYA-------PLAFLENQGYETVEDFN-AWRRDKGYK  74
            P    H ++  P   +T +   T Y        P  F ++     V +FN A++    +K
Sbjct  16   PLVAGHGIISNPLAEFTPNVMRTTYVTRIQANFPGKF-DDSPQTNVANFNKAFKAQTQFK  74

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRS-----TGY----THDGPCEV  125
            TLR  +D        G D  CG T   G  + IP   M +     TG     +H GPCEV
Sbjct  75   TLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFVPSHTGPCEV  126

Query  126  WLDTTRVLQSDNCHETFSGK---TYDLDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYKA  181
            W+D  RV Q+D+C   F  K      +DYSSC G  C LR+YWL +    +E  WQVYK 
Sbjct  127  WIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKN  182

Query  182  CVPL  185
            CVPL
Sbjct  183  CVPL  186

>PITG_04948
Length=232

 Score = 85.9 bits (211),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 68/123 (55%), Gaps = 14/123 (11%)

Query  74   KTLRAFMDGASYTVADGADYYCGFTDIK-GVAQPIPDGTMR-STGYTHDGPCEVWLDTTR  131
            K +R  +D  S T   GAD  CG+T+       P  DGT   S G  H GPCE+WLD   
Sbjct  77   KDIRTLLD--SDTSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  132  VLQSDNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VLQ+D+C   +   T +       +DYSSC  G C LR+YWL ++ L  +  WQVYK C+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  192

Query  184  PLS  186
            PLS
Sbjct  193  PLS  195

>PHYRA_73606
Length=366

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 72/134 (54%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +   +   GY  +R  +D  S T   GAD  CG+T+    A+  P   D T  S G  H 
Sbjct  69   YTGLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATF-SRGMVHV  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKN  172
            GPCE+WLD T VL +D+C   +   T D       +DYSSC  S C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  EYSWQVYKACVPLS  186
            E  WQVYK CVPL+
Sbjct  184  EIVWQVYKDCVPLT  197

>PPTG_03153
Length=314

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 78/178 (44%), Gaps = 21/178 (12%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGY---------ETVEDFNAWRRDKGYKT  75
            A+AH  +  PA  Y T    ++Y         G+         + V  F        YK+
Sbjct  18   ANAHGWLTKPAAVYDTQMDKSQYIGTIESTTSGFKGTFTGAPADNVAAFTKAFESSKYKS  77

Query  76   LRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGT----MRSTGYT--HDGPCEVWLDT  129
            L+A +D  +  +  GA   CG  D K   QP+P         S G+T  H+GPCEVW D 
Sbjct  78   LKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEVWCDK  137

Query  130  TRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             RV   DNC   ++    +L Y  S C G+  L  YW+ +    +  SWQVY  C PL
Sbjct  138  ERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----HGPSWQVYVNCAPL  191

>PHYRA_79140
Length=424

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 59/106 (56%), Gaps = 18/106 (17%)

Query  95   CGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFSG----  144
            CG TD     QPIP DG  +       G+TH GPCE++LD T VL SDNC + + G    
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  --KTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
              +T D+  DYSSC G CTL  YWL  +  +    WQ Y  CVPLS
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLS  187

>PHYCA_531163
Length=314

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 72/134 (54%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            + + +   GY  +R  +D  S T   GAD  CG+T+    A+  P   D T  S G  H 
Sbjct  69   YTSLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNADATAKDPPSTGDATF-SRGMVHV  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKN  172
            GPCE+WLD T VL +D+C   +   T D       +DYSSC  S C LR+YWL  + + +
Sbjct  124  GPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  EYSWQVYKACVPLS  186
               WQVYK CVPL+
Sbjct  184  AIVWQVYKDCVPLT  197

>PYVX_16138
Length=559

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 72/133 (54%), Gaps = 15/133 (11%)

Query  59   ETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STG  116
            ++V+ + +   +KG   +R+ +D  S   AD     CG+TD  G AQ IP D T   S G
Sbjct  62   DSVDTYVSLAEEKGVTQIRSLLDDTSIYGAD-----CGYTDPDGTAQDIPTDSTATFSRG  116

Query  117  YTHDGPCEVWLDTTRVLQSDNCHETFSGKTYD------LDYSSC--KGSCTLRWYWLGVR  168
              H GPCE+WLD T VL  D+C+ T+ G   D      +DYSSC   G   +R+YWL  +
Sbjct  117  MVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQ  176

Query  169  FLKNEYSWQVYKA  181
             + +E  WQVY  
Sbjct  177  GVDDETVWQVYSV  189

>PYAP_22257
Length=247

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 84/182 (46%), Gaps = 30/182 (16%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLA--FLENQGYET-----VEDF-NAWRRDKGYK  74
            PT   H  ++ P    + D  AT+         E + Y       V+ F  A++  K +K
Sbjct  13   PTVFGHGKLVQPKADISDDGYATRITASIDPGFEGRKYNNDPTSNVKAFTEAFKSQKTFK  72

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-------DGTMRSTGY--THDGPCEV  125
            TL+         V       CG +  KG  Q +        + T   TG+  +H GPCE+
Sbjct  73   TLKDM-------VEKQLKGSCGKSSGKGKPQSVEGLSDVHWENTEEKTGFVSSHSGPCEI  125

Query  126  WLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            W+D TRV+  DNC   F G      ++YS CKG C LR+YWL +    +E  WQVYK CV
Sbjct  126  WIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLAL----HEPEWQVYKNCV  181

Query  184  PL  185
            P+
Sbjct  182  PI  183

>PYIW_25463
Length=216

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 85/181 (47%), Gaps = 28/181 (15%)

Query  24   TADAHQVVLLPAPTYTTDDKATKY-APLAFLENQGY----------ETVEDFNAWRRDKG  72
            +A+AH  V  P   YT     T + A      N+G+          + V+ F A     G
Sbjct  19   SAEAHGFVSQPKAQYTGGGSYTSFSAEFTASVNKGFSGYIFNRSPEQNVQQFTAAWSKTG  78

Query  73   YKTLRAFMD----GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY--THDGPCEVW  126
            YK+L+  MD    G  ++  D A       D+ G++           G+  +H GPCE W
Sbjct  79   YKSLKELMDKQVPGCGFSRTDIAA-----VDVSGMSSMKFQNNEYKEGFLGSHHGPCEGW  133

Query  127  LDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVP  184
            +D T+V  SD+C +++ G      + Y++CKG+C L +YWL +   K    WQ YK CVP
Sbjct  134  IDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQK----WQAYKHCVP  189

Query  185  L  185
            +
Sbjct  190  I  190

>PHALS_04411
Length=262

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 22/179 (12%)

Query  25   ADAHQVVLLPAPTYTTDDK---ATKYAPL---AFLENQGYE-TVEDFNAWRRDKGYKTLR  77
            A AH  +  P PT+ + +      +  PL    + +++G E  +  F        YK +R
Sbjct  21   AQAHGYIAKPPPTWKSKETNKWVVEIKPLWDGPWDKSKGDEGLLSTFKELAAKNNYKNVR  80

Query  78   AFMDGASYTVADGADYYCGFTDIKG-VAQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQS  135
              MDG     A G D  CGFTD KG    P  DGT   S G  H GPCE+W +   +LQ+
Sbjct  81   TLMDG---NPAFGED--CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMILQN  135

Query  136  DNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            D+C   +   T         + YS C  G   LR+YWL ++ L+ +  WQ YK C+PL+
Sbjct  136  DDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIPLT  194

>PYIR_20481
Length=277

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 17/130 (13%)

Query  64   FNAWRRDKGYKTLRAFMD----GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY--  117
            F +   + GYK+L+  +D    G  +T+ DGA       D+ G+            G+  
Sbjct  66   FTSAFANTGYKSLKEMLDLSVPGCGFTLTDGAP-----VDVSGLKSMKWQNDQEQKGFID  120

Query  118  THDGPCEVWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYS  175
            +H GPCEVW+D T+++ SD+C   ++    ++  DYS CKG C L +YWL +    +E +
Sbjct  121  SHHGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLAL----HEPN  176

Query  176  WQVYKACVPL  185
            WQ+YK CVP+
Sbjct  177  WQIYKQCVPI  186

>PHYSO_459106
Length=223

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 70/134 (52%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +   ++    K +R  +D  S T   G D  CGFTD KG  Q  P   D T  S G  H 
Sbjct  67   YKQLKKANNVKDIRTMID--SDTKLYGED--CGFTDPKGKPQDPPTTGDATF-SRGIVHA  121

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKT-------YDLDYSSC-KGSCTLRWYWLGVRFLKN  172
            GPCE+WLD   VLQ+D+C   +   T         +DYSSC  G C  R+YWL ++   +
Sbjct  122  GPCEIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDS  181

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK C+PL+
Sbjct  182  KTYWQVYKNCIPLT  195

>SPRG_22161
Length=300

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 86/184 (47%), Gaps = 34/184 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYA-------PLAFLENQGYETVEDFN-AWRRDKGYK  74
            P    H ++  P   +T +   T Y        P  F ++     V +FN A++    +K
Sbjct  16   PLVAGHGIISNPLAEFTPNVMRTTYVTRIQANFPGKF-DDSPQTNVANFNKAFKAQTQFK  74

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRS-----TGY----THDGPCEV  125
            TLR  +D        G D  CG T   G  + IP   M +     TG     +H GPCEV
Sbjct  75   TLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFIPSHTGPCEV  126

Query  126  WLDTTRVLQSDNCHETFSGK---TYDLDYSSCKGS-CTLRWYWLGVRFLKNEYSWQVYKA  181
            W+D  RV Q+D+C   F  K      +DYSSC  + C LR+YWL +    +E  WQVYK 
Sbjct  127  WIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLAL----HEPMWQVYKN  182

Query  182  CVPL  185
            CVPL
Sbjct  183  CVPL  186

>PHYCA_534473
Length=1050

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            + + +   GY  +R  +D  S T   GA+  CGFTD    A+  P   D T  S G  H 
Sbjct  841  YASLKESNGYSDIRTLLD--SDTDLYGAN--CGFTDPDVTAKDPPTTGDATF-SRGMVHA  895

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKN  172
            GPCE+WLD T+VL +D+C   +   T +       +DYSSC  S C LR+YWL  + + +
Sbjct  896  GPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  955

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK CVPL+
Sbjct  956  KIVWQVYKDCVPLT  969

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 78/162 (48%), Gaps = 22/162 (14%)

Query  27   AHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYE-TVEDFNAWRRDKGYKTLRAF  79
            AH  +  PAP++    T+D   +  P     + E++G    +  F        YK +R  
Sbjct  23   AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDPGLLSTFKELAAKNNYKDVRTL  82

Query  80   MDGASYTVADGADYYCGFTDIKGV-AQPIPDGTMR-STGYTHDGPCEVWLDTTRVLQSDN  137
            MDG      D     CGFTD KG    P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  83   MDGNPVYGED-----CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  138  CHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLK  171
            C   +   T +       +DYSSC  G C LR+YWL ++ LK
Sbjct  138  CQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLK  179

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 65/134 (49%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +   ++    K +R  +D       +     CG TD K   +  P   D T  S G  H 
Sbjct  536  YKQLKKSNNVKDIRTMIDADPKLYGED----CGNTDPKAKPKDPPSTGDATF-SRGIVHA  590

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKT-------YDLDYSSC-KGSCTLRWYWLGVRFLKN  172
            GPCE+WLD   VLQ+D+C   +   T         +DYSSC  G C  R+YWL ++   +
Sbjct  591  GPCEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDS  650

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK C+PL+
Sbjct  651  KTLWQVYKNCIPLT  664

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 58/117 (50%), Gaps = 14/117 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQ-PIPDGTMR-STGYTHDG  121
            +   +     K +R  +D  S T   GAD  CG+T+     + P  DGT   S G  H G
Sbjct  273  YKELKASNNAKDIRTLLD--SDTKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAG  328

Query  122  PCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFL  170
            PCE+WLD   VL +D+C   +   T +       +DYSSC  G C  R+YWL ++ L
Sbjct  329  PCEIWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

>PHALS_03177
Length=259

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 22/179 (12%)

Query  23   PTADAHQVVLLPAPTYT---TDDKATKYAPL---AFLENQGYETVEDFNAWRRDKGYKTL  76
            P+ D+H  + +P   +     D    +  PL   +       ++V+ F + +    +K L
Sbjct  19   PSIDSHGYMYIPRTQFKGQGNDGWIVQIEPLWKSSDWNGNTQKSVKAFQSLKAANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD        G D  CG++D  G  QPIP DG    S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDNPVL----GRD--CGYSDPNGKPQPIPKDGKATFSRAMVHTGPCEMWLDNKKVLY  132

Query  135  SDNCHETFSG------KTYDLDYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVYKACVPL  185
             D+C+  +          + +DYSSC  G C  +R+YWL  + +  +  WQ YK C+PL
Sbjct  133  EDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGKTFWQSYKMCIPL  191

>PPTG_04619
Length=276

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 70/133 (53%), Gaps = 14/133 (11%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQ-PIPDGTMR-STGYTHDG  121
            +   +     K +R  +D  S T   GAD  CG+T+     + P  DGT   S G  H G
Sbjct  67   YKELKASNNAKDIRTLLD--SDTSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAG  122

Query  122  PCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNE  173
            PCE+WLD   VLQ+D+C   +   T +       +DYSSC  G C  R+YWL ++ L  +
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGK  182

Query  174  YSWQVYKACVPLS  186
              WQVYK C+PLS
Sbjct  183  TYWQVYKNCIPLS  195

>PYU1_G005985
Length=200

 Score = 84.0 bits (206),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 88/186 (47%), Gaps = 36/186 (19%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAP-LAFLENQGY----------ETVEDFNAWRRDK  71
            P  +AH  + +P  TY  D   T +   L    N  +          E  + F +     
Sbjct  19   PQVEAHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKWDGSPQENTQQFTSGFHAA  78

Query  72   GYKTLRAFMDGASYTVADGADYYCGFTDIK----GVAQPIPDGTMRSTGY------THDG  121
            GY +L+A +D     VA G    CG + +     GV++ +     R+  +      +H G
Sbjct  79   GYSSLKALLD----PVAPG----CGNSRVDVPPVGVSR-LAAMEFRNDEFHEGFVNSHHG  129

Query  122  PCEVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            PCEVW+D  R+   D+C   F+G   T  +++S C+G CTL +YWL +    +E +WQVY
Sbjct  130  PCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL----HEPTWQVY  185

Query  180  KACVPL  185
            K CVP+
Sbjct  186  KQCVPI  191

>PHYKE_2937
Length=366

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 72/134 (54%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            + + +   GY  +R  +D  S T   GAD  CG+T+    A+  P   D T  S G  H 
Sbjct  73   YTSLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATF-SRGMVHV  127

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKN  172
            GPCE+WLD T VL +D+C   +   T D       +DYSSC  S C LR+YWL  + + +
Sbjct  128  GPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  187

Query  173  EYSWQVYKACVPLS  186
               WQVYK CVPL+
Sbjct  188  SMVWQVYKDCVPLT  201

>PHYKE_6077
Length=322

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 63/132 (48%), Gaps = 13/132 (10%)

Query  63   DFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPD-------GTMRST  115
            +FN       Y +L+ FM   +   +      CG+T+ KG AQP+P+       G+    
Sbjct  68   NFNKGMAASKYTSLKEFMAAKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGF  127

Query  116  GYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNE  173
              +H+GPCEVW D TRV Q DNC   F      L Y   +C GS  L  YW+ +    + 
Sbjct  128  TSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL----HS  183

Query  174  YSWQVYKACVPL  185
             SWQVY  C  L
Sbjct  184  PSWQVYINCAAL  195

>PPTG_04620
Length=342

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 68/134 (51%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +   ++    K +R  +DG +    +     CG TD K   +  P   D T  S G  H 
Sbjct  69   YKELKKSNNVKDIRTMIDGDAKLYGED----CGNTDPKATPKDPPSTGDATF-SRGIVHA  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCK-GSCTLRWYWLGVRFLKN  172
            GPCE+WLD   VLQ+D+C   +   T         +DYSSCK G C  R+YWL ++   +
Sbjct  124  GPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDS  183

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK C+PLS
Sbjct  184  KTLWQVYKNCIPLS  197

>PHYSO_485524
Length=278

 Score = 84.7 bits (208),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 14/123 (11%)

Query  74   KTLRAFMDGASYTVADGADYYCGFTDIKGVAQ-PIPDGTMR-STGYTHDGPCEVWLDTTR  131
            K +R  +D  S T   GA+  CG+T+     + P  DGT   S G  H GPCE+WLD   
Sbjct  77   KDIRTLLD--SDTKLYGAN--CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  132  VLQSDNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VLQ+D+C   +   T +       +DYSSC  G C  R+YWL ++ L  +  WQVYK C+
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  184  PLS  186
            PLS
Sbjct  193  PLS  195

>PYIR_22134
Length=300

 Score = 85.1 bits (209),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYA-----PLAFLENQGYETVED-------FNAWRRDK  71
            + DAH  + +P PT+T     T+++     P       G     D       F A  +  
Sbjct  25   SVDAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKAS  84

Query  72   GYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGYT--HDGPCE  124
             Y ++RA ++     ++ GA   CG T   G AQP+P   +      S G+T  H GPCE
Sbjct  85   TYDSVRALVEAKGVFIS-GATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCE  143

Query  125  VWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKAC  182
            VW D  +V   +NC + +     +L  D++ C G+  L+  WL +    +  +WQ+Y  C
Sbjct  144  VWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIYINC  199

Query  183  VPL  185
             PL
Sbjct  200  APL  202

>PHYRA_83500
Length=394

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 58/106 (55%), Gaps = 18/106 (17%)

Query  95   CGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFSG----  144
            CG TD     QPIP DG  +       G+TH GPCE++LD T VL SDNC + + G    
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  --KTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
              +T D+  DYSSC G CTL  YWL  +  +    WQ Y  C PLS
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLS  187

>PHALS_03179
Length=372

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 16/137 (12%)

Query  59   ETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STG  116
            ++V+ + + +    +K L+  M+    T A G +  CGF+D KG  QPIP DG    S  
Sbjct  102  QSVKAYQSLKAANNFKDLKTLME----THALGPE--CGFSDPKGKPQPIPKDGKATLSRA  155

Query  117  YTHDGPCEVWLDTTRVLQSDNCHETFSGKTYDL------DYSSC-KGSCT-LRWYWLGVR  168
              H GPCE+WLD  +VL  D+C+  +  +   +      DYSSC  G C  +R+YWL  +
Sbjct  156  IVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQ  215

Query  169  FLKNEYSWQVYKACVPL  185
             +K    WQ YK C+PL
Sbjct  216  GIKGITFWQSYKNCIPL  232

>PHYCA_97965
Length=288

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 81/182 (45%), Gaps = 32/182 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLR  77
            P A+AH  +  P  T+   D A     +  ++N      G + V  F    ++KG     
Sbjct  20   PDANAHGNLKQPEATFK--DGAPTVEWVTLIDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  77

Query  78   AFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTR  131
              +D          D  CG+T      QPIP DG ++       G+TH GPCE+++D   
Sbjct  78   VVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKM  130

Query  132  VLQSDNCHETFSG--------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VL  D+C + F G            +D+SSC G CTL  YWL     +NE  WQ Y  CV
Sbjct  131  VLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLA---FQNEQ-WQSYVNCV  186

Query  184  PL  185
            PL
Sbjct  187  PL  188

>PITG_04947
Length=298

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 66/133 (50%), Gaps = 16/133 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +   ++    K +R  +DG +    +     CG TD K   +  P   D T  S G  H 
Sbjct  42   YKQLKKSNNIKDIRTMIDGDAKLYGED----CGNTDPKATPKDPPTTGDATF-SRGIVHA  96

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYD-------LDYSSCK-GSCTLRWYWLGVRFLKN  172
            GPCE+WLD   VLQ+D+C   +   T         +DYSSCK G C  R+YWL ++    
Sbjct  97   GPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQ  156

Query  173  EYSWQVYKACVPL  185
            +  WQVYK C+PL
Sbjct  157  KTLWQVYKNCIPL  169

>PYIW_15526
Length=256

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 84/180 (47%), Gaps = 26/180 (14%)

Query  24   TADAHQVVLLPAPTYTTDDKATKY-APLAFLENQGY----------ETVEDFNAWRRDKG  72
            + +AH  +  P  TYT     T + A +    N+G+          +   +F A     G
Sbjct  17   STEAHGFISEPKATYTGGGSYTSFSAEIGADVNKGFSGRIFNRSPEQNAAEFTAAWPKTG  76

Query  73   YKTLRAFMD----GASYTVADGADY-YCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWL  127
            Y +L+  +D    G  YT  + A     G   +K       +G + S    H GPCE W+
Sbjct  77   YTSLKEMLDKSVSGCGYTNPNAAPVDVSGLKSMKYQNNEYKEGFLGS----HRGPCEAWI  132

Query  128  DTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            D T++  +D+C +T+ G   T  +DYS CKG+C L +YWL V   K    WQVYK CV +
Sbjct  133  DNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQVYKGCVAI  188

>PYU1_G001519
Length=265

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 77/178 (43%), Gaps = 20/178 (11%)

Query  24   TADAHQVVLLPAPTY-----------TTDDKATKYAP--LAFLENQGYETVEDFNAWRRD  70
            TADAH  + LP PT+           T D  +T   P  ++F  +    T     A++  
Sbjct  18   TADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQ  77

Query  71   KGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTM-RSTGYTHDGPCEVWLDT  129
              YK+L+      +  V  GA   CGF+D+ G  QP+PD         +H GPCEVW D 
Sbjct  78   TKYKSLKDLAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDD  137

Query  130  TRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
              V Q DNC          L Y  + C G   L  +W+ +       +WQ+Y  C P+
Sbjct  138  VMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHV----PTWQIYTNCAPI  191

>PHYCA_12943
Length=287

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 81/182 (45%), Gaps = 32/182 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLR  77
            P A+AH  +  P  T+   D A     +  ++N      G + V  F    ++KG     
Sbjct  20   PDANAHGNLKQPEATFK--DGAPTVEWVTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  77

Query  78   AFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTR  131
              +D          D  CG+T      QPIP DG ++       G+TH GPCE+++D   
Sbjct  78   VVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKM  130

Query  132  VLQSDNCHETFSG--------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            VL  D+C + F G            +D+SSC G CTL  YWL     +NE  WQ Y  CV
Sbjct  131  VLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLA---FQNEQ-WQSYVNCV  186

Query  184  PL  185
            PL
Sbjct  187  PL  188

>PHYRA_77293
Length=302

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 65/125 (52%), Gaps = 23/125 (18%)

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---------DGTMRSTGYTHDGPC  123
            +KTLRA MD A+          CG T + G A  +          D   +    +H GPC
Sbjct  75   FKTLRALMDTAAPD--------CGNTALTGTAVDVSSLSSMKWQNDQEQKGFIDSHHGPC  126

Query  124  EVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
            E W+D TRV QSD+C   ++G      +D+SSC G CT  +YW+ +    +E +WQVYK 
Sbjct  127  EAWIDDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAM----HEPNWQVYKQ  182

Query  182  CVPLS  186
            C P++
Sbjct  183  CAPIA  187

>PHYSO_488921
Length=296

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 85/184 (46%), Gaps = 32/184 (17%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLE-NQGY----------ETVEDFNAWRRDKG  72
            T  AH  +  P  TY +  + TKY  L     N+G+             + FN      G
Sbjct  16   TVHAHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATG  75

Query  73   YKTLRAFMD------GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVW  126
            YK+LR  +D      G S   A   D   G+T++        +G + S    H GPCE W
Sbjct  76   YKSLREMLDPIAPDYGHSLKTATPVDV-TGYTEMWWQNDEYKEGFINS----HSGPCEAW  130

Query  127  LDTTRVLQSDNCHETFSGKTY----DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKAC  182
            +D  ++   DNC   F  K+Y      DYSSCKG C L +YWL +    +E +WQ+YK C
Sbjct  131  IDDVKIFHHDNCAAEF--KSYPAKVPADYSSCKGDCLLVFYWLAL----HEPNWQIYKQC  184

Query  183  VPLS  186
            VP++
Sbjct  185  VPIT  188

>SDRG_17317
Length=122

 Score = 79.0 bits (193),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 58/104 (56%), Gaps = 17/104 (16%)

Query  95   CGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEVWLDTTRVLQSDNCHETFSGK  145
            CG T   G  + IP DGTM         G+  +H GPCEVWLD  RV Q+D+C   F  K
Sbjct  9    CGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPAK  68

Query  146  T---YDLDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                  +DYSSC G  C LR+YWL +    +E  WQVYK CVPL
Sbjct  69   PAAHLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKNCVPL  108

>PITG_11936
Length=333

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 77/180 (43%), Gaps = 22/180 (12%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETV---------EDFNAWRRDKGYK  74
            TA  H  +  P   +T +   T+Y         G+  +          +FN       YK
Sbjct  20   TAKGHGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASKYK  79

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPD-------GTMRSTGYTHDGPCEVWL  127
            +L+ FM+     V +     CG+T+     QP+P        G       +H+GPCEV+ 
Sbjct  80   SLKEFMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYC  139

Query  128  DTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            D TRV Q DNC + F      L  D+ +C GS  L  YW+ +    +  SWQVY  C PL
Sbjct  140  DETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HSPSWQVYINCAPL  195

>PHYKE_3913
Length=321

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 10/102 (10%)

Query  95   CGFTDIKGVAQ-PIPDGTMR-STGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYD----  148
            CGFT+     + P  DGT   S G  H GPCE+WLD   VLQ+D+C   +   T +    
Sbjct  121  CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISI  180

Query  149  ---LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
               +DYSSC  G C  R+YW+ ++ L  +  WQVYK CVPL+
Sbjct  181  FKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCVPLT  222

>PHYSO_329293
Length=310

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 85/184 (46%), Gaps = 32/184 (17%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLE-NQGY----------ETVEDFNAWRRDKG  72
            T  AH  +  P  TY +  + TKY  L     N+G+             + FN      G
Sbjct  16   TVHAHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATG  75

Query  73   YKTLRAFMD------GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVW  126
            YK+LR  +D      G S   A   D   G+T++        +G + S    H GPCE W
Sbjct  76   YKSLREMLDPIAPDYGHSLKTATPVDV-TGYTEMWWQNDEYKEGFINS----HSGPCEAW  130

Query  127  LDTTRVLQSDNCHETFSGKTY----DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKAC  182
            +D  ++   DNC   F  K+Y      DYSSCKG C L +YWL +    +E +WQ+YK C
Sbjct  131  IDDVKIFHHDNCAAEF--KSYPAKVPADYSSCKGDCLLVFYWLAL----HEPNWQIYKQC  184

Query  183  VPLS  186
            VP++
Sbjct  185  VPIT  188

>PPTG_03156
Length=445

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 62/121 (51%), Gaps = 12/121 (10%)

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGT----MRSTGYT--HDGPCEVW  126
            YK+L+AF+D  +     GA   CG  +    AQP+PD        S G+T  H+GPCE W
Sbjct  76   YKSLKAFIDDKAKITVTGATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAW  135

Query  127  LDTTRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVP  184
             D+ RV   +NC   F     ++ Y  S C G+ TL +YW+ +       +WQVY  C P
Sbjct  136  CDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGP----TWQVYVNCAP  191

Query  185  L  185
            L
Sbjct  192  L  192

>PYU1_G005868
Length=267

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 27/127 (21%)

Query  72   GYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------THD  120
             YK+LR  +D A   V D     CGFT   G   P+   +++S  +           +H 
Sbjct  74   SYKSLREMLDSA---VPD-----CGFTLTDGT--PVDVSSLKSMKWQNDQEQKGFIDSHH  123

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQV  178
            GPCE+W+D T+++ SD+C   ++    ++  DYS CKG C L +YWL +    +E +WQ+
Sbjct  124  GPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLAL----HEPNWQI  179

Query  179  YKACVPL  185
            YK CVP+
Sbjct  180  YKQCVPI  186

>PHYSO_533747
Length=206

 Score = 80.9 bits (198),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 89/178 (50%), Gaps = 22/178 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPL--AFLENQGY----ETVEDFNAWRRDKGYKTL  76
            P  DAH  + +P   +   + +     +   +  +  Y    ++VE F + +    +K L
Sbjct  20   PGVDAHGYIYVPQSQFKGGENSQWLVQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDL  79

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DG-TMRSTGYTHDGPCEVWLDTTRVLQ  134
            +  +D  S    D     CGFTD  G  QPIP DG  + S G  H GPCE WLD  +VL 
Sbjct  80   KTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  135  SDNC-----HETFSGKT-YDLDYSSCK-GSC-TLRWYWLGVRFLKNEYS-WQVYKACV  183
            +D+C     H   + KT + +DYSSC+ G C  +R+YWLG + L ++ + WQ Y   +
Sbjct  135  ADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYSTLL  192

>PHYRA_80750
Length=275

 Score = 82.0 bits (201),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 81/174 (47%), Gaps = 21/174 (12%)

Query  23   PTADAHQVVLLPAPTYTTDDKA---TKYAPL---AFLENQGYETVEDFNAWRRDKGYKTL  76
            P+ADAH  +L+P   +     +    +  P+   A  +     +V+ F A +    +  L
Sbjct  19   PSADAHGYMLIPESQFKDSANSAWVVQIDPVWDSADWDGNNAGSVDAFKALKTANNFVDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD    T   GAD  CGFTD  G  QPIP DG    S    H GPCE+WLD  +V  
Sbjct  79   KTLMDD---TATFGAD--CGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWLDDKKVFY  133

Query  135  SDNCHETFSGKTYDL------DYSSCKGSC--TLRWYWLGVRFLKNEYSWQVYK  180
             D+C  T+  +  D+      DYS C G     +R+YWL  + +  +  WQ Y 
Sbjct  134  EDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSYN  187

>PHALS_05394
Length=288

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 65/123 (53%), Gaps = 15/123 (12%)

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGV-AQPIPDGTMR-STGYTHDGPCEVWLDTT  130
            +K+ R+ MDG     AD     CG+TD  G    P  DGT   S    H G CE+W++  
Sbjct  78   FKSARSLMDGNPVYGAD-----CGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWINKK  132

Query  131  RVLQSDNCHETFSGKTYD-------LDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYKAC  182
             VLQ+D+C   +  K          +DYSSCKG  C LR+YWL ++ + ++  WQ YK C
Sbjct  133  MVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNC  192

Query  183  VPL  185
            + +
Sbjct  193  ISI  195

>PHYRA_73583
Length=630

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 16/134 (12%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHD  120
            +   +     K +R  +D  S T   GAD  CGFTD K   +  P   D T  S G  H 
Sbjct  368  YKELKASNNIKDIRTMID--SDTKLYGAD--CGFTDPKATPKDPPSTGDATF-SRGMVHA  422

Query  121  GPCEVWLDTTRVLQSDNCHETFSGKT-------YDLDYSSC-KGSCTLRWYWLGVRFLKN  172
            GPCEVWLD   VLQ+D+C   +   T         +DYSSC  G C  R++WL ++   +
Sbjct  423  GPCEVWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDS  482

Query  173  EYSWQVYKACVPLS  186
            +  WQVYK CVPLS
Sbjct  483  KTWWQVYKNCVPLS  496

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 67/124 (54%), Gaps = 16/124 (13%)

Query  74   KTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP---DGTMRSTGYTHDGPCEVWLDTT  130
            K +R  +D  S T   GA+  CG+T+     +  P   D T  S G  H GPCE+WLD  
Sbjct  77   KDIRTLLD--SDTTLYGAN--CGYTNPDASPKDPPSTGDATF-SRGIVHAGPCEIWLDDK  131

Query  131  RVLQSDNCHETFSGKTYD-------LDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKAC  182
             VLQ+D+C   +   T +       +DYSSC  G C  R+YWL ++ L  +  WQVYK C
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNC  191

Query  183  VPLS  186
            +PLS
Sbjct  192  IPLS  195

>PHYRA_86016
Length=236

 Score = 81.3 bits (199),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 56/108 (52%), Gaps = 18/108 (17%)

Query  92   DYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFSG-  144
            D  CG+T      QPIP DG ++       G+TH GPCE+++D T VL  D+C E + G 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  145  -------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                       +DYSSC G CTL  YWL  +  +    WQ Y  CVPL
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PYIW_24288
Length=201

 Score = 80.5 bits (197),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 76/185 (41%), Gaps = 28/185 (15%)

Query  24   TADAHQVVLLPAPTYTTDDKATKY--------------APLAFLENQGYETVEDFNAWRR  69
            + D H  + +P PT+        Y              A + +  N          A+  
Sbjct  22   SVDGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPAGMTYSSNGANNARVYERAFGN  81

Query  70   DKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-------DGTMRSTGYTHDGP  122
               Y+ LR  +D  +   A GAD  CGFT   G  QP+P       +   +    TH+GP
Sbjct  82   QNRYRNLRELVDFTAVFSA-GADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGP  140

Query  123  CEVWLDTTRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYK  180
            CEVW D     +  NC + F G    L Y  S C G+  L++YWL +    +   W+VY 
Sbjct  141  CEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYI  196

Query  181  ACVPL  185
             CVPL
Sbjct  197  NCVPL  201

>SDRG_16534
Length=320

 Score = 82.8 bits (203),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 78/176 (44%), Gaps = 27/176 (15%)

Query  27   AHQVVLLPAPTYT------TDDKATKYAPLAFLENQGYETVEDFNAWR-----RDKGYKT  75
             H  ++ P P +T      +   AT   P   L    YE   D+N  +     +   +KT
Sbjct  20   GHGHLVDPVPAFTDKYGDPSKFAATLNGP-TVLPGSSYEQGPDWNTDQFTKHFKASSFKT  78

Query  76   LRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----THDGPCEVWLDTT  130
            L+AF+D        G D  CG TD  G AQP+P     + G      +H GPCE+W D T
Sbjct  79   LKAFLD----AYPTGGD--CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELWCDET  132

Query  131  RVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            RV Q DNC          +D S C G+  L   WL +   +    WQVYK CV LS
Sbjct  133  RVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

>PPTG_07520
Length=294

 Score = 82.4 bits (202),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 68/143 (48%), Gaps = 25/143 (17%)

Query  57   GYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR--  113
            G + +  F A  ++KG       +D          D  CG T   G  QPIP DG ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDTTRVLQSDNCHETFSG------KTYDL--DYSSCKGSCTLRW  162
                 G+TH GPCE++LD   VL  D+C + F G      +T D+  D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGVRFLKNEYSWQVYKACVPL  185
            YWL  +  +    WQ Y  CVPL
Sbjct  166  YWLAFQNAQ----WQTYVNCVPL  184

>PPTG_07516
Length=294

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 68/143 (48%), Gaps = 25/143 (17%)

Query  57   GYETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR--  113
            G + +  F A  ++KG       +D          D  CG T   G  QPIP DG ++  
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  ---STGYTHDGPCEVWLDTTRVLQSDNCHETFSG------KTYDL--DYSSCKGSCTLRW  162
                 G+TH GPCE++LD   VL  D+C + F G      +T D+  D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  163  YWLGVRFLKNEYSWQVYKACVPL  185
            YWL  +  +    WQ Y  CVPL
Sbjct  166  YWLAFQNAQ----WQTYVNCVPL  184

>PYU1_G005866
Length=194

 Score = 80.1 bits (196),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 84/181 (46%), Gaps = 24/181 (13%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPL-------AFL----ENQGYETVEDFNAWRRDK  71
            P+ DAH  +  P   Y     AT Y  +       AF     ++      + F A  +  
Sbjct  19   PSTDAHGYIAFPPAQYKDPATATNYNAIITASINTAFAGKKWDDNPTANTKTFTAAFKKS  78

Query  72   GYKTLRAFMDGASYTVADGADYYCGFTDIK----GVAQPIPDGTMRSTGYTHDGPCEVWL  127
            GY +L+  +D     V    +    FT IK       +   D   +    +H GPCE+WL
Sbjct  79   GYTSLKQMLDKK---VPGCQNSRTDFTPIKTKTYKTMEWQNDWEHKGFIDSHHGPCEIWL  135

Query  128  DTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            + TRVL +D+C  T++       ++YS CKG+C L +YWL +     E +WQ+YK CVP+
Sbjct  136  NNTRVLHNDDCVATYTTYPAVLPVNYSVCKGNCILTFYWLALH----EPNWQIYKHCVPV  191

Query  186  S  186
            +
Sbjct  192  N  192

>PYIR_24421
Length=213

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (48%), Gaps = 14/136 (10%)

Query  60   TVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPD-----GTMRS  114
              + F A  +   YK++R  ++ A  +   GA   CG +   G  QP+P          S
Sbjct  38   NAKAFTAALKSSSYKSVRDLVN-AKASFISGASKECGISSSSGAKQPLPAQYVEWAHSSS  96

Query  115  TGYT--HDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFL  170
             G+T  H+GPCEVW D      +DNC + +      L Y  S C G+  LR+YW+ +   
Sbjct  97   EGFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL---  153

Query  171  KNEYSWQVYKACVPLS  186
             +  +WQVY  C PLS
Sbjct  154  -HSSTWQVYINCAPLS  168

>PHYCA_98479
Length=276

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 59/110 (54%), Gaps = 18/110 (16%)

Query  90   GADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            G+   CG T   G  QP+P DG  +       G+TH GPCE+++D T VL  DNC + + 
Sbjct  81   GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYP  140

Query  144  GK------TYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            G       T D+  DYSSCKG CTL  YWLG +       WQ Y  CVPL
Sbjct  141  GGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGFQ----NAQWQAYINCVPL  186

>PYU1_G005873
Length=214

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 81/181 (45%), Gaps = 28/181 (15%)

Query  24   TADAHQVVLLPAPTYTTDDKATKY-APLAFLENQGY----------ETVEDFNAWRRDKG  72
            + +AH  +  P   YT     T Y A +    N+G+          +  + F A     G
Sbjct  20   SIEAHGYISQPKAQYTGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTG  79

Query  73   YKTLRAFMD----GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY--THDGPCEVW  126
            YK+L+  MD    G  Y+  D A       D+  ++           G+  +H GPCE W
Sbjct  80   YKSLKQMMDKAVPGCGYSRTDIAP-----VDVSRMSSMKFQNNEYKEGFLASHHGPCEGW  134

Query  127  LDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVP  184
            +D TRV   D+C   F G   T  + + +CKG+C L +YWL +   K    WQ YK+CVP
Sbjct  135  IDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSPK----WQAYKSCVP  190

Query  185  L  185
            +
Sbjct  191  I  191

>SPRG_07795
Length=335

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 79/173 (46%), Gaps = 23/173 (13%)

Query  27   AHQVVLLPAPTYTTDDKATKYAPL---AFLENQGYETVEDFNAWR-----RDKGYKTLRA  78
             H V  LPA T    D +   A L     L    YE   D+N  +     +   +KTL+A
Sbjct  22   GHLVDPLPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSFKTLKA  81

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTG-----YTHDGPCEVWLDTTRVL  133
            F+D A  T  D     CG TD  G AQP+P     + G      +H GPCE+W D TRV 
Sbjct  82   FLD-AHPTGGD-----CGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELWCDETRVF  135

Query  134  QSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            Q +NC   +      +D S C G+  L   WL +   +    WQVYK CV LS
Sbjct  136  QDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLS  184

>PYAP_22462
Length=210

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPL----AFLENQGY-------ETVEDFNAWRRDKGYK  74
            DAH  + LP  +Y      T Y  +    A+   QG+       +  + F    R  G+ 
Sbjct  28   DAHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGFS  87

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY--THDGPCEVWLDTTRV  132
            +LRA +D A+    + +       D+ G++           G+  +H GPCE W+D TRV
Sbjct  88   SLRALLDPAAPGCGN-SRTDVAPVDVSGLSVMQFQNDEEGKGFITSHHGPCEAWIDNTRV  146

Query  133  LQSDNCHETFSG--KTYDLDYSSCKG--SCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
               D+C   F+G   T  ++Y++C    +C L +YWL +    +E +WQVYK CVP+
Sbjct  147  FHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEANWQVYKQCVPI  199

>PHYRA_78161
Length=373

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 82/190 (43%), Gaps = 31/190 (16%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAP-------LAFLENQGYETVEDFNAWRRDK------  71
            A A  V ++    Y TD K T  A        +A +E+        FN    D       
Sbjct  10   ASALAVTVVNGHGYMTDPKVTFTAQAGDPTQYIATIESTASGLTGTFNGAPSDNVAAFTK  69

Query  72   -----GYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGYT--H  119
                  Y +L+ F++  +     GA   CG  D K  AQP+P  TM      S G+T  H
Sbjct  70   AFGSSKYSSLKEFINDKATVTVTGATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASH  129

Query  120  DGPCEVWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQ  177
            +GPCEVW D  R  Q D+C   +      L  D  +C GS TL +YW+ +       +WQ
Sbjct  130  EGPCEVWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH----SSTWQ  185

Query  178  VYKACVPLST  187
            VY  C PL++
Sbjct  186  VYVNCAPLAS  195

>PYAP_18584
Length=210

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 81/187 (43%), Gaps = 40/187 (21%)

Query  25   ADAHQVVLLPAPTYTTDDKATKY----------APLA--FLENQGYETVEDFNAWRRDKG  72
             DAH  ++ PA  +  +   T Y          AP A     +        F A  +   
Sbjct  19   VDAHGYLVQPAAKFKPNVMTTNYNGIINAYSLPAPFAGKKFNDNPTANANTFTAAFKQSS  78

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------THDG  121
            YK+++A MD     V D     CG T + G   PI    MRS  +           +H G
Sbjct  79   YKSIKALMDK---YVPD-----CGNTLMNG--SPINVSGMRSVKWANDQERVGFIKSHSG  128

Query  122  PCEVWLDTTRVLQS-DNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQV  178
            PCEVW+D   V Q   NC E ++    +L  DYS CKG C L +YWL +     E +WQ+
Sbjct  129  PCEVWIDNKMVFQELGNCVEKYTSYPAELPVDYSVCKGKCQLTFYWLALH----EPNWQI  184

Query  179  YKACVPL  185
            YK C P+
Sbjct  185  YKQCAPI  191

>PYIR_15187
Length=207

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 86/182 (47%), Gaps = 34/182 (19%)

Query  26   DAHQVVLLPAPTYTTDDKATKY-APLAFLENQGYE----------TVEDFNAWRRDKGYK  74
            +AH  + +P  +YT     T Y A L+   N  ++            + F A  R  GY 
Sbjct  27   EAHGYISVPQASYTNSYTKTSYSATLSQSVNPAFQGRKWNGSPEDNTQQFTAGFRAAGYP  86

Query  75   TLRAFMDGASYTVADGADYYCGFT--DIKGV-AQPIPDGTMRSTGY------THDGPCEV  125
            +L+  +D A    A G    CG +  D+  V    +     R+  Y      +H GPCEV
Sbjct  87   SLKTLLDPA----APG----CGNSRLDVPAVDVSRLSAMEFRNDEYHEGFVSSHHGPCEV  138

Query  126  WLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            W+D TR   +D+C   F G   +  +++S CK  CTL +YWL +    +E +WQVYK CV
Sbjct  139  WIDNTRAFHNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLAL----HEPTWQVYKQCV  194

Query  184  PL  185
            P+
Sbjct  195  PI  196

>PYAP_18713
Length=184

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 80/165 (48%), Gaps = 22/165 (13%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLE-----NQGYETVEDFNAWRRDKGYKTLRA  78
            TADAH  V  P   +    K+T Y      E     +  ++T   +    +DKG+K LR+
Sbjct  21   TADAHGYVAEPPAEFP---KSTPYPSEWVAEFPPPWSGTFKTGAQYAVVAKDKGFKDLRS  77

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIPDGT--MRSTGYTHDGPCEVWLDTTRVLQSD  136
            F++             CG T+     + +P  +  + S    H GPCE+W+D T V  +D
Sbjct  78   FLEDKGPA--------CGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCELWIDDTMVYHND  129

Query  137  NCHETFSGKT--YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            +C   F  K   + +D+SSCKG C LR+YWLG++   +   WQ Y
Sbjct  130  DCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSY  172

>PHYRA_86752
Length=300

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 56/108 (52%), Gaps = 18/108 (17%)

Query  92   DYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFSG-  144
            D  CG+T      QPIP DG ++       G+TH GPCE+++D T VL  D+C E + G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  145  -------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                       +DYSSC G CTL  YWL  +  +    WQ Y  CVPL
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  186

>PHYKE_10295
Length=292

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 66/127 (52%), Gaps = 27/127 (21%)

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------THDG  121
            +KTLRA MD    TVA      CG T + G   P+    + S  +           +H G
Sbjct  75   FKTLRALMD----TVAPD----CGNTALTG--SPVDVSALSSMKWQNDQEQKGFIDSHHG  124

Query  122  PCEVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            PCE W+D TRV+QSD+C   +        +DYSSC G CT  +YW+ +    +E +WQVY
Sbjct  125  PCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMAL----HEPNWQVY  180

Query  180  KACVPLS  186
            K C P++
Sbjct  181  KQCAPIT  187

>PYIW_25573
Length=279

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 72/173 (42%), Gaps = 20/173 (12%)

Query  28   HQVVLLPAPTY-----TTDDKATKYAPLAFLENQGYETVED-------FNAWRRDKGYKT  75
            H  + LP PT+     T     T   P A     G     D       F A  +   Y +
Sbjct  25   HSKMSLPKPTWDNGYGTNSPSGTIDGPSALKAPSGMSFSTDPTSNTKAFTAALKASSYGS  84

Query  76   LRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTM-RSTGYTHDGPCEVWLDTTRVLQ  134
            L+A    A+     GA   CGF+   G AQP+PD         +H+GPCEVW D T    
Sbjct  85   LKALAF-ATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAFH  143

Query  135  SDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             DNC +T++     L Y  S C G+  L   WL +       +WQVY  C P+
Sbjct  144  GDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLALH----TPTWQVYTNCAPI  192

>PHYSO_262844
Length=276

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 65/129 (50%), Gaps = 27/129 (21%)

Query  70   DKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------T  118
            +  +KTLRA MD A+          CG T + G   P+   ++ S  +           +
Sbjct  72   NSQFKTLRAMMDTAASD--------CGNTALTG--SPVDVSSLSSMKWQNDQEQMGFIDS  121

Query  119  HDGPCEVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSW  176
            H GPCE W+D TRV  SD+C   ++       +DYS+C G CT  +YWL +    +E +W
Sbjct  122  HHGPCEAWIDDTRVFHSDDCRAAYTSYPAEIPIDYSACSGDCTFTFYWLAL----HEPNW  177

Query  177  QVYKACVPL  185
            QVYK C P+
Sbjct  178  QVYKQCAPI  186

>PHYRA_73581
Length=293

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 48/82 (59%), Gaps = 9/82 (11%)

Query  114  STGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTY--------DLDYSSCKGS-CTLRWYW  164
            S G  H GPCE+WLD T VL  D+C +TF    Y         +DYSSC  S C LR+YW
Sbjct  123  SRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYW  182

Query  165  LGVRFLKNEYSWQVYKACVPLS  186
            L  +   + Y WQ+YK CVPL+
Sbjct  183  LAFQGSNDGYVWQIYKHCVPLT  204

>PYAR_20617
Length=254

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 76/166 (46%), Gaps = 16/166 (10%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLE---NQGYETVEDFNAWRRDKGYKTLRAFMDG  82
            DAH  V L  P       A+K + +A  +      ++T   + A  + +G   LR F++ 
Sbjct  20   DAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFLED  79

Query  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYT--HDGPCEVWLDTTRVLQSDNCHE  140
                        CG +      + IP     S   T  H GPCEVW D       D+C +
Sbjct  80   KGPV--------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDCEK  131

Query  141  TF-SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            TF S  ++ +D+S C GSC LR+YWLG++       WQ YK CVPL
Sbjct  132  TFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PHYRA_78176
Length=312

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 77/176 (44%), Gaps = 22/176 (13%)

Query  28   HQVVLLPAPTYTTDDKATKYAPLAFLENQGY---------ETVEDFNAWRRDKGYKTLRA  78
            H  +  PA T+ T +  T++         G+         +    F        Y +L+ 
Sbjct  25   HGYLSDPAVTFLTTNDPTQFIATIEATASGFSGTFNGAPADNTAAFTTAFESSSYSSLKE  84

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGYT--HDGPCEVWLDTTR  131
            F+D  +      A   CG  D    AQP+P+  +      S G+T  H+GPCEVW D  R
Sbjct  85   FIDDKATITVTDATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASHEGPCEVWCDDVR  144

Query  132  VLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            V Q D+C   F+     L  D+ +C GS  L +YWL +    +  +WQVY  C PL
Sbjct  145  VFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLAL----HSSTWQVYVNCAPL  196

>PHYKE_6078
Length=317

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 85/183 (46%), Gaps = 28/183 (15%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDK-----------GYK  74
            + H  +  PA T+ T +  T++  +A +E         FN    D             Y 
Sbjct  22   NGHGYMSDPAVTFLTSNDPTQF--IATIEASDSGLSGTFNGAPADNTAAFTTAFESSSYS  79

Query  75   TLRAFM-DGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGYT--HDGPCEVW  126
            +L+ F+ D A+ TV D A   CG  D    AQ +PD  +      S G+T  H+GPCEVW
Sbjct  80   SLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVW  138

Query  127  LDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVP  184
             D TRV Q D+C   ++     L  D+ +C GS T+  YWL +       +WQVY  C P
Sbjct  139  CDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALH----SSTWQVYVNCAP  194

Query  185  LST  187
            L T
Sbjct  195  LET  197

>PPTG_04803
Length=268

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 70/134 (52%), Gaps = 18/134 (13%)

Query  58   YETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR--S  114
            Y+ V+D   W       +L+ F+      +++     CG T+ KG AQP+P DG  +  +
Sbjct  63   YQAVDD---WFTKNNVASLKEFITTYGTDISE-----CGNTEKKGTAQPVPSDGYAQHDT  114

Query  115  TGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT---YDLDYSSCKGSCTLRWYWLGVRFLK  171
             G +H GPCE+W D TRV    NC  TFSG++     +D S+CK S    +YWL +    
Sbjct  115  LGNSHPGPCEIWCDDTRVFHDTNCVVTFSGQSPAKIPIDVSTCKSSSEFVFYWLAL----  170

Query  172  NEYSWQVYKACVPL  185
            +   WQVY  CV L
Sbjct  171  HAQPWQVYINCVAL  184

>SPRG_19917
Length=241

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 70/141 (50%), Gaps = 26/141 (18%)

Query  59   ETVEDFN-AWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR---  113
                +FN A++    YKTLRA +D        G D  CG T      + IP +G M    
Sbjct  58   NNAANFNKAFKAQSKYKTLRALLD------QHGPD--CGNTLTNVARKEIPSNGKMTFQN  109

Query  114  -STG----YTHDGPCEVWLDTTRVLQSDNCHETFSGK---TYDLDYSSCKG-SCTLRWYW  164
              TG     +H GPCEVWLD  RV Q+D+C   F  K      +DYSSC    C LR+YW
Sbjct  110  PDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYW  169

Query  165  LGVRFLKNEYSWQVYKACVPL  185
            + +   +    WQVYK CVPL
Sbjct  170  IALHSPR----WQVYKNCVPL  186

>SDRG_07565
Length=278

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 83/180 (46%), Gaps = 34/180 (19%)

Query  27   AHQVVLLPAPTYTTDDKATKYA-------PLAFLENQGYETVEDFN-AWRRDKGYKTLRA  78
             H +V  PA  ++ +   T Y        P  F +    E V  F  A++    +KTLR 
Sbjct  80   GHGIVSNPAAEFSPNVMRTTYVATIQANLPGKF-DGSPQENVAAFTTAFKAQSQFKTLRD  138

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEVWLDT  129
             ++             CG +      + IP DGTM         G+  +H GPCEVWLD 
Sbjct  139  MLEPQGPA--------CGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTGPCEVWLDD  190

Query  130  TRVLQSDNCHETFSGKT---YDLDYSSCKGS-CTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             RV Q D+C   F  K      +DYSSC GS C LR+YWL +    ++  WQVYK CVPL
Sbjct  191  KRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLAL----HQPQWQVYKNCVPL  246

>PHYSO_484051
Length=285

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 66/129 (51%), Gaps = 14/129 (11%)

Query  68   RRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQ--PIPDGTMRSTGYTHDGPCEV  125
            +   GY  +R  +D  S T   GAD  CGFT+     +  P       S    H  PCE+
Sbjct  73   KESNGYSDIRTLLD--SDTSLYGAD--CGFTNPDASPKDPPTTGDPTFSRCMVHASPCEI  128

Query  126  WLDTTRVLQSDNCHETFSGKTYD-------LDYSSCKGS-CTLRWYWLGVRFLKNEYSWQ  177
            WLD T VL +D+C   +   T +       +DYSSC  S C LR+YWL  + + ++  WQ
Sbjct  129  WLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  188

Query  178  VYKACVPLS  186
            VYK CVPL+
Sbjct  189  VYKDCVPLT  197

>PPTG_03160
Length=379

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 13/137 (9%)

Query  59   ETVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----  113
            + V  F        YK+L+ ++   +  +  GA   CG  D K   QP+P  T+      
Sbjct  62   DNVAAFTKAFTSSKYKSLKEYVTDKAKIIVSGATLTCGSCDPKQEPQPMPKSTVEWSHSD  121

Query  114  STGYT--HDGPCEVWLDTTRVLQSDNC--HETFSGKTYDLDYSSCKGSCTLRWYWLGVRF  169
            S G+T  H+GPCEVW D  R  Q D+C  H T        D  +C G+ TL +YW+ +  
Sbjct  122  SEGFTPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAM--  179

Query  170  LKNEYSWQVYKACVPLS  186
              +  SWQVY  C PL+
Sbjct  180  --HSSSWQVYVNCAPLA  194

>SDRG_08137
Length=282

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 84/179 (47%), Gaps = 34/179 (19%)

Query  28   HQVVLLPAPTYTTDDKATKYA-------PLAFLENQGYETVEDF-NAWRRDKGYKTLRAF  79
            H +V  PA  ++ +   T Y        P  F +    E V  F +A++    +KTLR  
Sbjct  83   HGIVSNPAAEFSLNVMRTTYVATIQANLPGKF-DGSPQENVAAFTSAFKAQSQFKTLRDM  141

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEVWLDTT  130
            ++             CG +      + IP DGTM         G+  +H GPCEVWLD  
Sbjct  142  LEPQGPA--------CGNSLPNASKKTIPSDGTMTWRNPDTGEGFISSHTGPCEVWLDDK  193

Query  131  RVLQSDNCHETFSGKT---YDLDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            RV Q+D+C   F  K      +DYSSC G  C LR+YWL +    ++  WQVYK CVPL
Sbjct  194  RVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLAL----HQPQWQVYKNCVPL  248

>SDRG_17318
Length=241

 Score = 79.3 bits (194),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 83/178 (47%), Gaps = 32/178 (18%)

Query  28   HQVVLLPAPTYTTDDKATKYAP--LAFLENQGYETVED----FN-AWRRDKGYKTLRAFM  80
            H +V  P   +  D   T Y     AFL  +   +  D    FN A++    YKTLRA +
Sbjct  21   HGIVSNPFAEFKADVMHTTYVAEIQAFLPGKFNGSPRDNAVNFNKAFKAQSKYKTLRAML  80

Query  81   DGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEVWLDTTR  131
            D        G D  CG T      + IP +G M         G+  +H GPCEVWLD  R
Sbjct  81   D------PHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTGEGFIPSHTGPCEVWLDNKR  132

Query  132  VLQSDNCHETFSGK---TYDLDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            V Q+D+C   F  K      +DYSSC    C LR+YW+ +   +    WQVYK CVPL
Sbjct  133  VFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALHSPR----WQVYKNCVPL  186

>CCI47381
Length=211

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 18/137 (13%)

Query  64   FNAWRRDKGYKTLRAFMDGASYTVAD---GADYYCGFTDIKGVAQPIP---------DGT  111
            F+   +D     L AF      T+ D       YCG T+     +PIP           T
Sbjct  52   FDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPYCGSTNPNASPKPIPADNAIVWENPDT  111

Query  112  MRSTGYTHDGPCEVWLDTTRVLQSDNC--HETFSGKTYDLDYSSCKGSCTLRWYWLGVRF  169
                  +H GPCEVWL  TRV   DNC  H T S     +++SSC G C L+++WL +  
Sbjct  112  REGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL--  169

Query  170  LKNEYSWQVYKACVPLS  186
              +E  WQVYK C+P++
Sbjct  170  --HEPQWQVYKNCIPIA  184

>PHYSO_524101
Length=308

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 67/132 (51%), Gaps = 15/132 (11%)

Query  64   FNAWRRDKGYKTLRAFM-DGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGY  117
            F        Y +L+  + D A+ TV D A   CG  D    AQP+PD  +      S G+
Sbjct  69   FTTAFESSSYSSLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGF  127

Query  118  T--HDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNE  173
            T  H+GPCEVW D  RV Q D+C   ++    +L Y   +C GS TL +YWL +    + 
Sbjct  128  TASHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLAL----HS  183

Query  174  YSWQVYKACVPL  185
             +WQVY  C PL
Sbjct  184  STWQVYVNCAPL  195

>PHYCA_69583
Length=224

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 70/131 (53%), Gaps = 17/131 (13%)

Query  69   RDKGY-KTLRAFMDGASYTVADGADYYCGFTDIKGVAQ-PIPDGTMR-STGYTHDGPCEV  125
            ++ GY   +R  +D  S T   GA+  CGF++    A+ P  DGT     G  H GPCE+
Sbjct  73   KEAGYANNIRKLLD--SDTNLYGAN--CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEI  128

Query  126  WLDTTRVLQSDNCHETFSGKTY--------DLDYSSCKGS-CTLRWYWLGVR-FLKNEYS  175
            WLD   VL +D+C + FS   Y         +DYSSC  S C  R+YWL  +     +Y 
Sbjct  129  WLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYV  188

Query  176  WQVYKACVPLS  186
            WQ+YK C+PL+
Sbjct  189  WQIYKDCIPLT  199

>PYIW_21964
Length=265

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 81/184 (44%), Gaps = 26/184 (14%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYA-----PLAFLENQGYETVED-------FNAWRRD  70
            P   AH  + +P  T+   D  T++A     P       G     D       F A  + 
Sbjct  20   PLVSAHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKA  79

Query  71   KGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGYT--HDGPC  123
              YK++RA +D  +  + + A+  CG T   G  QP+PD  +      S G+T  H GPC
Sbjct  80   STYKSMRALVDDKAVFIKE-ANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPC  138

Query  124  EVWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
            EVW D       +NC   ++    +L  D++ C G+  L+  WL +    +  +WQ+Y  
Sbjct  139  EVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLAL----HSSTWQIYIN  194

Query  182  CVPL  185
            C PL
Sbjct  195  CAPL  198

>SDRG_08782
Length=450

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 86/184 (47%), Gaps = 34/184 (18%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYA-------PLAFLENQGYETVEDFN-AWRRDKGYK  74
            P    H +V  P   + +D   TKY        P  F ++     V +FN A++    +K
Sbjct  15   PLISGHGIVSNPPAEFRSDVMRTKYVATIQANFPGKF-DDSPQTNVANFNKAFKAQSQFK  73

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEV  125
            TLR  +D        G D  CG+T      + IP +G M         G+  +H GPCEV
Sbjct  74   TLRDMLD------PHGPD--CGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEV  125

Query  126  WLDTTRVLQSDNCHETFSGK---TYDLDYSSCKGS-CTLRWYWLGVRFLKNEYSWQVYKA  181
            W+D  RV Q+D+C   F         +DYSSC  + C LR+YWL +     E  WQVYK 
Sbjct  126  WIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALH----EPMWQVYKN  181

Query  182  CVPL  185
            CVPL
Sbjct  182  CVPL  185

>PYU1_G001514
Length=469

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPD-----GTMRSTGYT--HDGPCEV  125
            YK++RA +D A      G D  CG T   G  QP+P          S G+T  H GPCEV
Sbjct  83   YKSMRALVD-AKGVFQPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCEV  141

Query  126  WLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACV  183
            W D TRV Q DNC + ++     L  D S C G+  L+ YWL +       +WQ Y  C 
Sbjct  142  WCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQAYINCA  197

Query  184  PL  185
            PL
Sbjct  198  PL  199

>PPTG_18166
Length=445

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 82/185 (44%), Gaps = 41/185 (22%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAP----LAFLEN-----QGYETVEDFNAWRRDKGYKT  75
            ADAH  +  P P +       K +P    +  ++N      G + V  F    ++KG   
Sbjct  19   ADAHGYLKQPEPDW-------KDSPNPGWITMVDNYWDIGSGGDQVGKFKTMAKEKGMSV  71

Query  76   LRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM-----RSTGYTHDGPCEVWLDT  129
                +D          D  CG T   G  +PIP DG +     R  G+TH GPCE++LD 
Sbjct  72   KDVVLDMVK-------DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDD  124

Query  130  TRVLQSDNCHETF--------SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
              VL  D+C E +        SG    +D+SSC G CTL  YWL  +  +    WQ Y  
Sbjct  125  KMVLHGDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ----WQTYVN  180

Query  182  CVPLS  186
            CVPLS
Sbjct  181  CVPLS  185

>PHYKE_1913
Length=280

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 78/180 (43%), Gaps = 32/180 (18%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLRAF  79
            ADAH  +  P PT+  +D A     +  +EN      G + V  +     +KG       
Sbjct  20   ADAHGHLKSPEPTF--EDGAPTVEWVTLIENYWDIGSGGDQVGKYKTMAAEKGMSVKDVV  77

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM-----RSTGYTHDGPCEVWLDTTRVL  133
            +D          D  CG+T      +P+P DG          G+TH GPCEV+++   VL
Sbjct  78   LDMVK-------DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVL  130

Query  134  QSDNCHETFSG--------KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
              D+C + + G            +DYSSC G CTL  YWL  +  +    WQ Y  CVPL
Sbjct  131  HGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>SPRG_07797
Length=318

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query  60   TVEDFNAWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY--  117
              ++F    +   +KTL+AF+D        G D  CG TD  G AQP+P     + G   
Sbjct  63   NTDEFTKHFKASSFKTLKAFLDAH----PSGGD--CGITDANGPAQPLPSTVKWANGQEG  116

Query  118  ---THDGPCEVWLDTTRVLQSDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEY  174
               +H GPCE+W D  RV   +NC   +      +D S C G+  L   WL +       
Sbjct  117  FISSHQGPCELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH----SP  172

Query  175  SWQVYKACVPLS  186
             WQVYK CV LS
Sbjct  173  QWQVYKNCVNLS  184

>PPTG_03138
Length=294

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 85/182 (47%), Gaps = 28/182 (15%)

Query  27   AHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAF-------  79
            AH  +  PA T+ T +  T++  +A +E+        FN    D      +AF       
Sbjct  23   AHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGTFNGAPADNTAAFTKAFESSSFSS  80

Query  80   -----MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR-----STGYT--HDGPCEVWL  127
                  + A+ TV+D A   CG  D    AQP+PD  +      S G+T  H+GPCE+W 
Sbjct  81   LKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCEIWC  139

Query  128  DTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            D  RV Q D+C   ++     L  D+ +C GS  L +YWL +    +  +WQVY  C PL
Sbjct  140  DDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLAL----HSSTWQVYVNCAPL  195

Query  186  ST  187
             +
Sbjct  196  ES  197

>PHYRA_83494
Length=224

 Score = 78.6 bits (192),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 56/111 (50%), Gaps = 18/111 (16%)

Query  90   GADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            G D  CG TD     Q +P DG  +       G+TH GPCE+++D   VL  DNC + + 
Sbjct  18   GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYP  77

Query  144  GK------TYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            G       T D+  DYSSC G CT   YWL  +  +    WQ Y  CVPL+
Sbjct  78   GGDVGSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLT  124

>SDRG_08129
Length=218

 Score = 78.2 bits (191),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 83/180 (46%), Gaps = 34/180 (19%)

Query  27   AHQVVLLPAPTYTTDDKATKYA-------PLAFLENQGYETVEDF-NAWRRDKGYKTLRA  78
             H +V  PA  ++ +   T Y        P  F +    E V  F +A++    +KTLR 
Sbjct  18   GHGIVSNPAAEFSPNVMRTTYVATIQANLPGKF-DGSPQENVAAFTSAFKVQSQFKTLRD  76

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEVWLDT  129
             ++             CG +      + IP DG M         G+  +H GPCEVWLD 
Sbjct  77   MLEPQGPA--------CGNSLPNASKKTIPSDGAMTWRNPDTGEGFISSHTGPCEVWLDD  128

Query  130  TRVLQSDNCHETFSGKT---YDLDYSSCKG-SCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             RV Q+D+C   F  K      +DYSSC G  C LR+YWL +    ++  WQVYK CVPL
Sbjct  129  KRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLAL----HQPQWQVYKNCVPL  184

>PPTG_01148
Length=295

 Score = 79.3 bits (194),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 68/127 (54%), Gaps = 27/127 (21%)

Query  73   YKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------THDG  121
            +KTL+A MD    TVA      CG T + G   P+   ++ S  +           +H G
Sbjct  75   FKTLKAMMD----TVASD----CGKTSLTG--SPVDVSSLSSMTWQNDQEQKGFIDSHRG  124

Query  122  PCEVWLDTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVY  179
            PCE W+D TRV  SD+C   ++G   ++  D+SSC G CT  +YWL +    +E +WQVY
Sbjct  125  PCEGWIDDTRVFHSDDCRADYTGYPAEIPVDFSSCSGDCTFTFYWLAL----HEPNWQVY  180

Query  180  KACVPLS  186
            K C P++
Sbjct  181  KQCAPIT  187

>PYIR_22549
Length=255

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 77/176 (44%), Gaps = 25/176 (14%)

Query  24   TADAHQVVLLPAPTY-----TTDDKATKYAPLAFLENQGYETVED-------FNAWRRDK  71
            TADAH  + LP PT+     T     T   P A     G     D       F A  +  
Sbjct  20   TADAHSKMSLPKPTWDNGYGTNSPSGTIDGPSALTAPSGMSFSTDPSSNTKAFTAALKSS  79

Query  72   GYKTLR--AFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTM-RSTGYTHDGPCEVWLD  128
             Y +L+  AF   A+     GA   CGF+ + G AQP+PD         +H+GPCEVW D
Sbjct  80   KYGSLKELAF---ATQKTESGASKDCGFSKV-GAAQPLPDVVQWDELTPSHEGPCEVWCD  135

Query  129  TTRVLQSDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKAC  182
             T     DNC +T++G    L Y  S C G+  L   WL +       +WQVY  C
Sbjct  136  GTMAFHGDNCAKTYTGTPAKLPYDKSKCSGAKVLMSIWLALH----TPTWQVYTNC  187

>PHYCA_112615
Length=196

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 80/167 (48%), Gaps = 25/167 (15%)

Query  23   PTADAHQVVLLPAPTYTTDDKA---TKYAPLAFLEN---QGYETVEDFNAWRRDKGYKTL  76
            P+ DAH  +L+P   +     +    +  P+   E+       +V+ F A +    +K L
Sbjct  19   PSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVDAFKALKTANNFKDL  78

Query  77   RAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-STGYTHDGPCEVWLDTTRVLQ  134
            +  MD  S   AD     CGFTD  G AQPIP DG    S    H GPCE+WLD T+ ++
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWLDDTKDIK  133

Query  135  SDNCHETFSGKTYDLDYSSC-KGSCT-LRWYWLGVRFLKNEYSWQVY  179
            S           + +DYSSC  G C  +R+YWL  + +  +  WQ Y
Sbjct  134  S----------IFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  170

>CCA17179
Length=185

 Score = 77.0 bits (188),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 15/104 (14%)

Query  94   YCGFTDIKGVAQPIP---------DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF--  142
            YCG T+     +PIP           T      +H GPCEVWL+  RV   DNC E F  
Sbjct  59   YCGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRS  118

Query  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
            S     +D+S+C   C L+++WL +     E  WQVYK C+P++
Sbjct  119  SPARIPIDFSTCTNGCLLQFFWLALH----EPQWQVYKNCIPIA  158

>PPTG_03139
Length=320

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 77/180 (43%), Gaps = 22/180 (12%)

Query  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGY---------ETVEDFNAWRRDKGYK  74
            T   H  + +P   +T +   T+Y       + G+         +   +FN       Y 
Sbjct  20   TVKGHGYMSVPKVEFTFNGDTTQYMATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYS  79

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPD-------GTMRSTGYTHDGPCEVWL  127
            +L+ FM      V+      CG+T+     QP+P+       G+      +H+GPCEVW 
Sbjct  80   SLKEFMTDKMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVWC  139

Query  128  DTTRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            D TRV Q DNC + F      L  D+ +C GS  L  YW+ +    +  SWQVY  C  L
Sbjct  140  DDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HSPSWQVYINCAAL  195

>PYU1_G001525
Length=312

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 80/178 (45%), Gaps = 21/178 (12%)

Query  24   TADAHQVVLLPAPTY-----------TTDDKATKYAP--LAFLENQGYETVEDFNAWRRD  70
            TADAH  + LP PT+           T D       P  ++F  +    T     A++  
Sbjct  16   TADAHSKMALPKPTWNPVWGTNSPSGTIDGPKALTVPGGMSFGTDPTSNTKAFTAAFKAQ  75

Query  71   KGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTM-RSTGYTHDGPCEVWLDT  129
              YK+L+  +  A+ TV  G    CGF+ + G  QP+PD         +H+GPCE+W D 
Sbjct  76   TKYKSLKDLV-FATQTVESGTTKECGFSLVSGTPQPLPDVVEWDELTPSHEGPCEIWCDN  134

Query  130  TRVLQSDNCHETFSGKTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
                 ++NC + + G    L  D S C G+  L   WL +    +  +WQVY  C PL
Sbjct  135  KLAFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLAL----HTPTWQVYTNCAPL  188

>PYU1_G005871
Length=284

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 80/184 (43%), Gaps = 38/184 (21%)

Query  26   DAHQVVLLPAPTYTTDDKATKY-APLAFLENQGY----------ETVEDFNAWRRDKGYK  74
            +AH  V  P  TY      T Y A +    N+G+          +  + F A     GYK
Sbjct  22   EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------THDGPC  123
            +L+  MD A           CG+++    A P+    M +  +           +H GPC
Sbjct  82   SLKQMMDKAVPG--------CGYSNPN--AAPVDVSKMSAMKFQNNEYKEGFLGSHHGPC  131

Query  124  EVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
            E W+D TRV   D+C   F G   T  + Y SCKG+C L +YWL +   K    WQ YK+
Sbjct  132  EGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKS  187

Query  182  CVPL  185
            CV +
Sbjct  188  CVAI  191

>PHYSO_374518
Length=116

 Score = 75.1 bits (183),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 10/97 (10%)

Query  95   CGFTDIKGVAQPIP-DGTMR--STGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT---YD  148
            CG T+ KG+AQP+P DG  +  + G +H GPCE+W D TRV  + NC + ++G+      
Sbjct  8    CGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPTKLP  67

Query  149  LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            +D S+CK S    +YWL +    +   WQVY  CV L
Sbjct  68   IDVSTCKASSEFVFYWLAL----HAQPWQVYINCVAL  100

>PYU1_G005872
Length=297

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 80/184 (43%), Gaps = 38/184 (21%)

Query  26   DAHQVVLLPAPTYTTDDKATKY-APLAFLENQGY----------ETVEDFNAWRRDKGYK  74
            +AH  V  P  TY      T Y A +    N+G+          +  + F A     GYK
Sbjct  22   EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGY-----------THDGPC  123
            +L+  MD A           CG+++    A P+    M +  +           +H GPC
Sbjct  82   SLKQMMDKAVPG--------CGYSNPN--AAPVDVSKMSAMKFQNNEYKEGFLGSHHGPC  131

Query  124  EVWLDTTRVLQSDNCHETFSG--KTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
            E W+D TRV   D+C   F G   T  + Y SCKG+C L +YWL +   K    WQ YK+
Sbjct  132  EGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKS  187

Query  182  CVPL  185
            CV +
Sbjct  188  CVAI  191

>SDRG_15426
Length=523

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 68/140 (49%), Gaps = 26/140 (19%)

Query  60   TVEDFN-AWRRDKGYKTLRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR----  113
             V +FN A+     YKTLR  +D        G D  CG T      +PIP DG M     
Sbjct  32   NVANFNKAFAAQSQYKTLRDLLD------LSGPD--CGNTRTNVAPKPIPSDGMMTWQNP  83

Query  114  --STGY--THDGPCEVWLDTTRVLQSDNCHETF---SGKTYDLDYSSC-KGSCTLRWYWL  165
                G+  +H GPCE+WLD  RV Q+DNC   F         +DY+ C    C LR+YWL
Sbjct  84   DTGEGFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWL  143

Query  166  GVRFLKNEYSWQVYKACVPL  185
             +     +  WQVYK CVPL
Sbjct  144  ALH----QPQWQVYKNCVPL  159

>PYIW_16810
Length=216

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 80/178 (45%), Gaps = 18/178 (10%)

Query  23   PTADAHQVVLLPAPTYTTDDKATK----YAPLAFLENQGYETVEDFNAWRRDKGYKTLRA  78
            P  DAH  + LPAPT+    K+      Y  +   +N    T   F A  +  G+K+LRA
Sbjct  21   PNVDAHGRLALPAPTFIASAKSKPNYWAYG-VDNTKNPPRATAATFAANYKKNGFKSLRA  79

Query  79   F-MDGASYTVADGADY----YCGFTDIKGVAQPIPDGTM-RSTGYTHDGPCEVWLDTTRV  132
            F MD  +    DG        CGFTD  G  QP+PD        + H+GPCE W D   V
Sbjct  80   FIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCDDVLV  139

Query  133  LQ-SDNCHETFSGKTYDLDY--SSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187
            +  + +C     G    + Y  + C G   L +YWL   F+     +Q Y  CVP+ +
Sbjct  140  MPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLAT-FVS---PFQAYTNCVPIKS  193

>PYIR_24743
Length=357

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 83/179 (46%), Gaps = 31/179 (17%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQG------YETVEDF-NAWRRDKGYKTLRA  78
            DAH  V  P   +      TKY        QG         V+ F  A++    +KTLR 
Sbjct  33   DAHGYVSSPLAEFKDGVMPTKYTATMSPAFQGKFNDNPQANVDTFTKAFQGQSEFKTLRD  92

Query  79   FMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTM------RSTGY--THDGPCEVWLDT  129
             +         GAD  CG +      + IP DG +         G+  +H GPCE+WLD 
Sbjct  93   LLKD------HGAD--CGDSKPDASRKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDD  144

Query  130  TRVLQSDNCHETFSGK---TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             RV   +NC   F+ K      +D+SSCK +C LR+YWL +    +E +WQVYK CVPL
Sbjct  145  KRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HEPTWQVYKNCVPL  199

>PYAP_24691
Length=145

 Score = 75.1 bits (183),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query  119  HDGPCEVWLDTTRVLQSDNCHETFSGKT-YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQ  177
            H GPCE+W D TRV    +C + F   T + +DYS CKG+C LR+YWLG++       WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQ  60

Query  178  VYKACVPLST  187
             YK CVP+  
Sbjct  61   SYKNCVPIGN  70

>SPRG_07627
Length=536

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 85/183 (46%), Gaps = 32/183 (17%)

Query  23   PTADAHQVVLLPAPTYTTDDKATKYAPL--AFL----ENQGYETVEDFN-AWRRDKGYKT  75
            P    H V+  P   +  +   T Y  +  AFL    ++     V +FN A+     YKT
Sbjct  13   PFISGHGVISSPLAEFAPNIMRTTYVAIIQAFLPGKFDDSPQTNVANFNKAFAAQTQYKT  72

Query  76   LRAFMDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR------STGY--THDGPCEVW  126
            LR  +D        G D  CG T     A+ IP DG M         G+  +H GPCE+W
Sbjct  73   LRDLLD------LHGPD--CGNTLPNVAAKAIPSDGKMTWKNPDTGEGFIPSHTGPCEIW  124

Query  127  LDTTRVLQSDNCHETFSG---KTYDLDYSSC-KGSCTLRWYWLGVRFLKNEYSWQVYKAC  182
            LD+TRV Q+++C   F         +DY+ C    C LR+YWL +     +  WQVYK C
Sbjct  125  LDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALH----QPQWQVYKNC  180

Query  183  VPL  185
            VPL
Sbjct  181  VPL  183

>PYAP_23672
Length=257

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 83/178 (47%), Gaps = 30/178 (17%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRD----------KGYKT  75
            +AH  ++LP PTY       K+     + +    +V  F AWR+D          K   +
Sbjct  20   EAHGELMLPRPTYP------KWG--GGVTSTISPSVLPF-AWRQDFPQAFDEAITKTGLS  70

Query  76   LRAF------MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDT  129
            L+ F      M GAS T   G+   CG++D KG  QP+P+     TG+ H GPCE + D 
Sbjct  71   LKDFIMKYQNMSGASDT---GSTPECGYSDPKGTPQPLPEKIQFHTGFMHWGPCEAYCDN  127

Query  130  TRVLQ-SDNCHETFSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186
              V + + +C   + G     D + C G    ++YWLG+    N   WQ Y  CVPLS
Sbjct  128  VLVTKHAADCKVAYPGGAVPYDKAKCAGKKQFKFYWLGMDS-GNSAPWQAYVNCVPLS  184

>PHYCA_14560
Length=300

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 21/125 (17%)

Query  72   GYKTLRAFMD------GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEV  125
            GYK+LR  +D      G S   A   D   G+T++        +G + S    H+GPCE 
Sbjct  75   GYKSLREMLDPIAPDYGHSLKTATPVDV-SGYTEMWWQNDEYKEGFIAS----HEGPCEA  129

Query  126  WLDTTRVLQSDNCHETFSGKTY----DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
            W+D TR+   DNC   F  KTY      DYSSCKG C   +YWL +    +E  WQ+YK 
Sbjct  130  WIDDTRIFHYDNCAAQF--KTYPAKVPADYSSCKGDCLFVFYWLAL----HEPDWQIYKQ  183

Query  182  CVPLS  186
            CVP++
Sbjct  184  CVPIT  188

>PHYKE_5749
Length=300

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 78/180 (43%), Gaps = 31/180 (17%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLRAF  79
            ADAH  +  P P++  D        +  ++N      G + V  F     +KG       
Sbjct  20   ADAHGYLKEPKPSWK-DGGDGNVGWITQVDNYWDIGSGGDQVGKFKTMAAEKGMSVKDVV  78

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVL  133
            +D             CG T   G  QPIP DG  +       G+TH GPCE++LD   VL
Sbjct  79   LDMVGSQT-------CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVL  131

Query  134  QSDNCHETFSG------KTYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             SD+C + F G      +T D+  DYSSC G C    YWL  +  +    WQ Y  CVPL
Sbjct  132  HSDDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PHYCA_103479
Length=314

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 21/125 (17%)

Query  72   GYKTLRAFMD------GASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEV  125
            GYK+LR  +D      G S   A   D   G+T++        +G + S    H+GPCE 
Sbjct  75   GYKSLREMVDPIATDYGFSVKTATPVDV-TGYTEMWWQNDEYKEGFIAS----HEGPCEG  129

Query  126  WLDTTRVLQSDNCHETFSGKTY----DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKA  181
            W+D TR+   DNC   F  KTY      DYSSCKG C   +YWL +     E +WQ+YK 
Sbjct  130  WIDDTRIFHYDNCAAQF--KTYPAKIPADYSSCKGDCLFSFYWLALH----EPNWQIYKQ  183

Query  182  CVPLS  186
            CVP++
Sbjct  184  CVPIT  188

>PHYCA_18657
Length=295

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 77/181 (43%), Gaps = 31/181 (17%)

Query  25   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEN-----QGYETVEDFNAWRRDKGYKTLRAF  79
             DAH  +  P+ T+   D A+    +  ++N      G + V  +    ++KG       
Sbjct  105  VDAHGHLNQPSSTF--QDGASHVNWVTQIDNFWDIGSGGDQVGKYKTLAKEKGVSVRDVI  162

Query  80   MDGASYTVADGADYYCGFTDIKGVAQPIPDGTMR------STGYTHDGPCEVWLDTTRVL  133
            +         G D  CGFT      +P+P             G+TH GPCE+++D   VL
Sbjct  163  LQMV------GNDKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVL  216

Query  134  QSDNCHETFSGKTYD--------LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             SD+C   + G   D        +DYSSC G CT   YWLG +       WQ Y  CVPL
Sbjct  217  HSDDCQADYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVPL  272

Query  186  S  186
            S
Sbjct  273  S  273

>PPTG_07521
Length=281

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 56/110 (51%), Gaps = 18/110 (16%)

Query  90   GADYYCGFTDIKGVAQPIP-DGTMR-----STGYTHDGPCEVWLDTTRVLQSDNCHETFS  143
            GA   CG T   G  QPIP DG  +       G+TH GPCE++LD   VL  DNC + + 
Sbjct  81   GAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYP  140

Query  144  GK------TYDL--DYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
            G       T D+  DYSSC   CTL  YWL  +      +WQ Y  CVPL
Sbjct  141  GGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NANWQAYINCVPL  186

>PHYCA_122958
Length=260

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 79/179 (44%), Gaps = 27/179 (15%)

Query  26   DAHQVVLLPAPTYTTDDKATKYAPLAFLENQG-----------YETVEDFNAWRRDKGYK  74
            DAH  +  PA  +     +T Y      +  G                 F +   + GY 
Sbjct  20   DAHGYISKPAAQFVDPTASTSYVKTITADVNGAFGGLKWDDNPVANAATFTSSFPNTGYS  79

Query  75   TLRAFMDGASYTVADGADYYCGFT--DIKGVAQPIPDGTMRSTGY--THDGPCEVWLDTT  130
            +LR  +D     V+D A+     +  D+ G+            G+  +H GPCEVW+D T
Sbjct  80   SLRNMLD---QQVSDCANTKTDVSPVDVSGLTVMNWQNDQEQKGFIDSHHGPCEVWIDDT  136

Query  131  RVLQSDNCHETFSGKTY----DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185
             V   D+C  T+ G +Y      DYS C G CTLR+YWL +     E +WQ+YK CVP+
Sbjct  137  MVDHQDDCVATY-GSSYPANVKADYSQCSGDCTLRFYWLALH----EPNWQIYKQCVPI  190

Lambda      K        H        a         alpha
   0.322    0.137    0.457    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9540163245

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40