Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_95903147551341346954e-95
PHYCA_11834147551341346234e-84
PHYSO_321155147551361336151e-82
PPTG_17126147551361336071e-81
PITG_18455147551321305774e-77
PHALS_06479147551361335769e-77
PHYKE_8392147551381355751e-76
HYAP_07103147551641645214e-68
PYVX_18180147551351304726e-61
PYAP_17747147551341354371e-55
PYU1_G001736147551231263813e-47
PYIW_19970147551301223701e-45
CCA17542147551201213456e-42
PYIR_13454147551291223328e-40
CCI44820147551231243188e-38
SDRG_01782147551231232911e-33
H257_06293147551231232842e-32
SPRG_06335147551231222823e-32
H310_09224147551231232813e-32
PYU1_G0059631114710357942e-04
HYAP_084991114710862924e-04
HYAP_085006526017262928e-04
PHYKE_58411114712146880.002
SPRG_128831114710574870.002
SDRG_149121114710574870.003
PITG_137391114710546860.003
PYAP_228461114710492860.003
H310_07567111479849850.004
PYIW_147431114710557850.004
PYIR_151861114710957850.005
PPTG_092521114710546850.005
PHYSO_3150171114710946840.006
CCA175211114710454820.013
PHALS_115641114710756820.014
PYAR_232071114711260820.014
PYVX_208541114710460810.018
CCI442321114710554790.030
H257_07358111479847790.031
PHYRA_816751114710646790.035
PHYRA_751931416310461750.11
PHYCA_5353801114710846750.13
CCI487201340311484740.20
CCA240562362427061760.24
PYIW_142931416310445710.41
PHALS_00343295789253700.50
PYAR_160001136148850730.58
PHYCA_5404611416310461690.74
SPRG_1173112822943179720.77
H310_00823127212103435710.93
PHYRA_773291699127691711.1
PYIR_221473362117389701.5
PYVX_151505606474667692.1
SPRG_21627911025433682.2
PPTG_19852612352163682.6
PPTG_156551416311261653.1
PYVX_18358141636245623.6
PHYSO_5143231416310461643.8
PYAR_21749141639245634.5
PYAP_248671340314760644.9
PITG_177011416310461635.0
CCI496327093195149656.0
PYIW_2045314445131559657.2
PHYRA_773287043247973647.6
PYVX_202821167235651647.7
PHYSO_3211894996633745648.1
SDRG_0686812822954874648.5
PHYRA_773277043182773648.6
PHYSO_39743287349058649.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_95903

Length=135
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_95903                                                           272        4e-95
PHYCA_11834                                                           244        4e-84
PHYSO_321155                                                          241        1e-82
PPTG_17126                                                            238        1e-81
PITG_18455                                                            226        4e-77
PHALS_06479                                                           226        9e-77
PHYKE_8392                                                            226        1e-76
HYAP_07103                                                            205        4e-68
PYVX_18180                                                            186        6e-61
PYAP_17747                                                            172        1e-55
PYU1_G001736                                                          151        3e-47
PYIW_19970                                                            147        1e-45
CCA17542                                                              137        6e-42
PYIR_13454                                                            132        8e-40
CCI44820                                                              127        8e-38
SDRG_01782                                                            116        1e-33
H257_06293                                                            114        2e-32
SPRG_06335                                                            113        3e-32
H310_09224                                                            112        3e-32
PYU1_G005963                                                          40.8       2e-04
HYAP_08499                                                            40.0       4e-04
HYAP_08500                                                            40.0       8e-04
PHYKE_5841                                                            38.5       0.002
SPRG_12883                                                            38.1       0.002
SDRG_14912                                                            38.1       0.003
PITG_13739                                                            37.7       0.003
PYAP_22846                                                            37.7       0.003
H310_07567                                                            37.4       0.004
PYIW_14743                                                            37.4       0.004
PYIR_15186                                                            37.4       0.005
PPTG_09252                                                            37.4       0.005
PHYSO_315017                                                          37.0       0.006
CCA17521                                                              36.2       0.013
PHALS_11564                                                           36.2       0.014
PYAR_23207                                                            36.2       0.014
PYVX_20854                                                            35.8       0.018
CCI44232                                                              35.0       0.030
H257_07358                                                            35.0       0.031
PHYRA_81675                                                           35.0       0.035
PHYRA_75193                                                           33.5       0.11 
PHYCA_535380                                                          33.5       0.13 
CCI48720                                                              33.1       0.20 
CCA24056                                                              33.9       0.24 
PYIW_14293                                                            32.0       0.41 
PHALS_00343                                                           31.6       0.50 
PYAR_16000                                                            32.7       0.58 
PHYCA_540461                                                          31.2       0.74 
SPRG_11731                                                            32.3       0.77 
H310_00823                                                            32.0       0.93 
PHYRA_77329                                                           32.0       1.1  
PYIR_22147                                                            31.6       1.5  
PYVX_15150                                                            31.2       2.1  
SPRG_21627                                                            30.8       2.2  
PPTG_19852                                                            30.8       2.6  
PPTG_15655                                                            29.6       3.1  
PYVX_18358                                                            28.5       3.6  
PHYSO_514323                                                          29.3       3.8  
PYAR_21749                                                            28.9       4.5  
PYAP_24867                                                            29.3       4.9  
PITG_17701                                                            28.9       5.0  
CCI49632                                                              29.6       6.0  
PYIW_20453                                                            29.6       7.2  
PHYRA_77328                                                           29.3       7.6  
PYVX_20282                                                            29.3       7.7  
PHYSO_321189                                                          29.3       8.1  
SDRG_06868                                                            29.3       8.5  
PHYRA_77327                                                           29.3       8.6  
PHYSO_397432                                                          29.3       9.0  

>PHYRA_95903
Length=134

 Score = 272 bits (695),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 134/134 (100%), Positives = 134/134 (100%), Gaps = 0/134 (0%)

Query  1    MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60
            MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG
Sbjct  1    MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60

Query  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ  120
            YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ
Sbjct  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ  120

Query  121  HFMDRKSGPPRPIF  134
            HFMDRKSGPPRPIF
Sbjct  121  HFMDRKSGPPRPIF  134

>PHYCA_11834
Length=134

 Score = 244 bits (623),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)

Query  1    MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60
            MAARELRPLYKKLLRLAQSLPEPKRQ S+DQIRREFRSHE+LTDPKEVS L+QRAQSSLG
Sbjct  1    MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60

Query  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ  120
            YLKIVTPRAESN G+QR+IYR+G+RVNA+E+E  GEENAR+KTQD+E GLKRHHQLLRRQ
Sbjct  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ  120

Query  121  HFMDRKSGPPRPIF  134
            +FMDRKSGPPRPIF
Sbjct  121  YFMDRKSGPPRPIF  134

>PHYSO_321155
Length=136

 Score = 241 bits (615),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 124/133 (93%), Gaps = 0/133 (0%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61
            AARELRPLYKKLLRLAQSLPEPKR+QSLDQIRREFRSH +LTDP+ VSALIQRAQSSL Y
Sbjct  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63

Query  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121
            LKIVTPR ESN G+QR+IYRNGQRVNA E EA GEENARYKTQDIE GLKRHHQLLRRQ+
Sbjct  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123

Query  122  FMDRKSGPPRPIF  134
            FMDRKSGPPRPIF
Sbjct  124  FMDRKSGPPRPIF  136

>PPTG_17126
Length=136

 Score = 238 bits (607),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61
            A RELRPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR+H +LTDP+EVSALIQRAQSSL Y
Sbjct  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63

Query  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121
            LKIVTPRAESN G+QRYIYRNGQRVNADE E  GEENAR+KTQD+EGGL+RHHQLLRRQ+
Sbjct  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQY  123

Query  122  FMDRKSGPPRPIF  134
            F+DRKSGPPRPIF
Sbjct  124  FLDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 226 bits (577),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64
            ELRPLYKKLLRLAQSLPEPKRQ S+DQIRR+FRSH + TDPKEVSALIQRAQSSL YLKI
Sbjct  3    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKI  62

Query  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124
            VTPRAESN G+QRYIYRNGQRVNA E E  G ENAR+K QD+EGGLKRHHQLL+RQ+FM+
Sbjct  63   VTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMN  122

Query  125  RKSGPPRPIF  134
            RKSGPPRPIF
Sbjct  123  RKSGPPRPIF  132

>PHALS_06479
Length=136

 Score = 226 bits (576),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 117/133 (88%), Gaps = 0/133 (0%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61
            A RELRPLYKKLLRLAQ+LP+ KRQ S+DQIRREFR HE+LTDPKEVS  IQRAQSSL Y
Sbjct  4    ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63

Query  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121
            LKI+TPR ESN G+QR+IYRNGQRVNA + E  G ENAR+KTQD+E G KRHHQLLRRQ+
Sbjct  64   LKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQY  123

Query  122  FMDRKSGPPRPIF  134
            FMDRKSGPPRPIF
Sbjct  124  FMDRKSGPPRPIF  136

>PHYKE_8392
Length=138

 Score = 226 bits (575),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 2/135 (1%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61
            AARELRPLYKKLLR+AQ+LPEPKR QSL QIRREFR+H +L+DPKEVS L+Q AQSSL Y
Sbjct  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSY  63

Query  62   LKIVTPR--AESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRR  119
            LKIVTPR   ESN G+QRYIYRNGQRVNA E+E  GEENARYKTQD+E GLKRHHQL+RR
Sbjct  64   LKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123

Query  120  QHFMDRKSGPPRPIF  134
            QHFMDRKSGPPRP+F
Sbjct  124  QHFMDRKSGPPRPMF  138

>HYAP_07103
Length=164

 Score = 205 bits (521),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 121/164 (74%), Gaps = 35/164 (21%)

Query  6    LRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIV  65
            +RPLYKKLLRLAQSLPEPKRQ+SLDQIRREFR H +LTDPKEVS+L+QRAQSS+ +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  66   TPRAE-----------------------------------SNKGIQRYIYRNGQRVNADE  90
            TPRAE                                   S+ GIQR++YR+G+R++A E
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  91   VEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGPPRPIF  134
            ++  GEENARYKTQDIE G+KRHHQLLRRQHFMDRKSGPPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYVX_18180
Length=135

 Score = 186 bits (472),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 108/130 (83%), Gaps = 0/130 (0%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64
            ELRPLYKKLLRLAQSLPEPKR  ++ QIR EFRSH E+TD  EV+ L+QRAQS LGYLKI
Sbjct  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65

Query  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124
            VTPR  S  G++RYIYRNGQRV+AD  EA GE+ ARYKT D+EG LKRHHQLLRRQHFMD
Sbjct  66   VTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMD  125

Query  125  RKSGPPRPIF  134
            R   PPRPIF
Sbjct  126  RGVAPPRPIF  135

>PYAP_17747
Length=134

 Score = 172 bits (437),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 2/135 (1%)

Query  1    MAARELRPLYKKLLRLAQSLP-EPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59
            MA  ELRPLYK+LLRLA+SLP E KR+ ++ QIR EFRS ++  DPKEV+AL+QRAQ+ +
Sbjct  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60

Query  60   GYLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRR  119
            GYLKIVTPR+ ++ G++ ++Y NG+RV++ +V+   EE ARYKT D EG ++RH+QLLRR
Sbjct  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRR  119

Query  120  QHFMDRKSGPPRPIF  134
            QHFMDR   PP+PIF
Sbjct  120  QHFMDRGVAPPKPIF  134

>PYU1_G001736
Length=123

 Score = 151 bits (381),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 3/126 (2%)

Query  1    MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60
            MA+ +LRP+YKKLL+LAQ+LP  KRQ +++QIRREFR+H    DPKE++AL+ RAQSS+G
Sbjct  1    MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60

Query  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ  120
            YLKIVTPRA S+ G++ Y+Y  G+RV A       E+ ARYKT D    ++RH QLLRRQ
Sbjct  61   YLKIVTPRATSDAGVKNYVYIKGKRVEAAGAA---EDGARYKTADYNAQMQRHVQLLRRQ  117

Query  121  HFMDRK  126
            HFMDRK
Sbjct  118  HFMDRK  123

>PYIW_19970
Length=130

 Score = 147 bits (370),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 95/122 (78%), Gaps = 3/122 (2%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64
            +LRP+YKKLL+LA++LPE KR+ +  QIR EFRS +EL+DPKE++AL+ RAQSS+ YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124
            VTPR  S+ G++ YIY+NGQRV A  V    E+ A+Y+  D  G + RH +LLRRQHFMD
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVM---EDGAKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  125  RK  126
            RK
Sbjct  129  RK  130

>CCA17542
Length=120

 Score = 137 bits (345),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 91/121 (75%), Gaps = 3/121 (2%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64
            + R +YK+L+RLA+SLP  K+  +L  IR EFR H +++DP ++S L++RAQS++GYLKI
Sbjct  3    DTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKI  62

Query  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124
            VTP   S+ G++R+++++G+R+   E      E AR+K QDI  GLKRHHQLLRRQHFMD
Sbjct  63   VTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  119

Query  125  R  125
            R
Sbjct  120  R  120

>PYIR_13454
Length=129

 Score = 132 bits (332),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (78%), Gaps = 3/122 (2%)

Query  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64
            +LRP+YKKLL+LA++LPE KR  +L QIR EFR+ ++++DPKE++AL+ RAQSS+GYLKI
Sbjct  11   DLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70

Query  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124
            VTPR  S+ G++ YIY+NGQRV A  V    E+ A+Y   D    ++RH +LLRRQHFMD
Sbjct  71   VTPRKSSDAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMD  127

Query  125  RK  126
            RK
Sbjct  128  RK  129

>CCI44820
Length=123

 Score = 127 bits (318),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query  2    AARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGY  61
            A  E R ++KK+++LA+SLP  K+  +L  IR EFR H ++ DP +++ L++RAQS++GY
Sbjct  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62

Query  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121
            LKIVTP   S+ G++ ++Y++G+R+   E      E A++K QD+E GLKRH+QL+RRQ+
Sbjct  63   LKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQY  119

Query  122  FMDR  125
            FMDR
Sbjct  120  FMDR  123

>SDRG_01782
Length=123

 Score = 116 bits (291),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 88/123 (72%), Gaps = 6/123 (5%)

Query  6    LRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIV  65
            +R  YKKLL+LA+S+P+ +R Q+L+++R EFR+HE    P+E+  L+++AQS + YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  66   TPR--AESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFM  123
            TP+  + S +G   ++Y+NGQR++  E+ A   ++A  KT D    + +H QL+RRQHFM
Sbjct  65   TPKKSSSSTQG-SHFVYKNGQRIDGRELSA---DSATIKTHDYNAMMTKHVQLVRRQHFM  120

Query  124  DRK  126
            DRK
Sbjct  121  DRK  123

>H257_06293
Length=123

 Score = 114 bits (284),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 85/123 (69%), Gaps = 2/123 (2%)

Query  4    RELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLK  63
            + +R  YKKL++LAQSLP  ++  +LD+IR +FRS   ++  +E+  L+ +AQS + YLK
Sbjct  3    KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLK  62

Query  64   IVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFM  123
            IVTP+     G QR+IY++G+R+++  ++  G  N   KT D+   ++RH +L+RRQHFM
Sbjct  63   IVTPKRTPQSGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFM  120

Query  124  DRK  126
            DRK
Sbjct  121  DRK  123

>SPRG_06335
Length=123

 Score = 113 bits (282),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 85/122 (70%), Gaps = 4/122 (3%)

Query  6    LRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIV  65
            +R  YKKLL+LA+S+P+ +R Q+L+++R EFR+H     P+E+  L+++AQS + YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  66   TPRAESNKGI-QRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124
            TP+   + G    ++Y+NGQR++  E+ A   ++A  KT D    + +H QL+RRQHFMD
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMD  121

Query  125  RK  126
            RK
Sbjct  122  RK  123

>H310_09224
Length=123

 Score = 112 bits (281),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 82/123 (67%), Gaps = 2/123 (2%)

Query  4    RELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLK  63
            + +R  YKKL++LAQSLP  ++  +LD++R EFRSH  +T   ++  ++ +AQS + YLK
Sbjct  3    KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLK  62

Query  64   IVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFM  123
            IVTP+       QRYIY++G+R++   ++     NA  KT D    ++RH +L+RRQHFM
Sbjct  63   IVTPKRAPQTSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFM  120

Query  124  DRK  126
            DRK
Sbjct  121  DRK  123

>PYU1_G005963
Length=103

 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (60%), Gaps = 0/57 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59
           A+E+  +Y+++L+LA   P  KR   +  I+ EFR ++ LTD   + A +Q A+  +
Sbjct  4   AKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

>HYAP_08499
Length=108

 Score = 40.0 bits (92),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (60%), Gaps = 0/62 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYL  62
           A E+  +Y+++L+LAQ  P  KRQ  +  I+ EFR++  L+D ++V   +   Q+ +  L
Sbjct  4   ANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKEL  63

Query  63  KI  64
            +
Sbjct  64  SM  65

>HYAP_08500
Length=172

 Score = 40.0 bits (92),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (60%), Gaps = 0/62 (0%)

Query  3    ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYL  62
            A E+  +Y+++L+LAQ  P  KRQ  +  I+ EFR++  L+D ++V   +   Q+ +  L
Sbjct  68   ANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKEL  127

Query  63   KI  64
             +
Sbjct  128  SM  129

>PHYKE_5841
Length=121

 Score = 38.5 bits (88),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 30/46 (65%), Gaps = 0/46 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
            +E+  +Y+++L+LAQ  P  KR   +  I+ EF +H+ LTD +++
Sbjct  4   VKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKI  49

>SPRG_12883
Length=105

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query  1   MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVS---ALIQRAQS  57
           MA R +  +Y+++L+LAQ  P  K+ Q +  I+ EF  +  LTD  ++    A+  +   
Sbjct  1   MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIE  60

Query  58  SLGYLKIVTPRAES  71
            LG    + P A S
Sbjct  61  QLGQYVHLDPTAHS  74

>SDRG_14912
Length=105

 Score = 38.1 bits (87),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query  1   MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVS---ALIQRAQS  57
           MA R +  +Y+++L+LAQ  P  K+ Q +  I+ EF  +  LTD  ++    A+  +   
Sbjct  1   MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIE  60

Query  58  SLGYLKIVTPRAES  71
            LG    + P A S
Sbjct  61  QLGQYVHLDPTAHS  74

>PITG_13739
Length=105

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 32/46 (70%), Gaps = 0/46 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
            RE+  +Y+++L+LAQ  P  KR+  +  I+ EF ++++LTD +++
Sbjct  4   TREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKI  49

>PYAP_22846
Length=104

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (47%), Gaps = 3/92 (3%)

Query  9   LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPR  68
           LY+ +L+LA+  P  KR   +  I+ EF   +  TD + +   I  AQ+ +  L +    
Sbjct  10  LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSMY---  66

Query  69  AESNKGIQRYIYRNGQRVNADEVEAHGEENAR  100
           A  N     +    G+ V+ +  +A G+ N +
Sbjct  67  ATLNPSSTAWTVGVGREVSPEATQAAGDTNTK  98

>H310_07567
Length=98

 Score = 37.4 bits (85),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query  1   MAARELRP-LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
           M+A    P +Y+++L+LA+  P  KR Q ++ I+ EF  ++ LTDP ++
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKI  49

>PYIW_14743
Length=105

 Score = 37.4 bits (85),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 34/57 (60%), Gaps = 0/57 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59
           A+E+  LY+++L+LA   P  KR   + +I+ EF  ++ LTD  ++   +Q A+  +
Sbjct  4   AKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

>PYIR_15186
Length=109

 Score = 37.4 bits (85),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 35/57 (61%), Gaps = 0/57 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59
           A+E+  +Y+++L+LA   P  KR   + +I+ EF +++ LTD  ++   +Q A+  +
Sbjct  4   AKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

>PPTG_09252
Length=105

 Score = 37.4 bits (85),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 31/46 (67%), Gaps = 0/46 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
            +E+  LY+++L+LAQ  P  KR+  +  I+ EF +++ LTD +++
Sbjct  4   TKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKI  49

>PHYSO_315017
Length=109

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 32/46 (70%), Gaps = 0/46 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
            +E+  +Y+++L+LAQ  P  KR+  +  I+ EF ++++LTD +++
Sbjct  4   TKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKI  49

>CCA17521
Length=104

 Score = 36.2 bits (82),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  9   LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYL  62
           LY+++LRLA+  P  KR   ++ IR EFR   ++T    +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PHALS_11564
Length=107

 Score = 36.2 bits (82),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  9   LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64
           +Y++LL+LAQ  P  KR+  +  I+ EF ++  +TD +++   +  A + +  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>PYAR_23207
Length=112

 Score = 36.2 bits (82),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (57%), Gaps = 0/60 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYL  62
           +RE+  LY+++L+LA+  P  KR   ++ I+ EF   + LTD   +   I  AQ+ +  L
Sbjct  7   SREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PYVX_20854
Length=104

 Score = 35.8 bits (81),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (2%)

Query  1   MAAR-ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSL  59
           MA R E+  LY+++L+LAQ  P  KR   +  I+ EF  ++ L+D ++V   I  A++ +
Sbjct  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

>CCI44232
Length=105

 Score = 35.0 bits (79),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 0/54 (0%)

Query  9   LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYL  62
           LY+++LRLA+  P  KR   ++ IR EFR    +  P  +   I  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>H257_07358
Length=98

 Score = 35.0 bits (79),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (62%), Gaps = 0/47 (0%)

Query  9   LYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRA  55
           +Y+++L+LA   P  K++Q +  I+ EF  ++ LTDP ++   I  A
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIA  56

>PHYRA_81675
Length=106

 Score = 35.0 bits (79),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 30/46 (65%), Gaps = 0/46 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
            +E+  +Y+++L+LAQ  P  KR   +  I+ EF +++ LTD +++
Sbjct  4   TKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKI  49

>PHYRA_75193
Length=104

 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSLP-EPKRQQSL-DQIRREFRSHEELTDPKEVSALIQRAQSSL-GYLKIV  65
           LY+  +RLAQ +    K+ Q++ D +RREF    + TDP++V AL   A   L  YL + 
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANAIRGLSNYLMLA  73

Query  66  T  66
            
Sbjct  74  N  74

>PHYCA_535380
Length=108

 Score = 33.5 bits (75),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 29/46 (63%), Gaps = 0/46 (0%)

Query  3   ARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEV  48
            +E+  +Y+++L+LA   P  KR+  +  I+ EF +++ LTD + +
Sbjct  4   TKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRI  49

>CCI48720
Length=114

 Score = 33.1 bits (74),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (48%), Gaps = 0/84 (0%)

Query  10   YKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPRA  69
            Y++  R+   LP   R     QIR EF +   + + +++  L++  +  L Y+  +   A
Sbjct  21   YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQLKYVSSLVDTA  80

Query  70   ESNKGIQRYIYRNGQRVNADEVEA  93
             S +  +R + RN +  N   V+A
Sbjct  81   VSKQHQKRKVNRNPEHTNGQGVDA  104

>CCA24056
Length=4270

 Score = 33.9 bits (76),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (7%)

Query  58    SLGYLKIVTPRAESNKGIQRYI----YRNGQRVNADEVEAHGEENARYKTQDIEGGLKRH  113
             S+  L +V P+ ES   +   +    YR G R++A +V    ++N R K+ D E     H
Sbjct  2039  SMEQLSMVVPKQESKDSVDEILGPVRYREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFH  2098

Query  114   H  114
             H
Sbjct  2099  H  2099

>PYIW_14293
Length=104

 Score = 32.0 bits (71),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  9   LYKKLLRLAQSLPEPKRQQSL--DQIRREFRSHEELTDPKEVSAL  51
           LY+  +RLA+ +    ++ S   D IRREF    + TDP+++ AL
Sbjct  13  LYRDCMRLAKHIGGTSKKGSAIKDLIRREFEKARDETDPEKIEAL  57

>PHALS_00343
Length=92

 Score = 31.6 bits (70),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 0/53 (0%)

Query  20  LPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPRAESN  72
           L +  RQ+SL    + F  H  +   KE+   +   Q ++G+L   TPR   N
Sbjct  37  LKDAGRQESLMSNNKGFGCHLYVQGTKEICTELTLVQCNVGFLATPTPRMRIN  89

>PYAR_16000
Length=488

 Score = 32.7 bits (73),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 0/50 (0%)

Query  6    LRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRA  55
            L PL +  L    +LP   +Q SLD I + FR    ++ P +  A + RA
Sbjct  179  LPPLKRACLSPTTTLPPLAQQLSLDDIGKPFRYQRSMSCPSDAMARVARA  228

>PHYCA_540461
Length=104

 Score = 31.2 bits (69),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSLP-EPKRQQSL-DQIRREFRSHEELTDPKEVSALIQRAQSSL-GYLKIV  65
           LY+  LRLA+ +    K+ Q++ D +RREF      TDP+++ AL   A   L  YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  66  T  66
            
Sbjct  74  N  74

>SPRG_11731
Length=431

 Score = 32.3 bits (72),  Expect = 0.77, Method: Composition-based stats.
 Identities = 26/79 (33%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query  2    AARELRPLYKKLLRLAQSLPE--PKRQQSLDQIRRE--FRSHEELTDPKEVSALIQRAQS  57
            A +  RPL K  L L   L +  PK++ + +Q  +   FRSH  L DP  VS  I    S
Sbjct  296  AEKRKRPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPHLQDPATVSTWIPTITS  355

Query  58   SLGYLKIVTPRAESNKGIQ  76
            +  + ++ T +A+   G Q
Sbjct  356  ASCH-EMATRKAKKESGAQ  373

>H310_00823
Length=1034

 Score = 32.0 bits (71),  Expect = 0.93, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 24/35 (69%), Gaps = 0/35 (0%)

Query  26   QQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60
            Q+S D IR++     E ++  ++ AL+Q+AQSSLG
Sbjct  263  QESADYIRKQLYKAVEHSNLDDLDALLQQAQSSLG  297

>PHYRA_77329
Length=1276

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 35/91 (38%), Gaps = 2/91 (2%)

Query  46    KEVSALIQRAQSSL--GYLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKT  103
             KE   L      SL    L IV+  A S++     I R G      E+  H E   R KT
Sbjct  1025  KECGMLESSCSPSLIIDTLLIVSQLARSSQTNYECILRAGLLSEFYELVQHPEAMVRAKT  1084

Query  104   QDIEGGLKRHHQLLRRQHFMDRKSGPPRPIF  134
              +  G L RH     +   M  +SG P  I 
Sbjct  1085  LNCLGNLCRHSTTFYQHFTMPLESGKPDTIL  1115

>PYIR_22147
Length=1173

 Score = 31.6 bits (70),  Expect = 1.5, Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 40/89 (45%), Gaps = 4/89 (4%)

Query  42   LTDPKEVSALIQRAQSSLGYLKIVTPRAESNKGIQRYIYRNG-QRVNADEVEAHGEENAR  100
            L D +    L QRA+S +  L++ T  + + KG      RN   + +  +  A   +NA+
Sbjct  568  LADTRAEKVLAQRAKSQVNILEVYTSYSSTMKGHPSGCLRNSFLKSHVRDCPACAGQNAQ  627

Query  101  YKTQDIEGGLKRHHQLLRRQHFMDRKSGP  129
                 +  G+  H  +L RQ     KSGP
Sbjct  628  EGQCGLHSGMSFHKPVLERQF---SKSGP  653

>PYVX_15150
Length=746

 Score = 31.2 bits (69),  Expect = 2.1, Method: Composition-based stats.
 Identities = 18/67 (27%), Positives = 34/67 (51%), Gaps = 4/67 (6%)

Query  16   LAQSLPEPKR--QQSLDQIRREFRSHEELTDPKEVSALIQ--RAQSSLGYLKIVTPRAES  71
            LA+ L  P     Q++      FRS  + ++   V  +++  R+  SL YL +V PR + 
Sbjct  592  LAKELARPSSLVAQNVLCWSYSFRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQH  651

Query  72   NKGIQRY  78
            +  ++R+
Sbjct  652  DASLERF  658

>SPRG_21627
Length=254

 Score = 30.8 bits (68),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 1/33 (3%)

Query  18  QSLPEPKRQQSL-DQIRREFRSHEELTDPKEVS  49
           Q+L EP R   L D +R  FR++  LTDPK ++
Sbjct  68  QALLEPHRGADLRDVVRATFRANATLTDPKTIA  100

>PPTG_19852
Length=521

 Score = 30.8 bits (68),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 34/63 (54%), Gaps = 9/63 (14%)

Query  72   NKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGPPR  131
            ++ +Q+ I    Q ++A+   AH     R  TQ I G ++RHHQ+LR+ H   R     R
Sbjct  2    DEDVQQRITYLLQEIDANICAAH-----RSATQ-ICGTVRRHHQILRQIHEASRVW---R  52

Query  132  PIF  134
            P+F
Sbjct  53   PLF  55

>PPTG_15655
Length=112

 Score = 29.6 bits (65),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSLP-EPKRQQSLDQ-IRREFRSHEELTDPKEVSALIQRAQSSL-GYLKIV  65
           LY+  LRLA+ +    K+ Q++ + +RREF      TDP+++ AL   A   L  YL + 
Sbjct  22  LYRDCLRLAKHIGGNSKKGQAIKELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  81

Query  66  T  66
            
Sbjct  82  N  82

>PYVX_18358
Length=62

 Score = 28.5 bits (62),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query  9   LYKKLLRLAQSLP-EPKRQQSL-DQIRREFRSHEELTDPKEVSAL  51
           LY+  LRLA+ +  + K+ +++ + +RREF      TDP+++ AL
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEAL  45

>PHYSO_514323
Length=104

 Score = 29.3 bits (64),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSLP-EPKRQQSLDQ-IRREFRSHEELTDPKEVSALIQRAQSSL-GYLKIV  65
           LY+  +RLA+ +    K+ Q++ + +RREF      TDP+++ AL   A   L  YL + 
Sbjct  14  LYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  66  T  66
            
Sbjct  74  N  74

>PYAR_21749
Length=92

 Score = 28.9 bits (63),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  9   LYKKLLRLAQSLP-EPKRQQSL-DQIRREFRSHEELTDPKEVSAL  51
           LY+  +RLA+ +    K+ Q++ D IRREF      TDP+++  L
Sbjct  14  LYRDCMRLAKHIGGTSKKGQAIRDLIRREFDKGRSETDPEKIEML  58

>PYAP_24867
Length=147

 Score = 29.3 bits (64),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  10  YKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPRA  69
           Y + LR+ Q L E  R+    QIR  F  +  + D K+V   I++ +  L ++  +   A
Sbjct  26  YHEFLRITQPLAEDTRRDVRQQIRAAFDMYRHVEDEKQVMQFIRQGREQLKHVSDLVDSA  85

>PITG_17701
Length=104

 Score = 28.9 bits (63),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  9   LYKKLLRLAQSLP-EPKRQQSL-DQIRREFRSHEELTDPKEVSALIQRAQSSL-GYLKIV  65
           LY+  LRLA+ +    K+ Q++ + +RREF      TDP+++ AL   A   L  YL + 
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIRELVRREFDKGRSETDPEKIEALKANAVRGLSNYLMLA  73

Query  66  T  66
            
Sbjct  74  N  74

>CCI49632
Length=1951

 Score = 29.6 bits (65),  Expect = 6.0, Method: Composition-based stats.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query  82    NGQRVNADEVEAH-GEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGP  129
             NG++ NA+E+ AH    NA ++ Q   G    H  LL+ +H + R S P
Sbjct  1366  NGKQFNANEMAAHSARHNAPFQLQ---GNNTIHGVLLQIEHLLARMSTP  1411

>PYIW_20453
Length=1315

 Score = 29.6 bits (65),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 29/59 (49%), Gaps = 8/59 (14%)

Query  60    GYLKIVTPRAESNKGIQRYIYRNGQRVNAD-------EVEAHGEENARYKTQDIEGGLK  111
             G  K++  RA+SNK  Q  +  NGQ  N D       +V   GE ++ Y  Q + GG K
Sbjct  1050  GEGKMLILRADSNKADQPEVVTNGQEANVDTFSGVQIKVSFRGEGDS-YLMQQLSGGQK  1107

>PHYRA_77328
Length=479

 Score = 29.3 bits (64),  Expect = 7.6, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 30/73 (41%), Gaps = 0/73 (0%)

Query  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121
            L IV+  A S++     I R G      E+  H E   R KT +  G L RH     +  
Sbjct  246  LLIVSQLARSSQTNYECILRAGLLSEFYELVQHPEAMVRAKTLNCLGNLCRHSTTFYQHF  305

Query  122  FMDRKSGPPRPIF  134
             M  +SG P  I 
Sbjct  306  TMPLESGKPDTIL  318

>PYVX_20282
Length=356

 Score = 29.3 bits (64),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (53%), Gaps = 9/51 (18%)

Query  81   RNGQRVNADEVEAHGEENARYKTQDIEGGLKRH-HQLLRRQHFMDRKSGPP  130
            R+GQR+N DE+  HGE+  R        GL  H H  + ++ F   ++ PP
Sbjct  34   RSGQRINKDEIRDHGEQVLR--------GLIDHVHTRMLQEFFFLEQAIPP  76

>PHYSO_321189
Length=337

 Score = 29.3 bits (64),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 11/45 (24%), Positives = 26/45 (58%), Gaps = 0/45 (0%)

Query  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQD  105
            Y  I+     ++  +++++YR+G   N  E++  GEE+  ++ +D
Sbjct  49   YETIIQHAGAADPAMKQFVYRSGLIQNFPEIDTSGEEDKAFENKD  93

>SDRG_06868
Length=548

 Score = 29.3 bits (64),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 37/74 (50%), Gaps = 5/74 (7%)

Query  7    RPLYKKLLRLAQSL--PEPKRQQSLDQIRRE--FRSHEELTDPKEVSALIQRAQSSLGYL  62
            RPL K  L L   L   +PK++ + +Q  +   FRSH  L DP  VS  I    S+  + 
Sbjct  299  RPLPKGFLELLDKLLQIDPKKRFNAEQALQSEYFRSHPYLQDPATVSTWIPTITSASCH-  357

Query  63   KIVTPRAESNKGIQ  76
            ++ T +A+   G Q
Sbjct  358  EMATRKAKKESGAQ  371

>PHYRA_77327
Length=827

 Score = 29.3 bits (64),  Expect = 8.6, Method: Composition-based stats.
 Identities = 23/73 (32%), Positives = 30/73 (41%), Gaps = 0/73 (0%)

Query  62   LKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQH  121
            L IV+  A S++     I R G      E+  H E   R KT +  G L RH     +  
Sbjct  594  LLIVSQLARSSQTNYECILRAGLLSEFYELVQHPEAMVRAKTLNCLGNLCRHSTTFYQHF  653

Query  122  FMDRKSGPPRPIF  134
             M  +SG P  I 
Sbjct  654  TMPLESGKPDTIL  666

>PHYSO_397432
Length=490

 Score = 29.3 bits (64),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (52%), Gaps = 2/58 (3%)

Query  14  LRLAQSLPEPKRQQS--LDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPRA  69
           L LA+S+ E K  Q+  L Q    + + E+  DP +  A I+R  +  G  KIV P+ 
Sbjct  4   LALAKSVVETKMVQTTALPQGAVFYPTLEQFADPIKYIASIEREAAKTGICKIVPPQG  61

Lambda      K        H        a         alpha
   0.322    0.137    0.393    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3398400027

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40