Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_95901147571075107552880.0
PPTG_17128147571177117942980.0
PITG_18457147571170117442400.0
PHALS_06477147571166116135650.0
PHYSO_32115714757118082734030.0
PHYCA_344751475769271728200.0
PYIW_1879314757997101524220.0
PYAP_17746147571169114923500.0
PYU1_G0017341475780081722780.0
PYIR_1345314757118698722550.0
SDRG_01764147571092112019290.0
H257_06305147571099112317960.0
H310_09212147571113116317760.0
SPRG_063541475788488416640.0
CCI45122147571105112114940.0
CCA18898147571147115814720.0
PHYKE_8394147574282228868e-108
PYAR_13581147577303917788e-89
H310_112724789179940880.29
PPTG_1622114050125943821.3
PHYCA_51068649593241821.5
PHYSO_360938495120041811.8
PHYRA_8453414050136843811.9
CCI491231646542039792.5
PHYCA_539991405094743792.8
PHYRA_96309343297445792.9
PHYSO_51769810613191141802.9
SDRG_01714139881233124793.4
PYU1_G0107961453866168793.4
HYAP_0862314050118743784.3
PHALS_01137495133241775.1
PHYSO_3074523432121445775.8
CCA253811513681939775.8
PHYCA_1309541624449387766.1
PPTG_08220495133541776.2
HYAP_00989495133049767.1
HYAP_1285012378697849767.6
CCI419087773154131768.7
PYVX_2429081040549149759.3
PHYSO_285743473469237689.4
PPTG_132145362223773759.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_95901

Length=1076
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_95901                                                           2041       0.0   
PPTG_17128                                                            1660       0.0   
PITG_18457                                                            1637       0.0   
PHALS_06477                                                           1377       0.0   
PHYSO_321157                                                          1315       0.0   
PHYCA_34475                                                           1090       0.0   
PYIW_18793                                                            937        0.0   
PYAP_17746                                                            909        0.0   
PYU1_G001734                                                          882        0.0   
PYIR_13453                                                            873        0.0   
SDRG_01764                                                            747        0.0   
H257_06305                                                            696        0.0   
H310_09212                                                            688        0.0   
SPRG_06354                                                            645        0.0   
CCI45122                                                              580        0.0   
CCA18898                                                              571        0.0   
PHYKE_8394                                                            345        8e-108
PYAR_13581                                                            304        8e-89 
H310_11272                                                            38.5       0.29  
PPTG_16221                                                            36.2       1.3   
PHYCA_510686                                                          36.2       1.5   
PHYSO_360938                                                          35.8       1.8   
PHYRA_84534                                                           35.8       1.9   
CCI49123                                                              35.0       2.5   
PHYCA_53999                                                           35.0       2.8   
PHYRA_96309                                                           35.0       2.9   
PHYSO_517698                                                          35.4       2.9   
SDRG_01714                                                            35.0       3.4   
PYU1_G010796                                                          35.0       3.4   
HYAP_08623                                                            34.7       4.3   
PHALS_01137                                                           34.3       5.1   
PHYSO_307452                                                          34.3       5.8   
CCA25381                                                              34.3       5.8   
PHYCA_130954                                                          33.9       6.1   
PPTG_08220                                                            34.3       6.2   
HYAP_00989                                                            33.9       7.1   
HYAP_12850                                                            33.9       7.6   
CCI41908                                                              33.9       8.7   
PYVX_24290                                                            33.5       9.3   
PHYSO_285743                                                          30.8       9.4   
PPTG_13214                                                            33.5       9.8   

>PHYRA_95901
Length=1075

 Score = 2041 bits (5288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1075/1075 (100%), Positives = 1075/1075 (100%), Gaps = 0/1075 (0%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGYGDAS  120
             AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYGDAS
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYGDAS  120

Query  121   SIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLLPSVNKVDP  180
             SIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLLPSVNKVDP
Sbjct  121   SIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLLPSVNKVDP  180

Query  181   TAPTPELREEDAKHGVLNLVTRSSGTKDGSGVMKQRATRIYDRSEQPARATPFTQSTGYN  240
             TAPTPELREEDAKHGVLNLVTRSSGTKDGSGVMKQRATRIYDRSEQPARATPFTQSTGYN
Sbjct  181   TAPTPELREEDAKHGVLNLVTRSSGTKDGSGVMKQRATRIYDRSEQPARATPFTQSTGYN  240

Query  241   LAALKFDLRSTGTGKNDRSNDDMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVD  300
             LAALKFDLRSTGTGKNDRSNDDMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVD
Sbjct  241   LAALKFDLRSTGTGKNDRSNDDMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVD  300

Query  301   KIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYF  360
             KIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYF
Sbjct  301   KIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYF  360

Query  361   VPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATT  420
             VPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATT
Sbjct  361   VPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATT  420

Query  421   IQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQ  480
             IQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQ
Sbjct  421   IQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQ  480

Query  481   DLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVY  540
             DLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVY
Sbjct  481   DLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVY  540

Query  541   VSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRR  600
             VSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRR
Sbjct  541   VSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRR  600

Query  601   IRHYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNV  660
             IRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNV
Sbjct  601   IRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNV  660

Query  661   PTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRRE  720
             PTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRRE
Sbjct  661   PTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRRE  720

Query  721   KRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIE  780
             KRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIE
Sbjct  721   KRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIE  780

Query  781   AVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLNRKTVAFTFPQTAAPH  840
             AVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLNRKTVAFTFPQTAAPH
Sbjct  781   AVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLNRKTVAFTFPQTAAPH  840

Query  841   EAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACF  900
             EAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACF
Sbjct  841   EAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACF  900

Query  901   HLLARGAYRVAASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960
             HLLARGAYRVAASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP
Sbjct  901   HLLARGAYRVAASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960

Query  961   HVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRT  1020
             HVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRT
Sbjct  961   HVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRT  1020

Query  1021  ALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075
             ALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR
Sbjct  1021  ALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075

>PPTG_17128
Length=1177

 Score = 1660 bits (4298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 911/1179 (77%), Positives = 990/1179 (84%), Gaps = 106/1179 (9%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEKVQQQ HVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSA+VTTAEVQAFN
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGYG---  117
             AILQQTE ELR+KAELVL GMVNSS++AQ NQ+QSG  LP VTVAA PST+HRSGY    
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  118   -----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLL  172
                  DASSIP+EFFREQF NSSVE+RQSLMPSP+ WQRH G+ HGRL+RKKTTQHCRLL
Sbjct  121   KPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHCRLL  180

Query  173   PSVNKVDPTAPTPELREEDAKHGVLNLVTRS---------------SGTKDGS--GVMKQ  215
             PSVNKVDP+AP PELREEDAKHGVLNLVTR                +GT +GS  G+MKQ
Sbjct  181   PSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGIMKQ  240

Query  216   RATRIYDRSEQPARATPFTQSTGYNLAALKFDL---------------------------  248
             RATRIYDRSEQ  R+TPFTQSTGYNLA+LKFDL                           
Sbjct  241   RATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTRRRS  300

Query  249   ------------------RSTGTGKNDRS-----------------NDDMEGNREHI-DG  272
                               +S    KN RS                  +DM+ NR    D 
Sbjct  301   VRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRFSDD  360

Query  273   EISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFV  332
             ++SDEDQ   +N KDE+AEMEELGANVDKIRGYN+LLDAYSLHQFLIHKGR+MRDTPEF+
Sbjct  361   DVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFI  420

Query  333   SFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIV  392
             SFRRVAQELWGSVEEALRALE LLTQYFVPLAYVDGQRLL+LA TGQPRFSK ELL+CIV
Sbjct  421   SFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIV  480

Query  393   NEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWR  452
             NE+Q+MSVLRRPGQRYKGRDRKRRAATT+QAC+RMW +RRRY RSRASDI+AT+IQLAWR
Sbjct  481   NEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWR  540

Query  453   SYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSA  512
             +YSCH ALKTRLREVRRE+LE+WE RM  L++QW QIA RRRVVVHVPSLSLDEH RLSA
Sbjct  541   AYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSA  600

Query  513   ENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  572
             ENFAVQQNLQLTR+CA ALDS+VDLLVYVSPFELTADV QYFLKLLQLGGL DS PRVK 
Sbjct  601   ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  660

Query  573   VFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpi  632
             VFPEQ+ RFP HFSLSSLLLYSPHCLRRIRHYT GKEAYLVMGLPGAEDQRLA+ALDLPI
Sbjct  661   VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPI  720

Query  633   lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLL  692
             LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYDEHEL AALAKLA+AHM+QPKWL+
Sbjct  721   LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  780

Query  693   KLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLAR  752
             KLDYDPLG+GEAVVDLS +QAMRELRREKRTPEYWRQPGPRDAAAK++LAELERPG+LAR
Sbjct  781   KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLAR  840

Query  753   LATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPD  812
             LA PMH+E+FP WRD+ +A+GHFGCVIEAVPP  IAA+PE+S+ LVEPAYVRANLFV PD
Sbjct  841   LAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPD  900

Query  813   G-------KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSL  865
             G       +NVLA+ GGGLNRKTVAFTFPQTAAPHEA++GAC+A GKLLVET+VWGYVSL
Sbjct  901   GSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSL  960

Query  866   DFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLAR-------GAYRVAASNSMVN  918
             DFVVFQDEK+ G+PRLWALAVHPFLTDSAASFACFHLLAR       GAYRV AS S+  
Sbjct  961   DFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRV-ASKSLTT  1019

Query  919   ANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHG  978
                GR+GSG   DLLLREASL K +LAGAPRCFVVCSYVFHPHVTTMQY+AFFHACRLHG
Sbjct  1020  VT-GRNGSGCTTDLLLREASLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHG  1078

Query  979   VCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMAT-  1037
             VCFDVERTLGTLFLLADSLTAGVFG+LS+GET EGALAFLRTALEVIGRE G+TI M + 
Sbjct  1079  VCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSS  1138

Query  1038  -SRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075
              SRPVS R+GNFAQVLSAVRASTGGGK DRLGKM+R RR
Sbjct  1139  PSRPVSGRSGNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177

>PITG_18457
Length=1170

 Score = 1637 bits (4240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 888/1174 (76%), Positives = 978/1174 (83%), Gaps = 103/1174 (9%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             M+KVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRH+A+VTTAEVQAFN
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGYG---  117
             AILQQTE ELRAKAELVL GMVNSSSSA+ NQ+QSGTLLP VTVAA PS  HRSGY    
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  118   -----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLL  172
                  DASSIP+EFFREQF N+SVE+RQSL   P+ W+RH GI HGRL+RKKTTQHCRLL
Sbjct  121   KPRQMDASSIPVEFFREQFRNNSVEIRQSL---PEPWERHFGIHHGRLMRKKTTQHCRLL  177

Query  173   PSVNKVDPTAPTPELREEDAKHGVLNLVTR--------------SSGTKDGSGVMKQRAT  218
             PSVNK DP+ PTPELREEDAKHGVLNLVTR               +    G GVMKQRAT
Sbjct  178   PSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQRAT  237

Query  219   RIYDRSEQPARATPFTQSTGYNLAALKFDLR-----------------------------  249
             RIY+RSEQ  R+TPFTQSTGYNLA+LKFDLR                             
Sbjct  238   RIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRSTRRSSA  297

Query  250   -------------STGTGKNDRS-----------------NDDMEGNREHI-DGEISDED  278
                          S+   KN RS                  +D E NR+   D +ISDE+
Sbjct  298   LQGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAVAAFTNQGEDTENNRDRFSDDDISDEE  357

Query  279   QGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVA  338
             Q   +NDKDE AEME+LGANVDKIRGYN+LLD YSLHQFLIHKGR+MRDTPEFVSFRRV 
Sbjct  358   QESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVT  417

Query  339   QELWGSVeealraletlltQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVM  398
             QELWGSVEEALRALETLL QYFVPLAYVDGQRLL+LA TGQPRFSK ELL+CIVNE+QVM
Sbjct  418   QELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVM  477

Query  399   SVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHA  458
             SVLRRPGQRYKGRDRKRRAATTI+ACVRMW +RRRY R+RASD +A++IQLAWR+YSCH 
Sbjct  478   SVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHT  537

Query  459   ALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQ  518
             +LK RLREV  E+LE+WE RM +L++ WPQIAGRRRVVVHVPSLSLDEHSRL AENFA+Q
Sbjct  538   SLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQ  597

Query  519   QNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQA  578
             QNLQLTR+CAAALDS+V+LL+YVSPFELT+DVSQYFLKLLQLGGL DSRPRVKLVFPEQ 
Sbjct  598   QNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQT  657

Query  579   ARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappa  638
              RFP HFSLSSLLLYSPHCLRRIRHYT GKEAYLVMGLPGAEDQRLA+ALDLPILGAPPA
Sbjct  658   TRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPA  717

Query  639   qalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDP  698
             QALPLLTRSGGKRLLIRADVNVP GTYELYDEHE+ AALAKLA+AHM+QP+WL+KLDYDP
Sbjct  718   QALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDP  777

Query  699   LGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMH  758
             L +GEAVVDLS MQAMRELRREKRTPEYWRQPGPRDAAAKL+LAELERPG+LAR+ATPM 
Sbjct  778   LDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQ  837

Query  759   TEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDG-----  813
             TEIFP WR+F +A+GHFGCV+EAVPP  IAA+ E+S++LVEPAYVRANLFV PDG     
Sbjct  838   TEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHIS  897

Query  814   --KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQ  871
               +NVLA+ GGGLNRKTVAFTFPQTAAP+EA++GAC+A GKLLVET+VWGYVSLDFVVFQ
Sbjct  898   STQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQ  957

Query  872   DEKNGGSPRLWALAVHPFLTDSAASFACFHLLAR-------GAYRVAASNSMVNANPGR-  923
             DEK+  +PRLWALAVHPFLTDSA SFACFHLLAR       G YRV A+ S+  AN GR 
Sbjct  958   DEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRV-ANKSLTTANSGRK  1016

Query  924   SGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDV  983
             S SG A DLLLREA L K++L GA RCFV CSYVFHPHV TMQY+AFFHACRLHGVCFDV
Sbjct  1017  SESGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDV  1076

Query  984   ERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMAT--SRPV  1041
             ERTLGTLFLLADSLTAGVFGILS+GETTEGALAFLRTALEVIGRE G+TI +A+  SR V
Sbjct  1077  ERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSPSRSV  1136

Query  1042  STRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075
             ++R+GNFAQ+LSA+R STGGGK DRLGKMR+ +R
Sbjct  1137  ASRSGNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170

>PHALS_06477
Length=1166

 Score = 1377 bits (3565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/1161 (65%), Positives = 878/1161 (76%), Gaps = 101/1161 (9%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEKVQQ +HVEDVGRLLL+TQEQLR MREQMTAAAA++EAN SP RHS+V+T AEVQAF+
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSG-----  115
             A+LQQTE ELRAKAELVL G++NSS+S   +Q Q  T LP V+VAAP   +HR G     
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  135

Query  116   -YG-----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHC  169
              +G     D +S  +EFFR+QF N+ VE+RQSLM SP++W+R  G    R +RKKTTQH 
Sbjct  136   EFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSG---ARRVRKKTTQHY  192

Query  170   RLLPSVNKVDPTAPTPELREEDAKHGVLNLVTRS---------------SGTKDGSG--V  212
             RLLP VNK DP+ PTP+LREEDA  G+LNLVTR                +G  +GSG   
Sbjct  193   RLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCA  252

Query  213   MKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGT-------------------  253
             +K RAT IYDRS++ AR TP   S G+NLA LKFD R++ T                   
Sbjct  253   LKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSASMPN  312

Query  254   ------------GKNDRS----------NDDMEGNREHIDGEISDEDQGGADND--KDEE  289
                         G   R+          N+D+E N  H   E  ++++G  D+D  KDE 
Sbjct  313   TKFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTH-SFEDQEDEEGSDDSDIIKDEG  371

Query  290   AEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeeal  349
                ++L  NV KIR YNDL+DAYSLHQ LI+KGR++RDTPEF SFRRV  +LWGSVEE L
Sbjct  372   FSTKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVL  431

Query  350   raletlltQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYK  409
             RALE +L QYFVPLA+VDGQRL++LA+T QP+FS+ ELL+CIVN+EQVMSVLRRPGQRY 
Sbjct  432   RALEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYN  491

Query  410   GRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrr  469
             GRDRK RAATTIQAC RMW +  RYV+SR+S+I+A +IQ A+R+YS   ALK RLRE+R 
Sbjct  492   GRDRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRC  551

Query  470   eqlerweARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAA  529
             E+  +WEARM + ++QW QIA RRR+VVHVPS+SL EHSRL+AENFAVQQNLQLTRICAA
Sbjct  552   EKAAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAA  611

Query  530   ALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSS  589
             ALD  VDLLVYVSP+ELTADVSQYF KLLQL G ADSRPRVK V+PEQAARFP HFSLSS
Sbjct  612   ALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSS  671

Query  590   LLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGG  649
             L+LYSP+CLRRIRHYTAG EAYLVMGLPG EDQRLA+ LDLPILGA P+QALPLLTRSGG
Sbjct  672   LILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGG  731

Query  650   KRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLS  709
             KRLLI+AD+NVPTGTYELYDEHE+  ALAKLAVAH++Q KWL+KLDYDPLG+GEAVVDLS
Sbjct  732   KRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLS  791

Query  710   GMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFT  769
              MQAMREL REKRTPEYWRQPG RDAAA L L E ERPG LARL TP+HTE++P WR++ 
Sbjct  792   SMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYA  851

Query  770   EAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDG-------KNVLASSGG  822
              AIGHFGCVIEAVPP   AA+ E      EP Y+RAN+FV P+G       +NVL ++ G
Sbjct  852   AAIGHFGCVIEAVPPTASAASME------EPTYLRANIFVDPNGTVHMTSTQNVLTTTRG  905

Query  823   GLNRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLW  882
             GL+RK+  F FPQT APH A++GAC+A GK L ET+VWGYVSLDFVVFQD K+  + RLW
Sbjct  906   GLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLW  965

Query  883   ALAVHPFLTDSAASFACFHLLARGA-------YRVAASNSMVNANPG-RSGSGGAADLLL  934
             ALA+HPFLT+SAA+FACFHLL RG        YRV  +  +  A    +SG+  A DLLL
Sbjct  966   ALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAMDLLL  1025

Query  935   REASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLA  994
             REASLTKA   GA RC+VVCSYVFHP+VT  QY+ FF  CRLHGVCFDV R LGTLFLLA
Sbjct  1026  REASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLA  1085

Query  995   DSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGAT--IEMATSRPVSTRNGNFAQVL  1052
             DSLTAGVFGILS+GET + AL++LRTALEVIGRE GAT  I  ++SR V    GNFA VL
Sbjct  1086  DSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVL---GNFADVL  1142

Query  1053  SAVRASTGGGKGDRLGKMRRL  1073
             S VRASTGGG  +RLG++ R+
Sbjct  1143  STVRASTGGGSSNRLGQVHRM  1163

>PHYSO_321157
Length=1180

 Score = 1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/827 (86%), Positives = 760/827 (92%), Gaps = 22/827 (3%)

Query  260   NDDMEGNREHIDGE----ISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLH  315
             +DD+E NRE    +    ISDE+Q   +N+KDEEAEMEELGANVDKIRGYN+LLDAYSLH
Sbjct  345   SDDLEDNRERFSEQPDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLH  404

Query  316   QFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLA  375
             QFLIHKGR+MRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAY DGQRLLSLA
Sbjct  405   QFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLA  464

Query  376   ATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  435
             +TGQPRFSK ELL+CIVNEEQVM+VLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV
Sbjct  465   STGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  524

Query  436   RSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRV  495
             RSRASD SAT+IQLAWR++SCHAALK RLRE+RREQL+ WEA+M DL+TQW QIAGRRRV
Sbjct  525   RSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRV  584

Query  496   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFL  555
             VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDS+VDLLVYV+PFELTADVS YFL
Sbjct  585   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFL  644

Query  556   KLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMG  615
             KLLQLGGLADSRPRVKLVFPEQAARFP HFSLSS+LLYSPHCLRRIRHYTAGK+AYLVMG
Sbjct  645   KLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMG  704

Query  616   LPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFA  675
             LPG EDQRLA+ALDLPILGAPP QALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFA
Sbjct  705   LPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFA  764

Query  676   ALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDA  735
             ALAKLAVAHM+QP+WLLKLDYDPLG+GEAVVDLSGMQAMRELRREK+TPEYWRQPGPRDA
Sbjct  765   ALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDA  824

Query  736   AAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSS  795
             A+KLVLAELERPGVLARLATPMHTEIFP+WR++TEAI HFGCV+EAVPP    A+PE++S
Sbjct  825   ASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETAS  884

Query  796   LLVEPAYVRANLFVYPDG-------KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQGACD  848
               VEPAYVRANLF+ PDG       +NVLA SGGGLNRKTVAFTFPQT APHEAV+GAC 
Sbjct  885   SSVEPAYVRANLFIDPDGTVHITSTQNVLA-SGGGLNRKTVAFTFPQTVAPHEAVKGACT  943

Query  849   ATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLAR---  905
             A GKLLVET+VWGYVSLDFVVFQD+K+GG+PRLWALAVHPFLTDSAASFACFHLLAR   
Sbjct  944   AAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVL  1003

Query  906   ----GAYRVAASNSMVNA-NPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCSYVFHP  960
                 G YR+AA+NS + A N GRSG GG  DLLLREASL K A AG PRC+VVCSYVFHP
Sbjct  1004  DASSGGYRMAAANSTLAAVNSGRSGGGGTTDLLLREASLAKGAQAGTPRCYVVCSYVFHP  1063

Query  961   HVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRT  1020
             HVTTMQY+AFFHACRLHGVCFDVERTLGTLFLL DSLTAGVFG+LSVGETT+GALAF+RT
Sbjct  1064  HVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRT  1123

Query  1021  ALEVIGREVGATIEMAT--SRPVSTRNGNFAQVLSAVRASTGGGKGD  1065
             ALEVIGRE GAT+EMAT  SRP S R+GNFAQVLSAVRASTGGGKGD
Sbjct  1124  ALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRASTGGGKGD  1170

 Score = 394 bits (1011),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 229/274 (84%), Positives = 234/274 (85%), Gaps = 25/274 (9%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  61   AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGYG---  117
            AILQQTE ELRAKAELVL GMVNSSSSAQ NQSQSGTLLP VTVAAPPSTRHRSGY    
Sbjct  61   AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGYAKPR  120

Query  118  -----DASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQHCRLL  172
                 DASSIP+EFFREQF NSSVEVRQ+LMPSP H QRHLGI HGRL+RKKTTQHCRLL
Sbjct  121  VAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHCRLL  180

Query  173  PSVNKVDPTAPTPELREEDAKHGVLNLVTRS---------------SGTKDGS--GVMKQ  215
            PSVNKVDP+APTPELREEDAKHGVLNLVTR                SG  DGS  GVMKQ
Sbjct  181  PSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGVMKQ  240

Query  216  RATRIYDRSEQPARATPFTQSTGYNLAALKFDLR  249
            RATRI+DRSEQ  R TPFTQSTGYNLAALKFDLR
Sbjct  241  RATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLR  274

>PHYCA_34475
Length=692

 Score = 1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/717 (83%), Positives = 640/717 (89%), Gaps = 32/717 (4%)

Query  303   RGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVP  362
             RGYN+LLDAYSLHQFLIHKGR+MRDTPEF+SF RVAQELWGSVEEALRALETLLT YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  363   LAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQ  422
             LAYVDGQRLLSLAATGQPRFSK ELL+CIVNEEQVM+ LRRPGQRYKGRDRKRRAATTIQ
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  423   ACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDL  482
             A VRMW+ RRRY RSRA DI+ATRIQLAWR+YSCHAALK RLREVRREQLE+WEARM  L
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  483   RTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVS  542
             ++QW QIA  RRVVVHVPSLSLDE+SRLSAEN AV+QNLQLTRICAAALDS VDLLVYVS
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  543   PFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIR  602
             PFELT DVSQYF+KLLQLGGLADSRPRVKL+FPEQA RFP HFSLSSLLLYSPHCLRRIR
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  603   HYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPT  662
             HYTAGKEAYLVMGLPGAEDQRLA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  663   GTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR  722
             GTYELYDEHELF+ALAKLAVAHM+QPKWL KLDYDPLG+GEAVVDLSGMQAMRELRREKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  723   TPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAV  782
             TPEYWRQPGPRDAAAKLVL ELERPG LARLA P+H +IFP+W +F EAIGHFGCVIEAV
Sbjct  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  783   PPAGIAATPESSSLLVEPAYVRANLFVYPDGK-------NVLASSGGGLNRKTVAFTFPQ  835
             P   IA TPE+S+ L+EPAY+RANLFV PDG        N+LA+ GGGLNR+TVAFTFPQ
Sbjct  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  836   TAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAA  895
             TAAPHEAV+GAC A GKLLVET+VWGYVSLDFVVFQD+K+ G+PRLWALAVHPFLTDSAA
Sbjct  541   TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  896   SFACFHLLARGAYRVAASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFVVCS  955
             SFACFHLLARG         +++AN G                + + A A  PRCFVVCS
Sbjct  601   SFACFHLLARG---------VLDANSG----------------VYRMAAASTPRCFVVCS  635

Query  956   YVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTE  1012
             YVFHPHVTTMQY+AFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFG+LS+GETTE
Sbjct  636   YVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETTE  692

>PYIW_18793
Length=997

 Score = 937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/1015 (52%), Positives = 673/1015 (66%), Gaps = 127/1015 (13%)

Query  167   QHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR----------SSGTKDGSGVMKQR  216
             QH RLLPSVNK DP+APTPEL E+DAK+G+L+LV R          S+      G+++  
Sbjct  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQNH  62

Query  217   ATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDDMEGNREH---IDGE  273
              TRIYDR EQP RA P T  +G+N+A LKFDL +T   +    +D    ++     ++G 
Sbjct  63    KTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVNGS  122

Query  274   ISDED----------------QGGA--------------------------------DND  285
               D D                QG A                                + +
Sbjct  123   QLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPETN  182

Query  286   KDEEAEMEE----------LGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFR  335
              DE+   +E          L  NV+KIRGYN+LLD YSLHQF+IHKGR+MR+TPEFVSF+
Sbjct  183   VDEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFK  242

Query  336   RVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEE  395
             RVAQE+WGSV+E ++ALE LLT+YFVPLAYVDGQRL+++AA     +SK +LL+CIVNE+
Sbjct  243   RVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNED  302

Query  396   QVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYS  455
             QV S++RRPGQRYKG+DRKRRAA TIQ   RMW  +++Y R R    S   IQ  WR Y+
Sbjct  303   QVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYA  362

Query  456   CHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENF  515
              H  LK R++  R +Q  +WEA+MQ L+  W +I G RRVV+HVPS S+DE  RLSA+NF
Sbjct  363   SHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNF  422

Query  516   AVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFP  575
             +V+QNLQL+R+C   +DS+VD +VYVSPFELT DV QY +KLLQLGG+AD   RVKLVFP
Sbjct  423   SVKQNLQLSRLC-GLVDSNVD-IVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFP  480

Query  576   EQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpilga  635
             E A RFP HFSL++LLLYSPHCLRRI+ Y   KEAYLV G+PG ED+RLA+AL++PILG 
Sbjct  481   EHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGM  540

Query  636   ppaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLD  695
              P  ALPL+T+SGGKR  +RADVNVPTGTY++YDE EL  +LAKL V+H+EQ  W+LK+D
Sbjct  541   DPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKID  600

Query  696   YDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLAT  755
             YDP   G A++D+S M A+RE+RREKR+PEYWRQPG RD AA++++AELER   L  L T
Sbjct  601   YDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELER--TLGNLVT  658

Query  756   PMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKN  815
             P+H E++P+W+D+ +AI  FG V+EA P A +              +VRANLFV P G+ 
Sbjct  659   PLHPELYPSWQDYADAIVQFGVVVEAAPSAVV-------------GHVRANLFVEPSGEV  705

Query  816   VLASSGGGL---------------NRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVW  860
              ++S+   L                 K+V + FPQTAAP+EA++GA  A GKLL E +V+
Sbjct  706   HVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVF  765

Query  861   GYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMVNAN  920
             GY S+DF+VFQ++K+  + RLWA+A+ P+LTDSAA+F  FHLL RGA    +    + A 
Sbjct  766   GYASIDFLVFQEDKS-HTARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAA  824

Query  921   PGRSGS--------------GGAADLLLREAS---LTKAALAGAPRCFVVCSYVFHPHVT  963
                S S                AADL+L EA+   L      GA   +VV  Y+FHP+V+
Sbjct  825   TVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVS  884

Query  964   TMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALE  1023
             TMQYSAFFH CRLHGVCFDVER +G++FLLADSLTAGVFG++   +T  GAL FLRTALE
Sbjct  885   TMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALE  944

Query  1024  VIGREVGA---TIEMATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075
             V+GREVG    T E  +     T  GNFA VL+A+RA T GGK  +L K+RRLRR
Sbjct  945   VVGREVGTQALTDEFTSGGEAET--GNFADVLAAIRALT-GGKSAKLEKIRRLRR  996

>PYAP_17746
Length=1169

 Score = 909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/1149 (47%), Positives = 724/1149 (63%), Gaps = 131/1149 (11%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+  +         P   S + +        
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSN-------GPGNGSVIASNNAGAEIE  53

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGY----  116
              ILQ+ E ELR KAELVL  +V +  ++     + G L+P+ TV  PP  R R       
Sbjct  54    EILQRAEDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELH  113

Query  117   -GDASSIPIEFFREQFHNSSVEVRQSLM----------PSPQHWQRHLGIQHGRLLRKKT  165
              G +  + IE+FR++F  ++V+   S M          P+P H        HG++++ KT
Sbjct  114   DGGSYDLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTH-------AHGKVVKHKT  166

Query  166   TQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR----------------SSGTKDG  209
             T + RLLP VNK DPTAP P L   DAK GVL+L+ R                SS    G
Sbjct  167   TSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQG  226

Query  210   --SGVMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGT--------------  253
               + V++  + +++ R EQP RAT ++    +NLA LKFD+ +  T              
Sbjct  227   NPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDE  286

Query  254   ------------------GKNDRSNDDMEGNREHIDGEISDEDQGGA------DNDKDEE  289
                               GK++ S  +     EH DG   D +          D   DE 
Sbjct  287   SEALPLRAMKTVTISFHNGKSESSPRNNARESEH-DGRREDGNDTAPLEREDLDVTADEA  345

Query  290   AE-MEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeea  348
             A  ME+L  NV+KIRGYN+LLDAYSLHQF+IHKGR++RDTPEF SF+RVAQE+WGS+EE 
Sbjct  346   ANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEV  405

Query  349   lraletlltQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRY  408
             ++ALE LLT+YFVPLAY+DGQRL++LA+    + S  ELL C+VNE+QV S++RRPGQRY
Sbjct  406   IQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRY  465

Query  409   KGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevr  468
             KG+DRKRRAATT+QA  RM   R R+ + R +  SA  IQ  WRSY+C  +L+ RL  VR
Sbjct  466   KGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVR  525

Query  469   reqlerweARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICA  528
              E+L  W+A+++ +R+QW  I  +RRVV+HV S+S+DE +RLS ENF+V+QNLQL+R+ A
Sbjct  526   EERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-A  584

Query  529   AALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLS  588
               +D +V+ +VYV+PFEL+ +VSQYF+KLLQL G+A++  RV+LVFPE AA+FP HFSL+
Sbjct  585   GLVDQNVE-IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLA  643

Query  589   SLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpil-gappaqalpllTRS  647
             + L+YSP+C+RRI+    GKEAYLVMG+PG EDQRLAVAL +PIL    P   LPL+TRS
Sbjct  644   THLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRS  703

Query  648   GGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVD  707
             G KR  I+ADVNVPTGTY++YD  EL  +LAKL ++H+ Q  WLLKLD DPLG G A++D
Sbjct  704   GSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILD  763

Query  708   LSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRD  767
             +S M  +R++RREKR PEYW+QPG RD  A+ +L ELER   +  L  P H EIF +W++
Sbjct  764   VSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELERE--IGSLLKPSHPEIFASWKE  821

Query  768   FTEAIGHFGCVIEAVP--PAGIAATPESSSLLVEPAYVRANLFVYPDG-------KNVLA  818
             F  AI  FG V+EA+P   AG+               +R N+F+ P G        +VL+
Sbjct  822   FASAIPEFGVVVEALPFHVAGV---------------IRMNIFIEPSGDVHVMSTNDVLS  866

Query  819   SSGGGLN---RKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVW-GYVSLDFVVFQDEK  874
              +G  L+   R+  AF FPQT  PHEA+ GA  A G++L E   + GY S+D  + Q+E 
Sbjct  867   GNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEE-  925

Query  875   NGGSP----RLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGRSGSGGAA  930
             +  SP    RLWA+++ P+LTDSAA+FA FH L RG    A     + A   R  +   +
Sbjct  926   SLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTA---RESTPPES  982

Query  931   DLLLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTL  990
             D  L  + +      GAPR + V  YVFHP+V+ M Y+AFFH CRLHGVCFDVER +G++
Sbjct  983   DSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSV  1042

Query  991   FLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSRPVSTR---NGN  1047
             FLLADSLTAG+FG+LS GE+   AL +LRTA EVIGREVG    ++    + +    +GN
Sbjct  1043  FLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGN  1102

Query  1048  FAQVLSAVR  1056
             FA++L  +R
Sbjct  1103  FAEILGLLR  1111

>PYU1_G001734
Length=800

 Score = 882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/817 (57%), Positives = 603/817 (74%), Gaps = 52/817 (6%)

Query  292   MEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealra  351
             M++L  NV+KIRGYN+LLD YSLHQF+IHKG++MR+TPEFVSF+RVAQE+WG VEE ++A
Sbjct  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  352   letlltQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGR  411
             LETLLT+YFVPLAYVDGQRL+++A+     FSK +LL+CIVNE+QV S++RRPGQRYKG+
Sbjct  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  412   DRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrreq  471
             DRKRRAA TIQ   RMWS +++Y R R    S   IQ  WR+Y+ H  L+ +L+  R++Q
Sbjct  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  472   lerweARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAAL  531
              E+WEARMQ L+ +WP+I   RRV++HVPSLS+DE  R+ A+NFAV+QNLQL+R+C   +
Sbjct  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-I  239

Query  532   DSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLL  591
             D++VD+ VYVSPFELT++V QYF+KLLQLGG+AD   RVKLVFPEQA RFP HFSL+++L
Sbjct  240   DANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVL  298

Query  592   LYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGGKR  651
             LYSPHCLRRIR    GKEAYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR
Sbjct  299   LYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKR  358

Query  652   LLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGM  711
               +RADVNVPTGTY++YDE EL  +LAKL V+H+EQ  WLLK+DYDP G G A+VD S +
Sbjct  359   FFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVV  418

Query  712   QAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEA  771
              A+RE+RREK++PEYWRQPG RD AA++++AELER   + +L TP+H E++P W++F +A
Sbjct  419   TALREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADA  476

Query  772   IGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDG-------KNVLASSGGGL  824
             I  FG VIEA P A +              Y+RANLFV P G       ++V+ S+    
Sbjct  477   IAQFGVVIEAAPSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIH  523

Query  825   NRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWAL  884
              RK   + FPQT AP+EA++GA  A GK+LV+ SV+GY S+D++VF+++K    PRLWA+
Sbjct  524   KRKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT-HVPRLWAM  582

Query  885   AVHPFLTDSAASFACFHLLARGAYRV----------AASNS-----------MVNANPGR  923
             A+HP+LTDSA++FA FHLL RGA  +          AAS              +NA+  R
Sbjct  583   ALHPYLTDSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTR  642

Query  924   -SGSGGAADLLLREAS---LTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGV  979
              +GS  +A+L+L+EA+   L     AGA R + V  Y+FHP+V+TMQYS+FFH CRLHGV
Sbjct  643   AAGSATSANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGV  702

Query  980   CFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSR  1039
             CFDVER  GT+F+LADSLTAGVFGI+  G+T   AL FLRTALEVIGREVG        R
Sbjct  703   CFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLR  762

Query  1040  -PVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075
                   +GNFA+VL+ VR  T GGK  +L K+RRLRR
Sbjct  763   GGGDCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLRR  798

>PYIR_13453
Length=1186

 Score = 873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/987 (50%), Positives = 658/987 (67%), Gaps = 87/987 (9%)

Query  156   QHGRLLRKKTT-------QHCRLLPSVN---------KVDPTAPTPELREEDAKHGVLNL  199
              HG +++   T       Q  R +PS N         K D   P+  + + +  +G    
Sbjct  219   NHGSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPS  278

Query  200   VTRSSG-----TKDGSGVMKQR----ATRIYDRSEQPARATPFTQSTGYNLAALKFDLRS  250
             + R++      +K GS ++  R    +  +  R  +         +   NL A    + +
Sbjct  279   LQRTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTA  338

Query  251   TGTGKNDRSNDDMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLD  310
                   D+S +  E    ++D E++      AD+D D+ + M+EL  NV+KIRGYN+LLD
Sbjct  339   AAMLSTDQSQE-AESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLD  397

Query  311   AYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQR  370
              YSLHQF+IHKGR+MR+TPEFVSF+RVAQE+WGSVEE +RALE LLT+YFVPLAY+DGQR
Sbjct  398   TYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQR  457

Query  371   LLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSI  430
             L+++AA     FSK +LL+CIVNE+QV S++RRPGQRYKG+DRKRRAA TIQ   RMW  
Sbjct  458   LMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWN  517

Query  431   RRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIA  490
             +++Y R R    S   IQ  WR+++ H +LK +L+  R +Q E+WEA+MQ L+  W  I 
Sbjct  518   QKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIK  577

Query  491   GRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADV  550
             G RRVV+HVPSLS+DE SR+SA+NF+V+QN+QL+R+C   +D +VD +VYVSPFELTADV
Sbjct  578   GNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVSPFELTADV  635

Query  551   SQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEA  610
             +QY +KLLQLGG+AD   RVKLV+PEQAARFP HFSL++LLLYSPHCLRRI+ Y   KEA
Sbjct  636   AQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEA  695

Query  611   YLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDE  670
             YLV G+PG ED+RLAVAL++PILG  P  ALPL+T+SG KR  +RADVNVPTGTY++YDE
Sbjct  696   YLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDE  755

Query  671   HELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQP  730
              EL  +LAKL ++H+EQ  W+LK+DYDP G G A++D+S M  +RE+RREK++PEYW+QP
Sbjct  756   DELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQP  815

Query  731   GPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAAT  790
               RD AA+ ++AELER   LA L TP+H E++P+W++F +AI  FG V+EA P A I   
Sbjct  816   STRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVI---  870

Query  791   PESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLN--------------------RKTVA  830
                        +VRANLF+ P G+  ++S+   +                      KTV 
Sbjct  871   ----------GHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVG  920

Query  831   FTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFL  890
             + FPQTAAP+EA++GA  A GKLL +  V+GY S+D++VFQ++K   + RLWA+A+HP+L
Sbjct  921   YAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALHPYL  979

Query  891   TDSAASFACFHLLARGAYRVAA------------------SNSMVNANPGRSGSGGAADL  932
             TDSA++FA FHLL RGA   ++                  S    ++    +    AADL
Sbjct  980   TDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADL  1039

Query  933   LLREAS---LTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGT  989
             +++EA+   L     AGA R +VV  Y+FHP+V+TMQYSAFFH CRLHGVCFDVER +G+
Sbjct  1040  VMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGS  1099

Query  990   LFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSR-PVSTRNGNF  1048
             +FLLADSLTAGVFGI+   ++  GAL FLRTALEVIGREVG    M        +  GNF
Sbjct  1100  VFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGESETGNF  1159

Query  1049  AQVLSAVRASTGGGKGDRLGKMRRLRR  1075
             A VL+ +RA T GGK  +L K+RRLRR
Sbjct  1160  ADVLAVIRALT-GGKSAKLEKIRRLRR  1185

 Score = 201 bits (510),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 172/289 (60%), Gaps = 43/289 (15%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRH-SAVVTTAEVQAF  59
            M++ QQQHHVEDVGR+LLQTQEQLR+MREQM A +       S MR  S+  +  +V AF
Sbjct  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPS---SSMRFASSGASQPDVLAF  57

Query  60   NAILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAA----PPSTRHRSG  115
              ILQ+ EVE+RAKAELVL G VN+SS          + LP V+ +A     P  R R  
Sbjct  58   QEILQRAEVEIRAKAELVLNGFVNTSSQ--------ASALPTVSSSANGNASPKARLRQN  109

Query  116  YGD----------ASSIP-IEFFREQFHNSSVE-VRQSLMPSPQHWQRHLGIQHGRLLRK  163
                         AS  P +++FR +FHN +VE V   ++PSP   QR   I  G+L++K
Sbjct  110  VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSP--VQR---ITKGQLVKK  164

Query  164  KTTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTRS----------SGTKDGSGVM  213
            K  Q+ RLLPSVNK DP+APTPEL E+DAK G+L+LV R           +   +   ++
Sbjct  165  KMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSII  224

Query  214  KQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDD  262
            K   TRIYDR EQP R+ P T  +G+N+A+LKFD+    T  +DR N +
Sbjct  225  KNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSN  273

>SDRG_01764
Length=1092

 Score = 747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/1120 (40%), Positives = 648/1120 (58%), Gaps = 107/1120 (10%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGYGDA-  119
             AIL++ E++LR+KAE+VL G+VN++          G   P V+  +    + R    DA 
Sbjct  44    AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRE-LADAM  102

Query  120   -----------SSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLG--IQHGRLLRKKTT  166
                         S P+E  R+Q     V V +   P     +R +G  +Q GRL++KK T
Sbjct  103   ARDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPG----KRPIGRTMQVGRLIKKKVT  158

Query  167   QHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------SSGTKDGSGVMKQRA  217
                RLLP VN++DP AP P+L ++DAK GVLNLV R         S     G G+++   
Sbjct  159   GPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSK  218

Query  218   TRIYDRSEQPARATPFTQSTGYNLAALKFDLRST------------GTGKNDRS-----N  260
              R+YDRSEQP ++ P+  S+ +N+A+LK DL                  +N +S      
Sbjct  219   LRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEPDPTPLTRLAVARNKKSAVATVQ  278

Query  261   DDMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIH  320
                 G ++  D  +  ED    D   +    ++EL  NV+KIRGYNDLLD YSLHQF+I 
Sbjct  279   LTFPGAKDEGD-VVPVEDPTTDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIR  337

Query  321   KGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLAATGQP  380
             KG+++ +TPEF+SF+R+ ++LWGSV  A+R LETLL  Y VPLAY+DGQ+LL +AA    
Sbjct  338   KGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAV  397

Query  381   RFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRAS  440
               SKSELL C++N ++V + + RPGQR+KG D +  AA  +Q+  RM   RRR +R    
Sbjct  398   SRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRR-LRQHHG  456

Query  441   DISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRVVVHVP  500
                A+ IQ  +R+Y     ++ +LR  R      WE +M      W +I  +RRVVVHVP
Sbjct  457   HSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVP  516

Query  501   SLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQL  560
             S S +E +RL+ +NFA++QNLQ+ R+CA A D +VD+ +Y+SPFEL+AD+ +Y ++LLQL
Sbjct  517   SFSAEERTRLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSADIQKYMMRLLQL  574

Query  561   GGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAE  620
             GG+AD   RV+++ PE A RFP+HFSL+++LLYSPHCL++I+ Y  GKEAY+V G  G E
Sbjct  575   GGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPE  634

Query  621   DQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKL  680
             D+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P G +++YDE EL  +LAKL
Sbjct  635   DKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKL  694

Query  681   AVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR---TPEYWRQPGPRDAAA  737
               A++ Q  WL+KLD DP   G A +D+  ++ + ++R EKR     EY+ QP  ++   
Sbjct  695   TAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIV  754

Query  738   KLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLL  797
             + ++AEL       RL +P   +++P W+     +   G VIEA PP  +          
Sbjct  755   RAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVL----------  802

Query  798   VEPAYVRANLFVYPDGKNVLASSGGGL-----NRKTVAFTFPQTAAPHEAVQGACDATGK  852
                A VRAN+F+ P G   L S+   L       ++V   +P T  P+ A++GA  A  +
Sbjct  803   ---ARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQSVGAVYPSTTVPYAAIRGASLAVAQ  859

Query  853   LLVETSVWGYVSLDFVVFQDEK--NG--GSP--RLWALAVHPFLTDSAASFACFHLLARG  906
              +  + + GY S+D+V F D K  NG  G P  RLWAL + P LT +A SF  F  L+  
Sbjct  860   AMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCA  919

Query  907   AYRVAASNSMVNANPGRSGSGGAADLLLREASLT---------KAALAGAPRCFVVCSYV  957
                 A   S +   P    S     L + E  L          +++  G  R ++   Y+
Sbjct  920   TLDAATGRSFL-PQPAPHPSPATGQLPVTETQLAVEKILSESPRSSNVGPERAYIAHEYI  978

Query  958   FHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAF  1017
             FHP++ T+QY+ FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L +GE+ + A+  
Sbjct  979   FHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRL  1038

Query  1018  LRTALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVRA  1057
              R ALE+IG +VG  ++ A       R GNFA VL A+R+
Sbjct  1039  TRAALELIGDQVG--VQPAPDALTGERLGNFAAVLGAIRS  1076

>H257_06305
Length=1099

 Score = 696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/1123 (38%), Positives = 644/1123 (57%), Gaps = 108/1123 (10%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             M+K+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   N
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEK-----------------NNVDVNEIN  43

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHR-------  113
             AIL++ E +LRAKAE+VL G+VN+S          G    +   ++  + +         
Sbjct  44    AILERAEADLRAKAEIVLNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMTR  103

Query  114   -SGYGDASSIPIEFFREQFHNSSVE-VRQSLMPSPQHWQRHLG--IQHGRLLRKKTTQHC  169
              S Y  AS    +  RE      +E + +   P     +R +G  I+ G L++KKTT+  
Sbjct  104   DSSYEPASPTYRQEDREPRFGGPIEPMERDRAPG----RRPVGRIIKAGSLVKKKTTKPH  159

Query  170   RLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------SSGTKDGSGVMKQRATRI  220
             RLLP +N+ DPTAP+P+L EEDA+ GV NLVTR         +     G+ V++    +I
Sbjct  160   RLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKI  219

Query  221   YDRSEQPARATPFTQSTGYNLAALKFDLRST----------------GTGKNDRSNDDME  264
             YDR+ QP ++ P+T  +G+N+A+LKFD+ +T                   K   +  D+ 
Sbjct  220   YDRASQPVKSMPYTNPSGFNMASLKFDMSTTPATSTPSPVAAVVSGGDVSKMVVTPIDIS  279

Query  265   GNREHIDGEISDEDQGGA----DNDKDEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIH  320
              +         ++ +GGA    D +  + + +  L  NV+KIRGYN+LLD YSLHQF+I 
Sbjct  280   FDAPSSSHPPVEQPKGGATGGDDTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIR  339

Query  321   KGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLAATGQP  380
             KG+++ DTPEF+SF+R  ++LWGSV  +++ LET+LT Y VPLAYVDGQ+L+ +AA    
Sbjct  340   KGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDAT  399

Query  381   RFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRAS  440
                 +ELL+CI+N ++V S++RRPGQRYKG      A   IQ+  RM+  ++R +++   
Sbjct  400   TRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKR-LKNHHG  458

Query  441   DISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRVVVHVP  500
             +  A  IQ  +RSY C + L+ RL+ VR   L  W+A+MQ  R  W  +  +RRVVVHVP
Sbjct  459   NEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVP  518

Query  501   SLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQL  560
             S + D+ +RL  +NF+++QNLQ+ R+CA A D +VD+ +Y+SPFEL+ D+ +Y ++LLQL
Sbjct  519   SFASDDRTRLKMDNFSIRQNLQMARMCAIA-DPNVDI-IYISPFELSPDIQRYQVRLLQL  576

Query  561   GGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAE  620
             GG+ D + R++++ PE   RFP+HFSL++LLLYSPHCL++I+ +  GK AY+V G  G E
Sbjct  577   GGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPE  636

Query  621   DQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKL  680
             D+RLA+AL +P+LG  P +AL   TRSGGKR+ + ADVN+P G +++YDE EL  +L+KL
Sbjct  637   DKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKL  696

Query  681   AVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR-----TPEYWRQPGPRDA  735
               A ++Q +WL+K+D D    G A +++  MQ++ ++R EKR       EY++QP  RDA
Sbjct  697   IAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDA  756

Query  736   AAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSS  795
               + +  EL      A + TP   +++ +W +        G VIEA P          S 
Sbjct  757   VLRSIFNELTESYFAANI-TPCFPDVYASWAELRPVALRVGVVIEAYP----------SK  805

Query  796   LLVEPAYVRANLFVYPDGKNVLAS------SGGGLNRKTVAFTFPQTAAPHEAVQGACDA  849
             +L +   VRAN+F+ P G   + S      S    +    A  FPQT+ P++A++GA  A
Sbjct  806   VLSQ---VRANVFIEPSGGVHITSAHDLFMSPANKHLPQCAL-FPQTSVPYQAIRGASLA  861

Query  850   TGKLLVETSVWGYVSLDFVVFQDEKN---GGSP--RLWALAVHPFLTDSAASFACFHLLA  904
                 +    + GY S+D++ F D K    GG P  RLWA+ V P LT++A SF  F  L+
Sbjct  862   IASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS  921

Query  905   RGAYRVAASNSMVNANPGR-----------SGSGGAADLLLREASLTKAALAGAPRCFVV  953
                +        +                 + +  A + +L       A + G  R ++V
Sbjct  922   CSQFNPITGKCHLQVAAPPPIAASATVAPITQAQKAVETILSARPPNGAVVCGPERTYMV  981

Query  954   CSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEG  1013
               Y++HP++ T+ +S FF+ CRL+GV FD++R +G  F+LADSLTAGV G++ +GE  + 
Sbjct  982   LDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKE  1041

Query  1014  ALAFLRTALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVR  1056
             A    R A+E+IG +VG  ++         R GNF  +L+ VR
Sbjct  1042  AFRIARQAVELIGDQVG--VQALPDSLSGERLGNFPHLLAIVR  1082

>H310_09212
Length=1113

 Score = 688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/1163 (38%), Positives = 661/1163 (57%), Gaps = 140/1163 (12%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
             MEK+ QQ+H EDVGR+LLQ Q++LR MRE++                       +V   +
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHEN-----------------NNLDVNQIH  43

Query  61    AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGY----  116
             AIL++ E +LRAKAE+VL G+VN+S            +LP +   AP   R+ S +    
Sbjct  44    AILERAEADLRAKAEIVLNGVVNNSMK----------MLPAID--APGGQRYLSKFSSKL  91

Query  117   GDASSIPIEFFREQF---------HNSSVEVRQSLMP--SPQHWQRHLG-------IQHG  158
                  +     RE           H++S     SL     P    R  G       ++ G
Sbjct  92    AQKRDLAATMARENTYEPGSPTYGHDTSYREHPSLSGPIEPMERDRTPGRRPVGRIVKAG  151

Query  159   RLLRKKTTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------SSGTKDG  209
              L++ KTT+  R+LP +N++DPTAP P L ++DA+ GV NL+TR         +     G
Sbjct  152   SLVKHKTTKPRRILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAFTHG  211

Query  210   SGVMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDL--RSTGTGKNDRSND--DMEG  265
             + V++    +IYDR+ QP ++ P+T  +G+N+A+LKFD+   +  T  N   N   D+  
Sbjct  212   TSVIQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPINQGGDIPP  271

Query  266   NREHI--------DGEISD-------EDQGGAD-NDKD-----------EEAEMEELGAN  298
             ++  I        DG  ++       + +GG D + KD           +   +  L  N
Sbjct  272   SKTSIPTPIDITFDGHANNAVPFRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRN  331

Query  299   VDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQ  358
             V+KIRGYN+LLD YSLHQF+I KG+++ DTPEF+SF+R  ++LWGSV ++++ LE +LT 
Sbjct  332   VEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTN  391

Query  359   YFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAA  418
             Y VPLAYVDGQ+L+ +AA         ELL+CI+N ++V S++RRPGQR+KG+     AA
Sbjct  392   YSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAA  451

Query  419   TTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweAR  478
               +Q+  RM+  ++R +++   +  A  IQ  +RSY C + L+ RL+ VR   L  W+A+
Sbjct  452   VLLQSVWRMYITKKR-LKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQ  510

Query  479   MQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLL  538
             MQ  R  W  I  +RRVVVHVPS S +E +RL  ENF++QQNLQ+ R+CA A D +VD +
Sbjct  511   MQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIA-DPNVD-I  568

Query  539   VYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCL  598
             +Y+SPFEL+ D+ +Y ++LLQLGG+AD + R++++ PE   RFP+HFSL+++LLYSPHCL
Sbjct  569   IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCL  628

Query  599   RRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADV  658
             ++I+ +  GK+AY+V G  G ED+RLA+AL LP+LG  P +AL   TRSGGKR+ + ADV
Sbjct  629   KKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADV  688

Query  659   NVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELR  718
             N+P G +++YDE EL  +L+KL  A ++Q +WL+K+D D    G A +++  MQ++ + R
Sbjct  689   NIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFR  748

Query  719   REKR-----TPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIG  773
              EKR       EY++QP  RDA  + V +EL      A   TP   E++ +W        
Sbjct  749   AEKREMKHGAAEYFQQPDVRDAVLRSVYSELNE-SYFAANVTPCFPEMYASWAAMRPIAL  807

Query  774   HFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGG----GLNRK-T  828
               G VIEA P          S +L   ++VR N+F+ P G   + S+       +N+   
Sbjct  808   RVGVVIEAYP----------SKVL---SHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLP  854

Query  829   VAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKN--GGSP--RLWAL  884
                 FPQ++ P++A++GA  A    +    + GY S+D++ F D K    G P  RLWA+
Sbjct  855   QCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAM  914

Query  885   AVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGRSGSGGAAD------------L  932
              V P LT++A SF  F  L+   +      S +   P    +   A+            +
Sbjct  915   QVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATI  974

Query  933   LLREASLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFL  992
             L   +S   A++ G  R ++V  Y++HP++ T+Q++ FF+ CRLHGV FD++R +G  ++
Sbjct  975   LSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYI  1034

Query  993   LADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSRPVSTRNGNFAQVL  1052
             LADSLTAGV G++ +GE+ + A    R A+E+IG +VG  ++   +     R GNF  +L
Sbjct  1035  LADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVG--VQALPNSLSGERLGNFPHLL  1092

Query  1053  SAVRASTGGGKGDRLGKMRRLRR  1075
             + VR  +     D     RR RR
Sbjct  1093  AIVRNKS----DDPAAADRRKRR  1111

>SPRG_06354
Length=884

 Score = 645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/884 (42%), Positives = 533/884 (60%), Gaps = 62/884 (7%)

Query  213   MKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGT------------GKNDRSN  260
             M+    R+YDRSEQP ++ P+  S+G+N+A+LK DL    T             +  +S 
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPAVARKRKST  60

Query  261   D-----DMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLH  315
                      G ++ +   +  ED    D   +    ++EL  NV+KIRGYNDLLD YSLH
Sbjct  61    VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  120

Query  316   QFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLA  375
             QF+I KG+++ +TPEF+SF+R+ ++LWGSV  A+R LETLL  Y VPLAY+DGQ+LL +A
Sbjct  121   QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA  180

Query  376   ATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  435
             A      SKSELL C++N ++V + + RPGQR+KG D +  AA  IQ+  RM   RR  +
Sbjct  181   AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRR-LL  239

Query  436   RSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRV  495
             R       AT IQ  +R+Y C   ++ +LR  R      WE +M      W +I  +RRV
Sbjct  240   RQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRV  299

Query  496   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFL  555
             VVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D +VD+ +Y+SPFEL+ D+ +Y +
Sbjct  300   VVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSVDIQKYMM  357

Query  556   KLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMG  615
             +LLQLGG+AD   RV+++ PE A RFP+HFSL+++LLYSPHCL++I+ Y  GKEAY+V G
Sbjct  358   RLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAG  417

Query  616   LPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFA  675
               G ED+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P G +++YDE EL  
Sbjct  418   TVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELIL  477

Query  676   ALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR---TPEYWRQPGP  732
             +LAKL  A++ Q  WL+KLD DP   G A +D+  ++ + ++R EKR     EY+ QP  
Sbjct  478   SLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNI  537

Query  733   RDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPE  792
             ++   + ++AEL       RL +P   +++P W+     +   G VIEA PP  +A    
Sbjct  538   KEGIVRAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLAR---  592

Query  793   SSSLLVEPAYVRANLFVYPDGKNVLASSGGGL-----NRKTVAFTFPQTAAPHEAVQGAC  847
                       VRAN+F+ P G   + S+   L       ++V   +P TA P+ A++GA 
Sbjct  593   ----------VRANVFIEPSGGVHVTSAQEQLMHVKNKHQSVGAVYPPTAVPYAAIRGAS  642

Query  848   DATGKLLVETSVWGYVSLDFVVFQDEK--NG--GSP--RLWALAVHPFLTDSAASFACFH  901
              A  + +  + + GY S+D+V F D K  NG  G P  RLWAL + P LT +A SF  F 
Sbjct  643   LAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFT  702

Query  902   LLARGAYRVAASNSMVN---------ANPGRSGSGGAADLLLREASLTKAALAGAPRCFV  952
              L+      A   S +          A P  + +  A + +L E+S   AA  GA R ++
Sbjct  703   FLSCATLDAATGRSFLPLPAPRPSSLAGPPATETQLAVEKILGESS--PAATMGAERAYI  760

Query  953   VCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTE  1012
                Y+FHP++ T+QY+ FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L +GE+ +
Sbjct  761   AHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDK  820

Query  1013  GALAFLRTALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVR  1056
              A+   R ALE+IG +VG  ++ A       R GNFA VL A+R
Sbjct  821   EAVRLTRAALELIGDQVG--VQPAPDALTGERLGNFAAVLGAIR  862

>CCI45122
Length=1105

 Score = 580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/1121 (34%), Positives = 599/1121 (53%), Gaps = 126/1121 (11%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaS--------PMRHSAVVT  52
             M+ ++Q+HH ED+GR+LLQTQ++LR +R +++      E   +        P    +V  
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  53    TAEVQAFNAILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPP----  108
             + +++    IL + E E++AK +L+ KG+ +     Q       T LP V  A+PP    
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQ-------TGLPFV--ASPPRQIP  111

Query  109   -----STRHRSGYGDASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQR------HLGIQH  157
                  S   +S + + S   ++  R+Q H  SV+ +   +P+ QH +         G+  
Sbjct  112   SSANSSLERKSSFQELS---VDLIRKQLH--SVKEKYKCLPTKQHSELISPKRPTQGLLT  166

Query  158   GRLLRKKTTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTRSSGTKDGSGVMKQRA  217
              +  +K+     R LP+V + +    +   R++  +         S+       V+ QR 
Sbjct  167   SKPSKKRYNASLRSLPTVQRGEAGDFSSASRDQIGEA--------SNTLSVNDRVLMQRT  218

Query  218   TRIYDRSEQPARATPFTQSTGYNLAALKFDLRS----TGTGKNDRS-----NDDMEGNRE  268
               +++R E+P + TP+T +  +N+ ++KFD  +    +  GK          +D++  + 
Sbjct  219   AHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQR  278

Query  269   H---IDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGY-----NDLLDAY-----SLH  315
             +   +  +IS    GG   D    +   +    +  I+       ND+  +        +
Sbjct  279   NGALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPIFLNDVTKSLVGEISKTY  338

Query  316   QFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLA  375
              F+IH+G   R  PEF +F+R+A  +W SV+  L AL  +L+ YF+P+AY++GQR+L+LA
Sbjct  339   DFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLA  398

Query  376   ATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  435
                    +  +L++CI NE++V  +L +PGQR++G +R +RA   +Q+ +RM   R+R++
Sbjct  399   QADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFL  458

Query  436   RSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRV  495
               R      T IQ  WR +S H A K ++   R  Q   +   M+   + W +I  +RR 
Sbjct  459   VMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRT  518

Query  496   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFL  555
             ++H+PS+S+D   R+  E F++QQNLQL R+C A +D +V+ L+Y+ PFELT D+ QY++
Sbjct  519   IIHIPSISIDSRQRMKTEQFSIQQNLQLQRLC-AVIDENVE-LIYICPFELTDDIVQYYM  576

Query  556   KLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMG  615
             KLLQLGG++D+  R+KL+ PE A+RFP HFSLSS++LYSP  L R+     G+ AY+V G
Sbjct  577   KLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPG  636

Query  616   LPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFA  675
              PG ED+R+A  L +PILG    ++L   T SG KR   +A+VN      +LYDE+EL  
Sbjct  637   FPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIF  696

Query  676   ALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDA  735
             +LAKL  +H  Q   +L+LDYDP G G A++D+S +Q+++E+R   +T E W QP     
Sbjct  697   SLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPP---I  753

Query  736   AAKLVLA-ELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESS  794
              AKL+    LE    ++     +H EIFP+ + F +AI  +G +IE  P           
Sbjct  754   QAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKK---------  804

Query  795   SLLVEPAYVRANLFVYPDGKNVLASS-----------------GGGLNR------KTVAF  831
                    +VRANLF+ P  +  ++S+                   GL++      +T   
Sbjct  805   ----RQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGV  860

Query  832   TFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLT  891
             TFPQT   HE ++ A  A G+ L +  + GY+S+DFVV  D++      L+A  + PFLT
Sbjct  861   TFPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-LYATGLQPFLT  919

Query  892   DSAASFACFHLLARGAYRVAASNSM----------VNANPGRSGSGGAADLLLREASLTK  941
             ++AASFA F LL+RG    + + S+          V  +P  S S  A DL++REA L+ 
Sbjct  920   NTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLS--ATDLMIREARLSG  977

Query  942   AALAGAP----RCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSL  997
                   P    R + +  YV +P V T+  S+FF  CR  GV FD ER  GT+FLLADSL
Sbjct  978   IVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSL  1037

Query  998   TAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATS  1038
             TAGVFGI+ + +T + AL+  R A+E I    G  + ++ S
Sbjct  1038  TAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKS  1078

>CCA18898
Length=1147

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/1158 (34%), Positives = 633/1158 (55%), Gaps = 142/1158 (12%)

Query  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaa---aveanaSPMR--HSAVVT---  52
             ME+V+Q++H EDVGR+LLQTQ++LR +R +++A      +   +A P R  H+++     
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  53    TAEVQAFNAILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPP---S  109
             + +++  + IL + E E++AK +L+ +G  N     Q       T LP VT  +PP   S
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQ-------TGLPAVT--SPPRQVS  136

Query  110   TRHRSGYGDASSI---PIEFFREQF------HNSSVEVRQSLMPSPQHWQRHLGIQHGRL  160
             T  +S      S     ++  R+Q       +  S  ++QS + SP+   +  G+   + 
Sbjct  137   TTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQ--GLLTSKA  194

Query  161   LRKKTTQHCRLLPSVNKVDPTAPTPELREE--------DAKHGV-LNLVTRSSGTKDGSG  211
              +K+     + LP+V     +  +  L ++        +++HG  LN +  S  T D + 
Sbjct  195   SKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHFLNSRHGSPLNSIEISQSTYDRA-  253

Query  212   VMKQRATRIYDRSEQPARATPFTQSTGYNLAALKFD------LRSTG--------TGKND  257
              + QR  ++++R E+P R TP T +  +++ +LKFD      L+S G        T  ND
Sbjct  254   -LMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQVTHFND  312

Query  258   RS----NDDMEGNREH---IDGEISDEDQGGADNDKDEEAEM--------EELGANVDKI  302
             ++    N  +  N+     I+G    ED       +D   +M         ++  + +  
Sbjct  313   QALGECNCRLSTNQVSMALING--FREDNSKLSPSRDHSKKMGIPKVIKSTKINTDTESH  370

Query  303   RGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVeealraletlltQYFVP  362
             +G N      S H F IH+G   R   +F SF+  A ++W +VEE +  LE LL+ YF+P
Sbjct  371   KGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIP  425

Query  363   LAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQ  422
             +A+++GQR+L+L+       +  +LL+C+ NE +V  +L +PGQR++G ++  RAA  +Q
Sbjct  426   IAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQ  485

Query  423   ACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTrlrevrreqlerweARMQDL  482
             + +RM + RR Y+   ++      IQ  WR Y+ + A K ++  +R  Q   +   M+  
Sbjct  486   SFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSF  545

Query  483   RTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVS  542
              + W +I  +RR V+H+PS+S+D   R+  E F++QQNLQL R+CA  +D +V+L +Y+ 
Sbjct  546   CSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCAL-IDENVEL-IYIC  603

Query  543   PFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIR  602
             PFELT D+ QY++KLLQL G++D+  R+KL+ PE A+RFP HFSLS+++L SPH ++R+ 
Sbjct  604   PFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLS  663

Query  603   HYTAGKEAYLVMGLPGAEDQRLAVALDlpilgappaqalpllTRSGGKRLLIRADVNVPT  662
              Y  G+ AYLV G PG ED+RLA  L +PILG  PA+   + T SG KR   + + N   
Sbjct  664   RYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLP  723

Query  663   GTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR  722
             G+ +LYDE+EL  +LAKL  A+  Q   +LKLDYDP   G A+VD+S +Q+++ LR   R
Sbjct  724   GSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTR  783

Query  723   TPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAV  782
             T +YWRQP  ++   + ++ E++   +++ L   ++ E++P+W+ F +AI  +G VIE  
Sbjct  784   TLDYWRQPPIQNKLIRNIVQEMQ--SIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVC  841

Query  783   PPAGIAATPESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLN-----------------  825
             P                  YVRANLF+ P  +  ++S+   L+                 
Sbjct  842   PKN-------------RQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFD  888

Query  826   ------RKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSP  879
                    +T+ FTFPQT   HE ++ A    G+ L +  + GY+S+DF+V  D++     
Sbjct  889   KAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI  948

Query  880   RLWALAVHPFLTDSAASFACFHLLAR-GAYRV---------AASNSMVNANPGRSGSGGA  929
              L+A+A+ PFLT+SAASF+ F  L+R G Y           A ++  V ++   S S  A
Sbjct  949   -LYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSA  1007

Query  930   ADLLLREASLTKAALAGAP----RCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVER  985
              DL++REA L+       P    R +V+  YV +P+V T+ Y +FF  CR  GV FD+ER
Sbjct  1008  TDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIER  1067

Query  986   TLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATS-------  1038
              +GT+FLLADSLTAGV GI+ + +T + AL   R A+E I    G    ++ S       
Sbjct  1068  DIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHSMNDL  1127

Query  1039  -RPVSTRNGNFAQVLSAV  1055
              R  STR+  F+++L A+
Sbjct  1128  MRADSTRD-RFSEILRAL  1144

>PHYKE_8394
Length=428

 Score = 345 bits (886),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 195/222 (88%), Gaps = 23/222 (10%)

Query  513  ENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  572
            ENFAVQQNLQLTRICAAALDS+VDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  573  VFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDlpi  632
            VFPEQA RFP                        GK+AYLVMGLPGAEDQRLA+ALDLPI
Sbjct  238  VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  633  lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLL  692
            LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYD+HELFAALAKLAV HM+QP+WLL
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  693  KLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  734
            KLDYDPLG+GEA++DLSGMQAMRELRREKR PEYWRQPGPRD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 109/148 (74%), Gaps = 25/148 (17%)

Query  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaaaveanaSPMRHSAVVTTAEVQAFN  60
            MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS V          
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV----------  50

Query  61   AILQQTEVELRAKAELVLKGMVnssssaqtnqsqsGTLLPVVTVAAPPSTRHRSGYG---  117
                +TE+ELRAKAELVL GMVNSSS+ Q+NQ+Q GTLLP VTV APPS R R GY    
Sbjct  51   ----KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  106

Query  118  --------DASSIPIEFFREQFHNSSVE  137
                    D  SIP+EFFRE+F NS+VE
Sbjct  107  KPKMTTRKDGGSIPMEFFRERFRNSNVE  134

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)

Query  271  DGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYS  313
            D ++SDEDQG A ND+DE+AEMEELGANVDKIRGYN+LLDAY+
Sbjct  135  DDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 1/31 (3%)

Query  814  KNVLASSGGGLNRKTVAFTFPQTAAPHEAVQ  844
            +NVLAS G GLNRKTVA+TFPQTAAPHEAV+
Sbjct  396  QNVLAS-GSGLNRKTVAYTFPQTAAPHEAVK  425

>PYAR_13581
Length=730

 Score = 304 bits (778),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 192/391 (49%), Positives = 249/391 (64%), Gaps = 47/391 (12%)

Query  217  ATRIYDRSEQPARATP-----FTQSTGYNLAALKFDLRSTGTGKNDRSNDD--MEGNREH  269
            A R+Y R EQP RA P            N   + F   + G     +S D+  M+ +   
Sbjct  3    AVRLYRREEQPVRAVPDISPRPPPPQQLNTVTISF---TDGESPPQQSTDEPEMDESPPQ  59

Query  270  IDGE----ISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSM  325
            +D E    I D D   +D +      M++L  NV+KIRGYN+LLD YSLHQF+IHKGR+M
Sbjct  60   LDTEHAQHIDDADASESDANA-----MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAM  114

Query  326  RDTPEFVSFRRVAQELWGSVeealraletlltQYFVPLAYVDGQRLLSLAATGQPRFSKS  385
            R+TPEF SF+RV QE+WG+V+E +RALE LLT+YF+                    F  S
Sbjct  115  RETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFM------------------ASFPTS  156

Query  386  ELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISAT  445
             LL+C+VNE+QV S+LRRPGQRYKG+DRKRRAATT+QA  RM   R R+ R      SAT
Sbjct  157  VLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHRNRFRRVCRRGASAT  216

Query  446  RIQLAWRSYSCHAALKTrlrevrreqlerweARMQDLRTQWPQIAGRRRVVVHVPSLSLD  505
            RIQ  WR ++   +L+  L   R EQL  W+ +M  LR+QW +I+ +RRVVVHVPSLSLD
Sbjct  217  RIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLD  276

Query  506  EHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLAD  565
            EH+R+S ++FAVQQNLQL R+ AA +D+ V+ +VYVSPFEL  D+S          G+A+
Sbjct  277  EHARVSLDHFAVQQNLQLARL-AAVVDATVEYVVYVSPFELPTDLSH---------GVAN  326

Query  566  SRPRVKLVFPEQAARFPDHFSLSSLLLYSPH  596
            +  RVK+V PE AA FP HFSL++ LLYSPH
Sbjct  327  AAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357

 Score = 173 bits (438),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 131/376 (35%), Positives = 175/376 (47%), Gaps = 101/376 (27%)

Query  704   AVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFP  763
             A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  LA P H+E FP
Sbjct  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446

Query  764   AWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYP-----DGKNVLA  818
              WR F +AIG  G VIEA+ PA +               VR N+FV P     D    + 
Sbjct  447   DWRAFAQAIGRDGVVIEAL-PARVRGV------------VRVNIFVTPASSDHDADVPVV  493

Query  819   SSGGGL----NRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVW-GYVSLDFVVFQDE  873
             S+   L     R  +AF  PQT  PH+AV GA  A G+LL E   + GY S+D  + +DE
Sbjct  494   STQEALRASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDE  553

Query  874   KNGGSPRLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGRSGSGGAADLL  933
              +G                        +LL   A  V  S  +  A P          L+
Sbjct  554   TSG-----------------------LYLLPSPA--VDTSAPLSPATP----------LV  578

Query  934   LREASLTK------AALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTL  987
             L+EA L        A+ + +PRCFV   +  HP++ TM  +AFF ACR  GVCFDV R  
Sbjct  579   LQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTRR-  637

Query  988   GTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSRPVSTRNGN  1047
                                       A+ +LRTA EV+ REVG      +S P S  +GN
Sbjct  638   --------------------------AMQYLRTAFEVLAREVG------SSTPSS--DGN  663

Query  1048  FAQVLSAVRASTGGGK  1063
             F  VL+ +R   G  K
Sbjct  664   FGDVLALLRHRVGVEK  679

>H310_11272
Length=1799

 Score = 38.5 bits (88),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 3/40 (8%)

Query  415   RRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSY  454
             R+AATTI + +RM+  RRRY +SRA+ +   ++Q  WRS+
Sbjct  1122  RKAATTIASGIRMFLARRRYRKSRAAFV---KLQARWRSF  1158

>PPTG_16221
Length=1259

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  415  RRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCH  457
            R+ A  +Q  VR W +RRRY+R +   +    IQ  WR Y  H
Sbjct  698  RKYAIVLQKNVRCWLMRRRYLRQKQQIVV---IQKYWRRYVVH  737

>PHYCA_510686
Length=932

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 3/41 (7%)

Query  416  RAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSC  456
            ++  T+Q     +S+R RY R R S I   RIQ  WRS+SC
Sbjct  426  KSVITLQRYCLGYSVRSRYQRKRRSSI---RIQTIWRSWSC  463

>PHYSO_360938
Length=1200

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 3/41 (7%)

Query  416  RAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSC  456
            ++  T+Q     +S+R RY R R S I   RIQ  WRS+SC
Sbjct  691  KSVITLQRYCLGYSVRTRYQRKRRSSI---RIQAIWRSWSC  728

>PHYRA_84534
Length=1368

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (56%), Gaps = 3/43 (7%)

Query  415  RRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCH  457
            R+ A  +Q  VR W +RRR++R +   ++   IQ  WR Y  H
Sbjct  801  RKYAIVLQKNVRCWLMRRRFLRKKQHIVA---IQKYWRRYVVH  840

>CCI49123
Length=420

 Score = 35.0 bits (79),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  418  ATTIQACVRMWSIRRRYVRSRAS--DISATRIQLAWRSY  454
            AT IQ+  RM   RRR+V  R S   I+A  IQ+AWR++
Sbjct  120  ATMIQSWYRMQIARRRFVWKRLSLYSIAAAEIQIAWRNF  158

>PHYCA_53999
Length=947

 Score = 35.0 bits (79),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  415  RRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCH  457
            R+ A  +Q  VR W +RRR++R +   +    IQ  WR Y  H
Sbjct  698  RKYAIVLQKNVRCWLMRRRFLRQKQQIVV---IQKYWRRYVVH  737

>PHYRA_96309
Length=974

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query  417  AATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALK  461
            AA TIQ+CVR W +RRR    + + + A R+Q AWR  +    +K
Sbjct  127  AARTIQSCVRKW-LRRREHLLQLTVMHAARLQAAWRGRATRKQVK  170

>PHYSO_517698
Length=1911

 Score = 35.4 bits (80),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query  415   RRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYS  455
             RR+  T+Q CV  W + R++ R+R    ++ RIQ  WRS+S
Sbjct  1184  RRSTRTLQYCVTSWLLCRQFRRARK---ASRRIQKTWRSHS  1221

>SDRG_01714
Length=1233

 Score = 35.0 bits (79),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 52/124 (42%), Gaps = 25/124 (20%)

Query  411  RDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQ----------------LAWRSY  454
            R  K  AA  +Q+ VR+W  RRR++ ++A + S  R+                 LAW  Y
Sbjct  508  RIEKEAAALMLQSNVRLWLARRRFLAAKAKEASHRRLVALFLGQRSAQRRRNTFLAW--Y  565

Query  455  SCHAALKTrlrevrreqlerweARMQDLRTQWP---QIAGRRRVVVHVPSLSLDEHSRLS  511
            S H  ++   R         W  R    R  W     +A RRRV+ HV +L L  H+   
Sbjct  566  SMHTHVRALKRASASRLQSWWRGR----RALWEFRLAMAHRRRVLNHVEALVLGRHAHWR  621

Query  512  AENF  515
             + F
Sbjct  622  LQCF  625

>PYU1_G010796
Length=661

 Score = 35.0 bits (79),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 33/68 (49%), Gaps = 10/68 (15%)

Query  272  GEISDEDQGGADNDKDEEAEMEELGANV-------DKIRGYNDLLDAYSLHQFLIHKGRS  324
            G  +D +Q   D D DE  +MEE G NV       DK  GY  LL A +L      + R 
Sbjct  306  GNEADSEQDDKDADSDENDDMEEDGVNVSASALNKDKAAGYRRLLQAEALQN---RQRRR  362

Query  325  MRDTPEFV  332
            ++ T +FV
Sbjct  363  LKQTGDFV  370

>HYAP_08623
Length=1187

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (7%)

Query  415  RRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCH  457
            R+ A  +Q  VR W +RRR++R +   +    IQ  WR Y  H
Sbjct  621  RKYAIVLQKNVRCWLMRRRFLRQKQQIVV---IQKYWRRYVIH  660

>PHALS_01137
Length=1332

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query  416  RAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSC  456
            ++  T+Q     +S R RY R R S I   RIQ  WRS+SC
Sbjct  828  KSVITLQRYCLGYSKRSRYQRKRRSSI---RIQTTWRSWSC  865

>PHYSO_307452
Length=1214

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 1/45 (2%)

Query  417  AATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALK  461
            AA TIQ CVR W +RRR    + + + A R+Q AWR  +    +K
Sbjct  149  AARTIQRCVRKW-LRRRERILQPTVLHAARLQAAWRGRATRKRIK  192

>CCA25381
Length=819

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  418  ATTIQACVRMWSIRRRYVRSRAS--DISATRIQLAWRSY  454
            AT IQ+  RM   RRRY+  R S   I+A  IQ+AWR +
Sbjct  552  ATRIQSWYRMQVARRRYMWKRFSVYPIAAFEIQIAWRKF  590

>PHYCA_130954
Length=493

 Score = 33.9 bits (76),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (45%), Gaps = 5/87 (6%)

Query  109  STRHRSGYGDASSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLGIQHGRLLRKKTTQH  168
            S R RS   ++  +P +F R  F +S  +   SL+P   +  R LG++H  L        
Sbjct  286  SDRLRSCMQESEELPKDFTR-LFDDSLFKFDTSLIPEAVNLYRELGVKHEPLTLIPPQFE  344

Query  169  CRLLPSVNKVDP----TAPTPELREED  191
            C L P  + V P     AP P L + D
Sbjct  345  CPLPPLKSAVFPPALREAPPPALDQFD  371

>PPTG_08220
Length=1335

 Score = 34.3 bits (77),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (59%), Gaps = 3/41 (7%)

Query  416  RAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSC  456
            ++  T+Q     +++R RY R R S I   RIQ  WRS+SC
Sbjct  829  KSVITLQRYCLGYTMRARYQRKRRSSI---RIQAMWRSWSC  866

>HYAP_00989
Length=1330

 Score = 33.9 bits (76),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 24/49 (49%), Gaps = 0/49 (0%)

Query  413  RKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALK  461
            RKRR+   IQA  R WS  RRY R      +  ++Q   R Y+    +K
Sbjct  844  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVK  892

>HYAP_12850
Length=978

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 24/49 (49%), Gaps = 0/49 (0%)

Query  413  RKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALK  461
            RKRR+   IQA  R WS  RRY R      +  ++Q   R Y+    +K
Sbjct  492  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVK  540

>CCI41908
Length=1541

 Score = 33.9 bits (76),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  408  YKGRDRKRRAATTIQACVRMWSIRRRYVRSR  438
            Y+ R R++ A   IQA +RM+ +R+++VR R
Sbjct  867  YEYRKRRQNAILKIQATMRMYQVRKKFVRHR  897

>PYVX_24290
Length=549

 Score = 33.5 bits (75),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 61/149 (41%), Gaps = 39/149 (26%)

Query  823  GLNRKT-VAFTFPQTAAPH--------EAVQGACDATGKLL---------VETSVWG-YV  863
            G+ RKT VA T+ ++ A +          +Q     TGKL+         V T+VW  Y+
Sbjct  14   GVRRKTAVALTYERSTASNVRQYSSIRRVLQLGAKNTGKLIEDEVQQQGKVSTNVWKQYL  73

Query  864  SLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGR  923
            S           GG P LW L +      + A +    +L  G Y +  S    ++  G 
Sbjct  74   S---------SIGGVPMLWVLLI------TQALWQVLQIL--GDYWLGVSTGSQHSMTGG  116

Query  924  SGSGGAADLLLREASLTKAALAGAPRCFV  952
            SG+G A   L    +LT    AGA   F+
Sbjct  117  SGAGNAEHYLSVYTALT---FAGAAMVFI  142

>PHYSO_285743
Length=92

 Score = 30.8 bits (68),  Expect = 9.4, Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 21/37 (57%), Gaps = 0/37 (0%)

Query  172  LPSVNKVDPTAPTPELREEDAKHGVLNLVTRSSGTKD  208
            LPS  ++D  AP  ++R+ D   G  N++ +S G  D
Sbjct  17   LPSSRRIDRLAPPQQMRDRDDNPGYANILVQSPGGDD  53

>PPTG_13214
Length=2237

 Score = 33.5 bits (75),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query  399   SVLRRPGQR------YKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWR  452
             SV++R  +R      +K   R  RAA TIQ   R +  R   +R R    ++TRIQ  WR
Sbjct  988   SVIQRNFRRHLCQVVFKDTLRNHRAAVTIQRLFRGFQGRNAALRRRWEMYASTRIQTVWR  1047

Query  453   SYSCH---AALKT  462
              Y      AA++T
Sbjct  1048  RYKAKKYVAAVRT  1060

Lambda      K        H        a         alpha
   0.321    0.134    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 90539441250

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40