Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_81106147522022029855e-137
PHYKE_8389147522041838911e-122
PPTG_17122147522042058061e-109
PHYCA_129425147522042057885e-107
PHYRA_81107568762021827746e-105
PHYSO_284086147522041837703e-104
PHYCA_511409568762041827661e-103
PPTG_17121568762021827564e-102
PHYSO_477820568762021827522e-101
PITG_18450147522032047488e-101
PHYKE_8388568762051827348e-99
PHYCA_14369109792481687129e-95
PHYKE_3446231281991907026e-94
PHYRA_82864231281931696972e-93
PPTG_10635528561991686922e-92
PYVX_18176568762011816905e-92
PHYRA_85631109792281766918e-92
PHYSO_341599109791851686832e-91
PPTG_10636109792461696893e-91
PHYCA_102852242061951716834e-91
PHYKE_7718109792201686846e-91
PPTG_15264231281941716817e-91
PPTG_17366239131941716817e-91
PYVX_18174854042041826801e-90
PPTG_10634720132081626751e-89
PHYRA_84190720132061766751e-89
PHYSO_536424606911971686635e-88
PHYSO_507031586531971686635e-88
PHYCA_102624720131951736627e-88
PHYCA_102550457052681686653e-87
PPTG_10643457052501686512e-85
PHALS_00498109791991696393e-84
PPTG_10048213141901686183e-81
PYU1_G001741854041991696044e-79
PYVX_18173449665001666122e-76
PYIR_25089854042621655881e-75
PYU1_G001742932042131735701e-73
PHYSO_499978231281741655617e-73
PHYSO_501575820771741655617e-73
PHALS_03284309411881695592e-72
PYU1_G001744568762131735561e-71
PYIR_26626147522121715473e-70
PYU1_G001740147522061645456e-70
PITG_13520109791711335173e-66
PHYSO_343376532371721315141e-65
PPTG_0882086622501705174e-65
PHYSO_254168462841701555034e-64
PYU1_G001739932032661685046e-63
PPTG_14255469372681684994e-62
PHYCA_510817445761881674915e-62
PPTG_14254445761881674863e-61
PHYSO_417649445761851674714e-59
PHYKE_9185445762811674795e-59
PITG_1049986623231614774e-58
PHYSO_341596528562311274661e-57
PYAR_24096932032271654651e-57
PHYCA_53693413059831674967e-57
PYAP_22273932032681794621e-56
PYAP_22278932042891734632e-56
PYAP_22279854042231714511e-55
PYIR_26546866052391644504e-55
PHYCA_14368528562191654484e-55
PYIW_18791854041941714412e-54
PHYSO_262732469371881664377e-54
PHYSO_246676457051871684186e-51
PHYSO_527908600641741534044e-49
PPTG_17123147532011623926e-47
PHYSO_340369526762001683883e-46
PYU1_G001738534612261673894e-46
PHYCA_537323449662001633857e-46
PHYRA_81105534612011633796e-45
PITG_18452147538561603981e-43
HYAP_07096534612511603671e-42
PHYSO_353401534611461423573e-42
PYVX_18179534611471803052e-34
PYIW_18788932032441633081e-33
PYIW_18792932041251032952e-33
PYVX_18175147521471812843e-31
PYAP_18131991722261152816e-30
PHYRA_78625541464341662848e-29
PHYRA_78626578954731662841e-28
PYU1_G007476539131951432682e-28
PHYSO_342364529831941812613e-27
PYIR_1643542333041272673e-27
PYIR_1644442341821722569e-27
PHYRA_7358242353261882632e-26
PHYRA_74651699693441342632e-26
PHYKE_10578778802391822564e-26
PPTG_04622696962731372523e-25
PYAP_246891014392521792504e-25
PHYKE_81047713586632384e-25
PHYRA_73607194343431362545e-25
PHYCA_12942213313531772538e-25
PHYCA_13036542352661442498e-25
PHYRA_7868968382961792491e-24
PPTG_0461842353261802482e-24
PHYKE_6002526711971892403e-24
PYIR_16443823992751702453e-24
PITG_0494842342321392424e-24
PPTG_0461942342761462445e-24
PHYCA_12727044782791792436e-24
PHYSO_438103557212381802417e-24
PHYSO_48552442342781392438e-24
PYU1_G005324845341911412378e-24
PYU1_G005326463491911412378e-24
PYU1_G00532842331911412378e-24
PYIW_19151831912481312418e-24
PHYSO_48395542353201472449e-24
PHYCA_531163194343141362431e-23
PHYRA_7358442332871362411e-23
PITG_0494942353371802432e-23
PYAP_18711943562101742362e-23
PHYKE_600144782891832412e-23
PITG_1981815643147612295e-23
PHALS_0317644782071832326e-23
PITG_0527144782781892366e-23
PYU1_G01469042342951292361e-22
PHYSO_533903604652081392301e-22
PHYKE_391342343211372352e-22
PHYSO_340333526712841792332e-22
PYAP_18709943552351692302e-22
PHYSO_34033244782951792333e-22
PHYSO_484051571982851332323e-22
PYIW_187905687686782183e-22
PPTG_04647194343271332343e-22
PYAR_2411397811921742264e-22
PYU1_G005325943562071312265e-22
PPTG_1422144782751372297e-22
CCI4738117292111922257e-22
PHYKE_2937571983661362327e-22
PHYSO_533682604462781322298e-22
PPTG_07509718142991862281e-21
PHALS_0539242353671362311e-21
PHYKE_2809752822911342281e-21
PHYRA_7358342346301392322e-21
PHYRA_73606571983661342292e-21
PHYCA_534296526713091362272e-21
PHYCA_534473423310501392323e-21
PYU1_G005985820772001922213e-21
PPTG_0750738072991862253e-21
PHALS_03179308833721452283e-21
PYVX_14662510865401672287e-21
PYU1_G007364851643161772247e-21
PYAR_14260845342121372187e-21
PYIW_27477823991801172168e-21
PPTG_0462042333421372248e-21
PHYKE_771752856568472288e-21
PYIW_168101650732161972171e-20
PHALS_03177526712591372191e-20
PHYRA_85794726192301912172e-20
PHYRA_77971705552301912172e-20
PITG_0494742332981362193e-20
PHYRA_8615172836170742105e-20
PHYRA_8794174106157742095e-20
PHYSO_459106194342231362136e-20
PHYKE_1913732362801792166e-20
PYIR_19612831912601872156e-20
H257_1355017302661422148e-20
PYAR_206171040482541682131e-19
PYU1_G005871944962842012141e-19
PYU1_G005872161732972012141e-19
PHYCA_97965401872881952141e-19
PHYRA_7914038074241962172e-19
PHYCA_12943369712871952122e-19
PYAP_18221944962261412092e-19
PHYCA_69583463492241042092e-19
H310_0636217301971382073e-19
SDRG_165351259803131912123e-19
PPTG_03153597733141772123e-19
PYAR_14256943551991362063e-19
PYU1_G005873510322141862064e-19
PHYRA_86016727462361112075e-19
PYU1_G005323943552511322085e-19
PYIW_1552617302561832086e-19
PITG_1193697753331762107e-19
CCA1717917291851422037e-19
PYVX_20783375052761722087e-19
PHYRA_83494464352241132058e-19
PYIR_23585845342401302068e-19
PHALS_04411944962621782051e-18
PHYRA_86752732363001822072e-18
PHYRA_83500718143941432092e-18
PYAP_22462820772101942022e-18
PHALS_0539442342881362062e-18
PHYSO_255056463492691012052e-18
PYIW_254631650392161882012e-18
PPTG_18166242064451872092e-18
PYIR_2213497753001812053e-18
PHYSO_533747604512061321994e-18
PPTG_07516464352941432027e-18
PPTG_0752038142941432027e-18
PHYSO_324715696932741362018e-18
SPRG_19916161733051902028e-18
H257_112641259792821322019e-18
PYIR_24743851643571802021e-17
PYU1_G00586817292671271991e-17
H257_112651431862821311992e-17
PYAP_1871342341841261932e-17
PPTG_0315697874451782003e-17
PHYKE_574938073001791973e-17
SPRG_2216117303001921974e-17
PHYCA_1865738072951841964e-17
PPTG_0313997753201761975e-17
PHYRA_86751732351631021895e-17
PHYRA_7358169693293911965e-17
SPRG_077961259803221811965e-17
PHYRA_8075044782751741946e-17
PHYKE_839053461130971858e-17
PHYCA_98479819502761801939e-17
SDRG_0878217304501891979e-17
PYVX_16138786195591471979e-17
PHYRA_83499204334731831979e-17
PPTG_04617696934961201971e-16
PHYRA_7729317293021581931e-16
PYIW_242891643031961821882e-16
PPTG_07521450302811101922e-16
PYIR_25999861323441801932e-16
PHYSO_26284417292761571912e-16
PYU1_G00151997822651761912e-16
SPRG_199171339462411501893e-16
PYAP_24691101441145751833e-16
PHYSO_31868397763521871923e-16
PYIW_2196497752651891893e-16
SDRG_173181339462411961883e-16
PYIR_15187820772071951863e-16
SPRG_078251259983371811913e-16
SPRG_0782697753711751924e-16
SDRG_009721259983331811914e-16
SDRG_081291363312181901864e-16
PHYKE_1029517292921251894e-16
PHYRA_86241728921951041845e-16
PHALS_02044930992371301866e-16
PHYSO_488921574612962021887e-16
PHYKE_2379539132851791877e-16
PHYSO_329293510323102021887e-16
PITG_0820268381911681838e-16
PYAP_222571003612471311858e-16
PYIR_2048117292771301868e-16
PYVX_22511188573031391879e-16
H310_054321431863011801861e-15
PYAP_18226840622261371831e-15
SDRG_165341259793201781861e-15
SPRG_077991259833451341871e-15
PYU1_G00152597813121761862e-15
PYIW_242881643022011841812e-15
PYIR_24421899032131341812e-15
PHYKE_607897753171861852e-15
PYAP_18138991732681161832e-15
PYU1_G001514188574691271872e-15
PHYKE_391242332521071823e-15
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81106

Length=203
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_81106                                                           384        5e-137
PHYKE_8389                                                            347        1e-122
PPTG_17122                                                            315        1e-109
PHYCA_129425                                                          308        5e-107
PHYRA_81107                                                           302        6e-105
PHYSO_284086                                                          301        3e-104
PHYCA_511409                                                          299        1e-103
PPTG_17121                                                            295        4e-102
PHYSO_477820                                                          294        2e-101
PITG_18450                                                            292        8e-101
PHYKE_8388                                                            287        8e-99 
PHYCA_14369                                                           278        9e-95 
PHYKE_3446                                                            275        6e-94 
PHYRA_82864                                                           273        2e-93 
PPTG_10635                                                            271        2e-92 
PYVX_18176                                                            270        5e-92 
PHYRA_85631                                                           270        8e-92 
PHYSO_341599                                                          267        2e-91 
PPTG_10636                                                            270        3e-91 
PHYCA_102852                                                          267        4e-91 
PHYKE_7718                                                            268        6e-91 
PPTG_15264                                                            266        7e-91 
PPTG_17366                                                            266        7e-91 
PYVX_18174                                                            266        1e-90 
PPTG_10634                                                            264        1e-89 
PHYRA_84190                                                           264        1e-89 
PHYSO_536424                                                          259        5e-88 
PHYSO_507031                                                          259        5e-88 
PHYCA_102624                                                          259        7e-88 
PHYCA_102550                                                          260        3e-87 
PPTG_10643                                                            255        2e-85 
PHALS_00498                                                           250        3e-84 
PPTG_10048                                                            242        3e-81 
PYU1_G001741                                                          237        4e-79 
PYVX_18173                                                            240        2e-76 
PYIR_25089                                                            231        1e-75 
PYU1_G001742                                                          224        1e-73 
PHYSO_499978                                                          220        7e-73 
PHYSO_501575                                                          220        7e-73 
PHALS_03284                                                           219        2e-72 
PYU1_G001744                                                          218        1e-71 
PYIR_26626                                                            215        3e-70 
PYU1_G001740                                                          214        6e-70 
PITG_13520                                                            203        3e-66 
PHYSO_343376                                                          202        1e-65 
PPTG_08820                                                            203        4e-65 
PHYSO_254168                                                          198        4e-64 
PYU1_G001739                                                          198        6e-63 
PPTG_14255                                                            196        4e-62 
PHYCA_510817                                                          193        5e-62 
PPTG_14254                                                            191        3e-61 
PHYSO_417649                                                          186        4e-59 
PHYKE_9185                                                            189        5e-59 
PITG_10499                                                            188        4e-58 
PHYSO_341596                                                          184        1e-57 
PYAR_24096                                                            183        1e-57 
PHYCA_536934                                                          195        7e-57 
PYAP_22273                                                            182        1e-56 
PYAP_22278                                                            182        2e-56 
PYAP_22279                                                            178        1e-55 
PYIR_26546                                                            177        4e-55 
PHYCA_14368                                                           177        4e-55 
PYIW_18791                                                            174        2e-54 
PHYSO_262732                                                          172        7e-54 
PHYSO_246676                                                          165        6e-51 
PHYSO_527908                                                          160        4e-49 
PPTG_17123                                                            155        6e-47 
PHYSO_340369                                                          154        3e-46 
PYU1_G001738                                                          154        4e-46 
PHYCA_537323                                                          152        7e-46 
PHYRA_81105                                                           150        6e-45 
PITG_18452                                                            157        1e-43 
HYAP_07096                                                            145        1e-42 
PHYSO_353401                                                          142        3e-42 
PYVX_18179                                                            122        2e-34 
PYIW_18788                                                            123        1e-33 
PYIW_18792                                                            118        2e-33 
PYVX_18175                                                            114        3e-31 
PYAP_18131                                                            112        6e-30 
PHYRA_78625                                                           114        8e-29 
PHYRA_78626                                                           114        1e-28 
PYU1_G007476                                                          107        2e-28 
PHYSO_342364                                                          105        3e-27 
PYIR_16435                                                            107        3e-27 
PYIR_16444                                                            103        9e-27 
PHYRA_73582                                                           105        2e-26 
PHYRA_74651                                                           105        2e-26 
PHYKE_10578                                                           103        4e-26 
PPTG_04622                                                            101        3e-25 
PYAP_24689                                                            100        4e-25 
PHYKE_8104                                                            96.3       4e-25 
PHYRA_73607                                                           102        5e-25 
PHYCA_12942                                                           102        8e-25 
PHYCA_130365                                                          100        8e-25 
PHYRA_78689                                                           100        1e-24 
PPTG_04618                                                            100        2e-24 
PHYKE_6002                                                            97.1       3e-24 
PYIR_16443                                                            99.0       3e-24 
PITG_04948                                                            97.8       4e-24 
PPTG_04619                                                            98.6       5e-24 
PHYCA_127270                                                          98.2       6e-24 
PHYSO_438103                                                          97.4       7e-24 
PHYSO_485524                                                          98.2       8e-24 
PYU1_G005324                                                          95.9       8e-24 
PYU1_G005326                                                          95.9       8e-24 
PYU1_G005328                                                          95.9       8e-24 
PYIW_19151                                                            97.4       8e-24 
PHYSO_483955                                                          98.6       9e-24 
PHYCA_531163                                                          98.2       1e-23 
PHYRA_73584                                                           97.4       1e-23 
PITG_04949                                                            98.2       2e-23 
PYAP_18711                                                            95.5       2e-23 
PHYKE_6001                                                            97.4       2e-23 
PITG_19818                                                            92.8       5e-23 
PHALS_03176                                                           94.0       6e-23 
PITG_05271                                                            95.5       6e-23 
PYU1_G014690                                                          95.5       1e-22 
PHYSO_533903                                                          93.2       1e-22 
PHYKE_3913                                                            95.1       2e-22 
PHYSO_340333                                                          94.4       2e-22 
PYAP_18709                                                            93.2       2e-22 
PHYSO_340332                                                          94.4       3e-22 
PHYSO_484051                                                          94.0       3e-22 
PYIW_18790                                                            88.6       3e-22 
PPTG_04647                                                            94.7       3e-22 
PYAR_24113                                                            91.7       4e-22 
PYU1_G005325                                                          91.7       5e-22 
PPTG_14221                                                            92.8       7e-22 
CCI47381                                                              91.3       7e-22 
PHYKE_2937                                                            94.0       7e-22 
PHYSO_533682                                                          92.8       8e-22 
PPTG_07509                                                            92.4       1e-21 
PHALS_05392                                                           93.6       1e-21 
PHYKE_2809                                                            92.4       1e-21 
PHYRA_73583                                                           94.0       2e-21 
PHYRA_73606                                                           92.8       2e-21 
PHYCA_534296                                                          92.0       2e-21 
PHYCA_534473                                                          94.0       3e-21 
PYU1_G005985                                                          89.7       3e-21 
PPTG_07507                                                            91.3       3e-21 
PHALS_03179                                                           92.4       3e-21 
PYVX_14662                                                            92.4       7e-21 
PYU1_G007364                                                          90.9       7e-21 
PYAR_14260                                                            88.6       7e-21 
PYIW_27477                                                            87.8       8e-21 
PPTG_04620                                                            90.9       8e-21 
PHYKE_7717                                                            92.4       8e-21 
PYIW_16810                                                            88.2       1e-20 
PHALS_03177                                                           89.0       1e-20 
PHYRA_85794                                                           88.2       2e-20 
PHYRA_77971                                                           88.2       2e-20 
PITG_04947                                                            89.0       3e-20 
PHYRA_86151                                                           85.5       5e-20 
PHYRA_87941                                                           85.1       5e-20 
PHYSO_459106                                                          86.7       6e-20 
PHYKE_1913                                                            87.8       6e-20 
PYIR_19612                                                            87.4       6e-20 
H257_13550                                                            87.0       8e-20 
PYAR_20617                                                            86.7       1e-19 
PYU1_G005871                                                          87.0       1e-19 
PYU1_G005872                                                          87.0       1e-19 
PHYCA_97965                                                           87.0       1e-19 
PHYRA_79140                                                           88.2       2e-19 
PHYCA_12943                                                           86.3       2e-19 
PYAP_18221                                                            85.1       2e-19 
PHYCA_69583                                                           85.1       2e-19 
H310_06362                                                            84.3       3e-19 
SDRG_16535                                                            86.3       3e-19 
PPTG_03153                                                            86.3       3e-19 
PYAR_14256                                                            84.0       3e-19 
PYU1_G005873                                                          84.0       4e-19 
PHYRA_86016                                                           84.3       5e-19 
PYU1_G005323                                                          84.7       5e-19 
PYIW_15526                                                            84.7       6e-19 
PITG_11936                                                            85.5       7e-19 
CCA17179                                                              82.8       7e-19 
PYVX_20783                                                            84.7       7e-19 
PHYRA_83494                                                           83.6       8e-19 
PYIR_23585                                                            84.0       8e-19 
PHALS_04411                                                           83.6       1e-18 
PHYRA_86752                                                           84.3       2e-18 
PHYRA_83500                                                           85.1       2e-18 
PYAP_22462                                                            82.4       2e-18 
PHALS_05394                                                           84.0       2e-18 
PHYSO_255056                                                          83.6       2e-18 
PYIW_25463                                                            82.0       2e-18 
PPTG_18166                                                            85.1       2e-18 
PYIR_22134                                                            83.6       3e-18 
PHYSO_533747                                                          81.3       4e-18 
PPTG_07516                                                            82.4       7e-18 
PPTG_07520                                                            82.4       7e-18 
PHYSO_324715                                                          82.0       8e-18 
SPRG_19916                                                            82.4       8e-18 
H257_11264                                                            82.0       9e-18 
PYIR_24743                                                            82.4       1e-17 
PYU1_G005868                                                          81.3       1e-17 
H257_11265                                                            81.3       2e-17 
PYAP_18713                                                            79.0       2e-17 
PPTG_03156                                                            81.6       3e-17 
PHYKE_5749                                                            80.5       3e-17 
SPRG_22161                                                            80.5       4e-17 
PHYCA_18657                                                           80.1       4e-17 
PPTG_03139                                                            80.5       5e-17 
PHYRA_86751                                                           77.4       5e-17 
PHYRA_73581                                                           80.1       5e-17 
SPRG_07796                                                            80.1       5e-17 
PHYRA_80750                                                           79.3       6e-17 
PHYKE_8390                                                            75.9       8e-17 
PHYCA_98479                                                           79.0       9e-17 
SDRG_08782                                                            80.5       9e-17 
PYVX_16138                                                            80.5       9e-17 
PHYRA_83499                                                           80.5       9e-17 
PPTG_04617                                                            80.5       1e-16 
PHYRA_77293                                                           79.0       1e-16 
PYIW_24289                                                            77.0       2e-16 
PPTG_07521                                                            78.6       2e-16 
PYIR_25999                                                            79.0       2e-16 
PHYSO_262844                                                          78.2       2e-16 
PYU1_G001519                                                          78.2       2e-16 
SPRG_19917                                                            77.4       3e-16 
PYAP_24691                                                            75.1       3e-16 
PHYSO_318683                                                          78.6       3e-16 
PYIW_21964                                                            77.4       3e-16 
SDRG_17318                                                            77.0       3e-16 
PYIR_15187                                                            76.3       3e-16 
SPRG_07825                                                            78.2       3e-16 
SPRG_07826                                                            78.6       4e-16 
SDRG_00972                                                            78.2       4e-16 
SDRG_08129                                                            76.3       4e-16 
PHYKE_10295                                                           77.4       4e-16 
PHYRA_86241                                                           75.5       5e-16 
PHALS_02044                                                           76.3       6e-16 
PHYSO_488921                                                          77.0       7e-16 
PHYKE_2379                                                            76.6       7e-16 
PHYSO_329293                                                          77.0       7e-16 
PITG_08202                                                            75.1       8e-16 
PYAP_22257                                                            75.9       8e-16 
PYIR_20481                                                            76.3       8e-16 
PYVX_22511                                                            76.6       9e-16 
H310_05432                                                            76.3       1e-15 
PYAP_18226                                                            75.1       1e-15 
SDRG_16534                                                            76.3       1e-15 
SPRG_07799                                                            76.6       1e-15 
PYU1_G001525                                                          76.3       2e-15 
PYIW_24288                                                            74.3       2e-15 
PYIR_24421                                                            74.3       2e-15 
PHYKE_6078                                                            75.9       2e-15 
PYAP_18138                                                            75.1       2e-15 
PYU1_G001514                                                          76.6       2e-15 
PHYKE_3912                                                            74.7       3e-15 
PPTG_10073                                                            73.2       3e-15 
SDRG_08137                                                            74.7       4e-15 
PPTG_03160                                                            75.5       4e-15 
PPTG_01148                                                            74.7       4e-15 
PYVX_20789                                                            74.7       5e-15 
SDRG_07565                                                            74.3       5e-15 
PPTG_20376                                                            72.4       6e-15 
PHYKE_7445                                                            74.7       7e-15 
SDRG_00948                                                            73.9       1e-14 
PHYSO_524101                                                          73.6       1e-14 
PHYCA_112615                                                          72.0       1e-14 
SPRG_07797                                                            73.6       1e-14 
PHYRA_78176                                                           73.2       2e-14 
PYVX_24563                                                            72.4       2e-14 
PHYRA_78172                                                           73.6       2e-14 
SPRG_07627                                                            73.9       2e-14 
PHYCA_19598                                                           73.6       2e-14 
PITG_01966                                                            73.2       2e-14 
PYIW_19601                                                            72.0       2e-14 
PYU1_G005867                                                          70.9       3e-14 
PHYRA_84947                                                           72.0       3e-14 
SDRG_15426                                                            73.2       3e-14 
PYAP_18584                                                            70.9       4e-14 
PPTG_03138                                                            72.0       4e-14 
PYVX_21643                                                            71.6       4e-14 
PPTG_10186                                                            71.6       5e-14 
PHYCA_19611                                                           72.8       5e-14 
PYVX_21438                                                            71.6       5e-14 
PYAR_25093                                                            70.1       5e-14 
PHYSO_246481                                                          72.0       5e-14 
PYIW_18065                                                            72.0       5e-14 
PHYCA_123316                                                          71.6       6e-14 
SDRG_17317                                                            68.2       6e-14 
PYAR_24818                                                            70.1       6e-14 
PYIR_17978                                                            70.9       7e-14 
PHALS_08575                                                           71.6       7e-14 
PYIR_14463                                                            72.0       7e-14 
PHYCA_132255                                                          68.2       8e-14 
PHYCA_103479                                                          71.2       8e-14 
PHYRA_78177                                                           71.2       1e-13 
PYIR_20483                                                            70.9       1e-13 
PHYCA_19612                                                           71.6       1e-13 
PPTG_03140                                                            71.2       1e-13 
PHYCA_122958                                                          70.5       1e-13 
PHYRA_77292                                                           69.3       1e-13 
SPRG_07795                                                            70.9       1e-13 
PHYRA_84732                                                           70.1       1e-13 
H257_11271                                                            71.2       1e-13 
PHALS_10635                                                           70.5       2e-13 
PYVX_19277                                                            70.5       2e-13 
PHYSO_476077                                                          69.7       2e-13 
PHYSO_472009                                                          69.7       2e-13 
HYAP_01683                                                            70.5       2e-13 
PYU1_G005866                                                          68.6       2e-13 
PITG_11937                                                            70.1       2e-13 
PHYRA_78175                                                           70.5       2e-13 
PHYRA_78169                                                           70.9       2e-13 
PYIW_18794                                                            69.3       2e-13 
PYVX_22510                                                            70.9       2e-13 
PHYRA_93650                                                           69.3       2e-13 
PYAP_19707                                                            68.9       3e-13 
PPTG_04803                                                            69.3       3e-13 
PHYKE_6066                                                            69.7       3e-13 
PHYCA_120062                                                          68.6       3e-13 
PYAP_23672                                                            69.3       3e-13 
PHYKE_6077                                                            69.7       3e-13 
PYIW_24287                                                            69.7       3e-13 
PHYKE_2539                                                            69.3       3e-13 
PYU1_G001528                                                          68.9       4e-13 
PHYCA_18729                                                           69.7       5e-13 
PYU1_G005869                                                          68.6       5e-13 
PYU1_G001527                                                          68.9       5e-13 
PYU1_G001523                                                          68.9       5e-13 
PHYSO_256017                                                          66.2       5e-13 
PYAR_16493                                                            68.2       6e-13 
PYIW_25573                                                            68.6       6e-13 
PHYKE_6079                                                            68.9       6e-13 
PYAR_21940                                                            68.2       7e-13 
PYU1_G007254                                                          66.6       8e-13 
PYU1_G001524                                                          68.2       9e-13 
HYAP_11923                                                            68.9       1e-12 
PHYSO_374518                                                          64.7       1e-12 
PYVX_21297                                                            67.8       1e-12 
PHYRA_78161                                                           68.6       1e-12 
PHYCA_15126                                                           68.6       1e-12 
PYU1_G001526                                                          68.2       1e-12 
PYAP_16351                                                            67.4       1e-12 
PYAP_16994                                                            67.4       1e-12 
PHYRA_80632                                                           67.8       1e-12 
PHYKE_2454                                                            68.2       1e-12 
PYIR_25571                                                            67.4       2e-12 
PHALS_05110                                                           66.2       2e-12 
PHYCA_12944                                                           65.5       2e-12 
PYAR_18165                                                            67.0       2e-12 
PHYSO_255975                                                          65.9       2e-12 
H310_05433                                                            67.8       2e-12 
PYAR_21271                                                            66.6       2e-12 
PHYCA_14560                                                           67.4       2e-12 
PITG_20631                                                            67.0       2e-12 
PHYKE_10296                                                           67.8       2e-12 
PITG_20312                                                            66.6       2e-12 
PPTG_01153                                                            67.0       3e-12 
PPTG_03143                                                            67.4       3e-12 
PPTG_03148                                                            66.6       3e-12 
PHYKE_6076                                                            66.2       3e-12 
PYIW_16208                                                            66.2       3e-12 
PYU1_G001520                                                          67.0       3e-12 
HYAP_14170                                                            66.2       4e-12 
SDRG_17448                                                            66.2       4e-12 
PHYCA_562062                                                          65.9       4e-12 
PHYCA_10471                                                           66.6       4e-12 
PHALS_01293                                                           66.6       4e-12 
PHALS_02041                                                           65.9       4e-12 
PHYCA_19608                                                           66.2       5e-12 
PYIR_22549                                                            65.9       5e-12 
H257_11258                                                            66.6       5e-12 
PHYSO_525076                                                          66.2       6e-12 
PYVX_22508                                                            65.9       6e-12 
PITG_11942                                                            65.9       6e-12 
PHYRA_78162                                                           66.6       6e-12 
PHYSO_426658                                                          64.7       8e-12 
PHYSO_374025                                                          65.5       8e-12 
PYIR_25334                                                            65.5       8e-12 
PPTG_04801                                                            65.1       8e-12 
PYAP_16338                                                            65.5       8e-12 
SPRG_04679                                                            64.7       8e-12 
PYAR_15391                                                            63.5       1e-11 
PHYSO_375794                                                          62.4       1e-11 
PYU1_G007242                                                          64.7       1e-11 
PYVX_16673                                                            65.9       1e-11 
PYIR_23689                                                            63.9       1e-11 
PHYKE_9023                                                            64.7       1e-11 
PHYKE_7443                                                            65.1       2e-11 
PYU1_G006405                                                          64.7       2e-11 
PHYRA_77290                                                           64.7       2e-11 
PHYRA_78164                                                           64.3       2e-11 
PYVX_21174                                                            60.5       2e-11 
PPTG_18176                                                            63.9       2e-11 
PPTG_06249                                                            63.9       3e-11 
PITG_11951                                                            62.0       3e-11 
PYAR_17166                                                            60.8       3e-11 
PPTG_09880                                                            62.8       3e-11 
PHYRA_78174                                                           63.5       4e-11 
PHYSO_488139                                                          63.2       4e-11 
PHYSO_337515                                                          63.5       5e-11 
PHYCA_6388                                                            63.2       5e-11 
PPTG_07511                                                            61.6       5e-11 
PYIR_16375                                                            62.8       6e-11 
PYIR_20482                                                            61.2       6e-11 
PYAP_20077                                                            62.4       7e-11 
PHYCA_538650                                                          62.8       7e-11 
PHYKE_6069                                                            62.8       8e-11 
PYU1_G003057                                                          61.6       1e-10 
PHYRA_86201                                                           62.4       1e-10 
PHYRA_95184                                                           63.2       1e-10 
PPTG_01147                                                            62.0       1e-10 
PITG_21641                                                            62.4       1e-10 
PYAP_14265                                                            62.0       1e-10 
PPTG_03144                                                            62.0       2e-10 
PYAR_17163                                                            58.9       2e-10 
PYAP_23455                                                            62.0       2e-10 
PYIW_14247                                                            61.2       2e-10 
PPTG_03161                                                            62.0       2e-10 
PHYSO_257305                                                          60.5       2e-10 
PHYRA_80631                                                           61.6       2e-10 
PPTG_03145                                                            61.6       2e-10 
PYIR_22133                                                            62.0       2e-10 
PYU1_G001517                                                          61.2       3e-10 
PPTG_01152                                                            60.8       3e-10 
PPTG_06256                                                            61.2       3e-10 
PYIR_24935                                                            60.8       3e-10 
PHYCA_19606                                                           61.2       3e-10 
PYVX_24274                                                            60.1       4e-10 
PYU1_G006672                                                          56.2       4e-10 
PHYKE_9024                                                            60.5       4e-10 
PPTG_06253                                                            60.5       5e-10 
PHYSO_318693                                                          60.8       6e-10 
PYAP_23673                                                            60.1       7e-10 
PYIW_23030                                                            59.3       8e-10 
PHYSO_454780                                                          58.5       9e-10 
PHYCA_15125                                                           59.7       9e-10 
PITG_08895                                                            58.5       9e-10 
PYAP_16347                                                            58.5       1e-09 
PITG_08892                                                            59.7       1e-09 
PYIR_26867                                                            57.8       1e-09 
PYIR_23622                                                            59.3       1e-09 
PHYCA_15124                                                           59.7       1e-09 
PITG_11944                                                            59.3       1e-09 
PYIW_15528                                                            59.3       1e-09 
PYAP_19712                                                            59.3       1e-09 
PYVX_22512                                                            58.5       1e-09 
PHYCA_552912                                                          59.7       1e-09 
PYIR_24867                                                            59.3       1e-09 
PHYRA_78167                                                           58.9       2e-09 
PYAR_22058                                                            57.8       2e-09 
PHYCA_14559                                                           58.2       2e-09 
PHYRA_78165                                                           58.5       2e-09 
PHYCA_558591                                                          55.8       2e-09 
PYIR_22634                                                            58.2       2e-09 
PYVX_23997                                                            57.4       2e-09 
H310_05438                                                            58.5       3e-09 
PYAR_14261                                                            56.2       3e-09 
PYU1_G001518                                                          58.2       3e-09 
PHALS_02037                                                           58.2       4e-09 
PHALS_01460                                                           57.8       5e-09 
PYAP_24338                                                            57.4       5e-09 
PHYRA_77291                                                           57.0       6e-09 
PHYSO_525490                                                          57.4       7e-09 
PPTG_22744                                                            55.5       7e-09 
PYAP_25026                                                            56.6       8e-09 
PHYCA_10470                                                           57.0       8e-09 
PITG_01969                                                            56.6       8e-09 
PYVX_21644                                                            55.8       9e-09 
PHYKE_7446                                                            57.0       9e-09 
PYIW_17867                                                            57.0       1e-08 
PYIW_20715                                                            56.6       1e-08 
PYIR_20304                                                            55.5       1e-08 
PYAP_16337                                                            56.2       1e-08 
H257_11306                                                            56.6       1e-08 
PITG_04404                                                            55.8       1e-08 
PYIW_21963                                                            56.6       1e-08 
PYU1_G001475                                                          55.8       2e-08 
PYU1_G006403                                                          55.5       2e-08 
HYAP_01682                                                            55.8       2e-08 
PYU1_G006404                                                          55.5       3e-08 
PYAR_23252                                                            54.7       3e-08 
PHYRA_78168                                                           55.5       3e-08 
PYIR_22136                                                            55.5       3e-08 
PYAR_25949                                                            53.9       4e-08 
PHALS_02296                                                           54.7       4e-08 
PHYCA_123476                                                          55.1       4e-08 
PYU1_G001516                                                          54.7       5e-08 
PHYKE_9025                                                            55.1       5e-08 
PHALS_05395                                                           53.5       5e-08 
PHYSO_261686                                                          54.3       6e-08 
PYAR_15390                                                            53.5       6e-08 
PITG_11957                                                            54.7       6e-08 
PHYCA_97699                                                           54.3       6e-08 
PYIW_26655                                                            54.3       6e-08 
PYAP_20161                                                            53.9       7e-08 
PYU1_G007250                                                          53.1       7e-08 
PHALS_02295                                                           53.9       8e-08 
PYVX_24774                                                            52.8       1e-07 
PPTG_03147                                                            53.5       1e-07 
PYAP_20456                                                            53.9       1e-07 
PHYSO_339832                                                          53.5       1e-07 
PYU1_G005878                                                          50.1       1e-07 
PHALS_06480                                                           52.0       1e-07 
PYAP_18983                                                            52.4       2e-07 
PYU1_G013346                                                          50.1       2e-07 

>PHYRA_81106
Length=202

 Score = 384 bits (985),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 202/202 (100%), Positives = 202/202 (100%), Gaps = 0/202 (0%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAPSLLSSLSVAAALSSAAFLAPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET
Sbjct  1    MAPSLLSSLSVAAALSSAAFLAPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
            VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH
Sbjct  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
            DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY
Sbjct  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180

Query  181  KACVPLSASARRLTNESAVIDF  202
            KACVPLSASARRLTNESAVIDF
Sbjct  181  KACVPLSASARRLTNESAVIDF  202

>PHYKE_8389
Length=204

 Score = 347 bits (891),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 169/183 (92%), Gaps = 3/183 (2%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQVVLLPAPTYTTD KDTKYAPLAFLENQGFETV DFNAWRR+NGYKTLRAFMDG
Sbjct  22   PTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG  81

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV DGADY+CGFTNADA PQAIP GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA
Sbjct  82   AKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199
            ISGKDYTIDYSSCTGTCTL WYW+GVR+LKN YSWQVYKACVPLSASARRL    NESA 
Sbjct  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAA  201

Query  200  IDF  202
            I+F
Sbjct  202  IEF  204

>PPTG_17122
Length=204

 Score = 315 bits (806),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 178/205 (87%), Gaps = 4/205 (2%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAPSLLSSLSVAA LSSAA LAP ++AHQVVLLPAPTYTTD+KDTKYAPLAFLENQG+ET
Sbjct  1    MAPSLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
            V DFN WRR+NGYKTLR FMD AKYTV DGADYYCGFTN +A PQ IPDG  MRSTGYTH
Sbjct  61   VEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGT-MRSTGYTH  119

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
            DGPCEVWLDT RVL  DNCHE ISGK Y +DYSSCTGTCTL WYW+GVRYLKNAYSWQ+Y
Sbjct  120  DGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179

Query  181  KACVPLSASARRL---TNESAVIDF  202
            KAC+PLSASARRL    NES  ++ 
Sbjct  180  KACIPLSASARRLESAANESVALEV  204

>PHYCA_129425
Length=204

 Score = 308 bits (788),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 177/205 (86%), Gaps = 4/205 (2%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAPSLLSSL+VAAALSSAA LAP  DAHQVVLLPAPTYTTD+KDTKYAPLAFLE+QGF+T
Sbjct  1    MAPSLLSSLTVAAALSSAALLAPTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
            V DFN WRRSNGYKTLRAFMDGAKYTV DGADYYCGFTNA A PQ IPDG  MRSTGYTH
Sbjct  61   VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTH  119

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
            DGPCEVWLD+TRVL  DNCHE   GK Y +DYSSC G+C L WYW+G R+LKN +SWQVY
Sbjct  120  DGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179

Query  181  KACVPLSASARRL---TNESAVIDF  202
            KAC+PLS+SARRL    NESA I+F
Sbjct  180  KACIPLSSSARRLEGAANESAAIEF  204

>PHYRA_81107
Length=202

 Score = 302 bits (774),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 155/182 (85%), Gaps = 3/182 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQVVLLPAPTYTTD K TKYAPLAFLE+QGF T  DF AWR  NGY +LRAF DGA
Sbjct  21   LADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGA  80

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
             YTV+DGAD+ CGFT+ +   QAIPDGNAMRSTGYTHDGPCEVWLD T V+ +DNCHE I
Sbjct  81   SYTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVI  140

Query  144  SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVI  200
            SGKDYTIDYSSCT TCTL+W+WMGVRYL NAYSWQVYKACVPLSASARRL    NESA++
Sbjct  141  SGKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASARRLEGAANESAIL  200

Query  201  DF  202
            DF
Sbjct  201  DF  202

>PHYSO_284086
Length=204

 Score = 301 bits (770),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 152/183 (83%), Gaps = 4/183 (2%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQVVLLPAPTYTTD K TKYAPLAFLENQG+ETV DFNAWRR  GYKTLRAFMDG
Sbjct  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            A YTVADGADYYCGFT+     Q IPDG  MRSTGYTHDGPCEVWLDTTRVL  DNCHE 
Sbjct  83   ASYTVADGADYYCGFTDIKGVAQPIPDGT-MRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199
             SGK Y +DYSSC G+CTL WYW+GVR+LKN YSWQVYKACVPLS SARRL    NESA 
Sbjct  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESAA  201

Query  200  IDF  202
            ++F
Sbjct  202  LEF  204

>PHYCA_511409
Length=204

 Score = 299 bits (766),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 155/182 (85%), Gaps = 3/182 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQVVLLPAPTYTTD K TKYAPLAFLE+QGF T  DF AWR+ NGY +LRAF DGA
Sbjct  23   LADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGA  82

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
             YTV+DGAD+ CGFTN +   QAIPD NAMRSTGYTHDGPCEVWLD T V+ +DNCHEAI
Sbjct  83   SYTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAI  142

Query  144  SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVI  200
            SGKDYTIDYSSCT TCTL+W+W+GVRYLKN YSWQ+YKACVPLSASARRL    NESA+ 
Sbjct  143  SGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIA  202

Query  201  DF  202
            DF
Sbjct  203  DF  204

>PPTG_17121
Length=202

 Score = 295 bits (756),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 153/182 (84%), Gaps = 3/182 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + +AHQVVLL APTYTTD KDTKYAPLAFLE+QGF T  DF AWR+ NGY +LRAF DGA
Sbjct  21   LANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGA  80

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
             YTV+DGAD  CGFTN +   Q IPDGNAMRSTGYTHDGPCEVWLD T V+ +DNCHEAI
Sbjct  81   SYTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAI  140

Query  144  SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVI  200
            SGK YTIDYSSCT TCTL+W+W+GVRYLKN YSWQ+YKACVPLS SARRL    NESA+I
Sbjct  141  SGKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAII  200

Query  201  DF  202
            DF
Sbjct  201  DF  202

>PHYSO_477820
Length=202

 Score = 294 bits (752),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 152/182 (84%), Gaps = 3/182 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            +  AHQVVLLPAPTYTTD K TKYAPLAFLE+QGF T  DF AWR  NGY +LRAF DGA
Sbjct  21   LAGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGA  80

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
             YTVADGAD+ CGFTN +   Q IPD NAMRSTGYTHDGPCEVWLD T V+ +DNCHE+I
Sbjct  81   SYTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESI  140

Query  144  SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVI  200
            SGKDYTIDYSSCT TCTL+W+W+GVRYLKN YSWQ+YKACVPLS SARRL   TNESA +
Sbjct  141  SGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGATNESARL  200

Query  201  DF  202
            DF
Sbjct  201  DF  202

>PITG_18450
Length=203

 Score = 292 bits (748),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 167/204 (82%), Gaps = 7/204 (3%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAPS+ SSL VAA LSS   LAP   AHQVVLLP+PTYTTD KDTKYAPL FLE QG+ET
Sbjct  1    MAPSVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYET  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
            V DFN WRR+NGYKTLR FM+   YTVADGADYYCGFTN +A PQ  PDG AMRSTGYTH
Sbjct  61   VEDFNGWRRNNGYKTLRDFME---YTVADGADYYCGFTNVNAAPQPNPDG-AMRSTGYTH  116

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
            DGPCEVWLD+TRVL  DNCHE I GK Y +DYSSC GTCTL WYW+GVR+LKNAYSWQ+Y
Sbjct  117  DGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIY  176

Query  181  KACVPLSASARRL---TNESAVID  201
            KAC+PLSASARRL    N+S V D
Sbjct  177  KACIPLSASARRLEVAANKSVVFD  200

>PHYKE_8388
Length=205

 Score = 287 bits (734),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 3/182 (2%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P+ +AHQVVLLP+PTYTTD K TKYAPLAFLE+QGF T  DF AWR  NGY +LRAF D 
Sbjct  23   PIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDD  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            A YTV+DGAD+ CGFT+ +   Q IPD NAMRSTGYTHDGPCEVWLD T V+ ++NCH++
Sbjct  83   ASYTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDS  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199
            ISGKDYTIDYSSCT TCTL+W+WMGVRYLKN YSWQVYKACVPLSASARRL    NES +
Sbjct  143  ISGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASARRLEGAVNESVI  202

Query  200  ID  201
             +
Sbjct  203  FE  204

>PHYCA_14369
Length=248

 Score = 278 bits (712),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 137/168 (82%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLLP P +TT+ KDTKY PLAFLENQGF+T  DF AWR  NGYK+LR FMD 
Sbjct  23   PTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV +GAD+ CGFT+   TPQ IP GNAMRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  83   AKYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKDYT+DYSSC GTCTL WYW+GVR+LKNAYSWQVYKAC+PL+ S 
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  190

>PHYKE_3446
Length=199

 Score = 275 bits (702),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 156/190 (82%), Gaps = 0/190 (0%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAP L S  +V AALS AA +AP+TDAHQ+VLLP P + TDSK+ KY PLAFLENQGF T
Sbjct  1    MAPPLASVFTVVAALSGAAVIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFAT  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
              D NAWRR NGYKTLRAFMD AKY V +GADY+CG+T+ + T Q IP+G AMRSTGYTH
Sbjct  61   QEDANAWRRDNGYKTLRAFMDMAKYQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTH  120

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
            DGPCEVW+D TRVL   NCHE I+GKDYTIDYS+C GTC L WYW+GVR+LKN+YSWQVY
Sbjct  121  DGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVY  180

Query  181  KACVPLSASA  190
            KAC+PL++ +
Sbjct  181  KACIPLTSGS  190

>PHYRA_82864
Length=193

 Score = 273 bits (697),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 139/169 (82%), Gaps = 1/169 (1%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQVVLLP P +TTD+KDTKY PLAFLE QGF T GDFNAWRR NGYKTLR FMD 
Sbjct  23   PTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV +GADY+CG+T+ + TPQ IP GN MRSTGYTHDGPCEVWLD TRVL  DNCHE 
Sbjct  83   AKYTVTEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPCEVWLDNTRVLQGDNCHEQ  141

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASAR  191
               KDY IDYSSC GTCTLHWYW+GVR+LKN+YSWQVYK C+ L++  R
Sbjct  142  FPDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQR  190

>PPTG_10635
Length=199

 Score = 271 bits (692),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 136/168 (81%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            PM DAHQ+VLLP P +TT+ KDTKY PLAFLENQGF+T  DF +WR  NGYK+LR FMD 
Sbjct  6    PMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR  65

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP GNAMRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  66   AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKDYT+DYSSC G+CTL WYW+GVR+LKN+YSWQVYKAC+PL+  A
Sbjct  126  FPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGA  173

>PYVX_18176
Length=201

 Score = 270 bits (690),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 144/181 (80%), Gaps = 4/181 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQ V+LPAPT+ TD KD  YAPLAFLE+QGF T  DF AWR  NGY +LRAFMDGA
Sbjct  21   VADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGA  80

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
             YTV DGAD  CG+TN D T QA+PDG  MRSTGYTH GPCEVWLD T VL +DNCH++I
Sbjct  81   SYTVTDGADQTCGWTNKDGTAQALPDG-VMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSI  139

Query  144  SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVI  200
            SGK Y +DYSSCT TCTL+W+WMGVRYL N YSWQVYK CVPLSASARRL    N SAV+
Sbjct  140  SGKTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAVV  199

Query  201  D  201
            D
Sbjct  200  D  200

>PHYRA_85631
Length=228

 Score = 270 bits (691),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 139/176 (79%), Gaps = 2/176 (1%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQVVLLP P +TTD KDTKY PLAFLEN+GF T  DF +WR  NGYK+LR FMD 
Sbjct  23   PTADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY VADGAD+ CGFT+   TPQ IP GNAMRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  83   AKYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLTNESA  198
              GKDYT+DYSSC GTCTL WYW+G+R+LKN YSWQVYK C+PL+  +   T+ESA
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSG--TSESA  196

>PHYSO_341599
Length=185

 Score = 267 bits (683),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 136/168 (81%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLLP P +TT+ K+TKY PLAFLENQGF+T  DF AWR+ NGYK+LR FMD 
Sbjct  6    PTADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR  65

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP+GN MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKDYT+DYSSC GTCTL WYW+GVR+LKN YSWQVYKAC+PL++ +
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGS  173

>PPTG_10636
Length=246

 Score = 270 bits (689),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 134/169 (79%), Gaps = 0/169 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            PM DAHQ+VLLP P +TT+ KDTKY PLAFLENQGF+T  DF +WR  N YK+LR FMD 
Sbjct  23   PMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP GNAMRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  83   AKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASAR  191
              GKDYT+DYSSC GTCTL WYW+G+R+LKN YSWQVYKAC+PLS S  
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGE  191

>PHYCA_102852
Length=195

 Score = 267 bits (683),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 137/171 (80%), Gaps = 0/171 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLLP P +TT+ KDTKY PLAFLEN+GF T  DF AWR  NGYK+LR FMD 
Sbjct  23   PTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V +GAD+ CGFT+ + TPQ IP GNAMRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  83   AKYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
              GK YTIDYSSC GTCTL+W+W+GVR+LKN YSWQVYKAC+PL+A  R L
Sbjct  143  FPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTAGQRNL  193

>PHYKE_7718
Length=220

 Score = 268 bits (684),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 137/168 (82%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P+ DAHQ+VLLP PT+TTD KDTKY PLAFLE +GF    DF AWR  NGYK+LR FMD 
Sbjct  27   PIADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN  86

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY+V  GAD  CGFT+ + TPQ IP+GNAMRSTGYTHDGPCEVW+D T  + +DNCHEA
Sbjct  87   AKYSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEA  146

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKDYTIDYS+C GTCTL WYW+GVR+LKN+YSWQVYKAC+PL+ S 
Sbjct  147  FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSG  194

>PPTG_15264
Length=194

 Score = 266 bits (681),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 138/171 (81%), Gaps = 2/171 (1%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK  84
            TDAHQ+VL P P +TTD+KD KY PLAFLE QGF+T  DFNAWRR NGYKTLR FMD AK
Sbjct  22   TDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAK  81

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            YTV +GADY+CG+T+   TPQ IP G AMRSTGYTHDGPCEVWLD  RVL   NCHE+I 
Sbjct  82   YTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIP  141

Query  145  GKDYTIDYSSC--TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
            GKDYTIDYSSC   G C L WYW+GVR+LKN+YSWQVYK C+PL+ + +RL
Sbjct  142  GKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRL  192

>PPTG_17366
Length=194

 Score = 266 bits (681),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 138/171 (81%), Gaps = 2/171 (1%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK  84
            TDAHQ+VL P P +TTD+KD KY PLAFLE QGF+T  DFNAWRR NGYKTLR FMD AK
Sbjct  22   TDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAK  81

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            YTV +GADY+CG+T+   TPQ IP G AMRSTGYTHDGPCEVWLD  RVL   NCHE+I 
Sbjct  82   YTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIP  141

Query  145  GKDYTIDYSSC--TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
            GKDYTIDYSSC   G C L WYW+GVR+LKN+YSWQVYK C+PL+ + +RL
Sbjct  142  GKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRL  192

>PYVX_18174
Length=204

 Score = 266 bits (680),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 143/182 (79%), Gaps = 6/182 (3%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQ V+LP PT+TT  +D  YAPLAFLE+QGFETV DFNAWRRSNGYKTLRAFMD A
Sbjct  24   VADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQA  83

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
             YTV DGAD  CGFT  D TPQ IP     RSTGYTHDGPCE+WLD+TRV  +DNCHEAI
Sbjct  84   SYTVTDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAI  141

Query  144  SGKDYTIDYS-SCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199
            SGKD  IDYS    GTCTL+WYWMGVRYL NAYSWQVYK CVPLS SAR L    N SA+
Sbjct  142  SGKDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARMLEGAANASAI  201

Query  200  ID  201
            I+
Sbjct  202  IE  203

>PPTG_10634
Length=208

 Score = 264 bits (675),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 133/162 (82%), Gaps = 0/162 (0%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK  84
             DAHQ+VLLP P +TT+ K+TKY PLAFLEN+GF T  DF AWR+ NGYK+LR F+D AK
Sbjct  25   VDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK  84

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            Y V DGAD+ CGFT+   TPQ IP GNAMRSTGYTHDGPCEVWLD T VL  DNCHE   
Sbjct  85   YPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFP  144

Query  145  GKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            GKDYT+DYSSC GTCTL+WYW+GVR+LKN YSWQVYKAC+PL
Sbjct  145  GKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PHYRA_84190
Length=206

 Score = 264 bits (675),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 137/176 (78%), Gaps = 2/176 (1%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLLP P +TTD KDTKY PLAFLEN+GF T  DF AWR  NGYK+LR FMD 
Sbjct  6    PTADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN  65

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY+V +GAD+ CGFT+   TPQ IP  NAMRSTGYTHDGPCEVWLD T VL  +NCHE 
Sbjct  66   AKYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  125

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLTNESA  198
              GKDYT+DYSSC GTCTL WYWMGVR+LK  YSWQVYK C+PL+  +   T+ESA
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSG--TSESA  179

>PHYSO_536424
Length=197

 Score = 259 bits (663),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P    HQ+VLLP P +TT+ K+TKY PLAFLEN+GF T  DF AWR+ NGYK+LR FMD 
Sbjct  18   PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP+GN MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  78   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKDYT+DYSSC GTCTL WYW+GVR+LKN YSWQVYKAC+PL++ +
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGS  185

>PHYSO_507031
Length=197

 Score = 259 bits (663),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 133/168 (79%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P    HQ+VLLP P +TT+ K+TKY PLAFLEN+GF T  DF AWR+ NGYK+LR FMD 
Sbjct  18   PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP+GN MRSTGYTHDGPCEVWLD T VL  DNCHE 
Sbjct  78   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKDYT+DYSSC GTCTL WYW+GVR+LKN YSWQVYKAC+PL++ +
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGS  185

>PHYCA_102624
Length=195

 Score = 259 bits (662),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 135/173 (78%), Gaps = 0/173 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P   AHQVVLLP P + TD++DT++ PL FLE  GF+T  DF AWR+ NGYK+LR FMD 
Sbjct  23   PTATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V++GAD+ CGFT+ + TPQ IP GNAMRSTGYTHDGPCEVW+D T V+  DNCHE 
Sbjct  83   AKYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLTN  195
              GKDYTIDYS C G CTL+WYW+GVR+LKN YSWQVYK C+PL++  R L +
Sbjct  143  FPGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQRSLRD  195

>PHYCA_102550
Length=268

 Score = 260 bits (665),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P   AHQVVLLPAP + TD++DT++ PLAFLE+QGF+T  DF AWR  NGYK+LR FMD 
Sbjct  23   PTATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV +GAD+ CG+T+ + TPQ IP GNAMRSTGYTHDGPCEVW+D T V+  DNCHE 
Sbjct  83   AKYTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GK YTIDYS C G CTL+WYW+GVR+LKN+YSWQVYK C+PL+ S 
Sbjct  143  FPGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PPTG_10643
Length=250

 Score = 255 bits (651),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 128/168 (76%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P TDAHQ+VLLP P +TT+ KDTKY PLAFLENQGF+   DF AW + NGYK+LR FMD 
Sbjct  23   PTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFTN   TPQ IP    MRSTGYTHDGPCEV+LD T VL  DNCHE 
Sbjct  83   AKYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GKD  IDYSSC GTCTL WYW+G+R+LKNAYSWQVYK C+PL  S 
Sbjct  143  FPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSG  190

>PHALS_00498
Length=199

 Score = 250 bits (639),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 129/169 (76%), Gaps = 0/169 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P   AHQ+VLLP P + T+ KDT+Y PLAFLENQ F+T GD  A+ + N +KTLR FMD 
Sbjct  23   PNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDN  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV  GAD  CGFT+ + TPQ IP  NAMRSTGYTHDGPCEVWL+ TRVL+  NCHE 
Sbjct  83   AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEK  142

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASAR  191
              GKDYTIDYSSC   C L WYW+GVR+LK  YSWQVYKAC+PLS SA+
Sbjct  143  FPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  191

>PPTG_10048
Length=190

 Score = 242 bits (618),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 134/168 (80%), Gaps = 0/168 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P+T+AHQVVL PAP + TD++DT++ PLAFLE+QGF+T  DF +WR  NGYKTLR FM+ 
Sbjct  20   PLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH  79

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV +GAD+ CG+TN   TPQ IP G  MRSTGYTH+GPCE+W+  T+V   DNCH +
Sbjct  80   AKYTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVS  139

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            + GK+Y IDYS C G C L+WYW+GVR+LKN+YSWQVYK C+PL+ ++
Sbjct  140  LPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PYU1_G001741
Length=199

 Score = 237 bits (604),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 3/169 (2%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-  84
            DAHQ V+LPAPT+T  ++  ++ PLAFLENQGFET  DFNA+ ++ GYKTLRAFMD  K 
Sbjct  25   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKA  84

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            YTVA GAD+ CG+T  D T Q+IP G  +RSTGYTHDGPCEVWLD+TRV+  +NCH   +
Sbjct  85   YTVASGADFECGWTKLDGTRQSIPAGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFT  143

Query  145  GKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
            G  +TIDYSSC G+CTL WYWMG+R+LK  YSWQVYK CVP+  S+RRL
Sbjct  144  GTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPI-GSSRRL  191

>PYVX_18173
Length=500

 Score = 240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 129/166 (78%), Gaps = 2/166 (1%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P   AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T  DF  +  +NG+ +LRAFMD 
Sbjct  230  PQAMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD  289

Query  83   -AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHE  141
             + Y+V   AD+ CGFT+ DA PQ IPDG  MRSTGYTHDGPCEVWLD TRVL HDNCHE
Sbjct  290  DSLYSVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHE  348

Query  142  AISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             ISGK Y +DYS+C G+CTL+WYW+GVRYLK  YSWQVYKACVP+S
Sbjct  349  VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 94/163 (58%), Gaps = 1/163 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYTV  87
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147
             +   + CG T  +   Q IP   +  ++GYT DGPCE+W+D T  L   NCH       
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            +TIDYS C  +C + W+W+G++Y    YSWQV+K C+ LSASA
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

>PYIR_25089
Length=262

 Score = 231 bits (588),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 124/165 (75%), Gaps = 1/165 (1%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMD-GAK  84
            DAHQ V+LPAPT+T  ++  ++ PLAFLENQGF+T  DF+A+ ++ GYKTLRAFMD  + 
Sbjct  26   DAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSA  85

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            Y VADGAD+ CG+T    TPQ IP  + +RSTGYTHDGPCEVWLD TRVL   NCH    
Sbjct  86   YKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFP  145

Query  145  GKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
            G  + IDYSSC G+C L WYWMG+R+LK  YSWQVYK CVP++ S
Sbjct  146  GTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS  190

>PYU1_G001742
Length=213

 Score = 224 bits (570),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 127/173 (73%), Gaps = 4/173 (2%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-  84
            DAHQ V+LPAPT+T  ++  ++ PLAFLENQG++T  DFNA+ ++ GYKTLRAFMD  K 
Sbjct  26   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKA  85

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            Y VA GAD+ CG+T  D   Q IP G  +RSTGYTHDGPCEVWLD+TRV+  +NCH    
Sbjct  86   YKVAAGADFQCGWTKLDGKRQPIPAGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFP  144

Query  145  GKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLTNES  197
            G  + IDYSSC G+CTL WYWMG+R+LK  YSWQVYK CVP+    +RL  E 
Sbjct  145  GTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI--GGKRLLEEQ  195

>PHYSO_499978
Length=174

 Score = 220 bits (561),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 128/165 (78%), Gaps = 0/165 (0%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAPSL+S+  VA  LSSAA LAP  DAHQ+VL P P +TT+ K+TKY PLAFLENQGF T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
              DF  WR  NGYKTLR FMD  KYTV  GAD+ CG+T+   TPQ IPDG+AMRSTGYTH
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTH  120

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYW  165
            DGPCEVW+D TRVL  DNCHE I+ K YTIDYS+C GTCTL WYW
Sbjct  121  DGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 220 bits (561),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 128/165 (78%), Gaps = 0/165 (0%)

Query  1    MAPsllsslsvaaalssaaflaPMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET  60
            MAPSL+S+  VA  LSSAA LAP  DAHQ+VL P P +TT+ K+TKY PLAFLENQGF T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTH  120
              DF  WR  NGYKTLR FMD  KYTV  GAD+ CG+T+   TPQ IPDG+AMRSTGYTH
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTH  120

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYW  165
            DGPCEVW+D TRVL  DNCHE I+ K YTIDYS+C GTCTL WYW
Sbjct  121  DGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PHALS_03284
Length=188

 Score = 219 bits (559),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 119/169 (70%), Gaps = 0/169 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P   AHQ++LLP P + T+ KDTKY PLAFLENQ F T  DF  + + N Y +LR F+  
Sbjct  9    PNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKR  68

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            A YTV +GAD  CGFT+ + TPQ IP GN MR TGYTHDG CE+WLD T+VL+  NCH  
Sbjct  69   ANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHND  128

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASAR  191
              GKD  +DYSSC   C ++WYW+ VR LKN YSWQVYKAC+PL+ S +
Sbjct  129  FPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  177

>PYU1_G001744
Length=213

 Score = 218 bits (556),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 124/173 (72%), Gaps = 4/173 (2%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-  84
            DAHQ V+LPAPT+T  ++  ++ PLAFLENQGF+T  DFNA+ ++ GYK+LRAFMD  K 
Sbjct  26   DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKA  85

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            Y VA GAD+ CG+T  D   Q IP G  +RSTGYTHDGPCEVWLD T V+  +NCH    
Sbjct  86   YKVAAGADFQCGWTKLDGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFP  144

Query  145  GKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLTNES  197
            G  + I Y+SC G+CTL WYWMG+R+LK  YSWQVYK CVP+    +RL  E 
Sbjct  145  GTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI--GGKRLLEEQ  195

>PYIR_26626
Length=212

 Score = 215 bits (547),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 4/171 (2%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK  84
             DAHQ V+LPAPT+T   K+  + PLAFLENQG++T  DFN + +S GYKTLRAFMD  K
Sbjct  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84

Query  85   -YTV-ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
             Y V A GA++ CG+TN +   Q IP G  +RSTGYTHDGPCEVWLD T+V++  NC++ 
Sbjct  85   AYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
              GK ++I Y+SC G+CTL WYWMG+R+LKN +SWQVYK CVP+  S RRL
Sbjct  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI-GSGRRL  193

>PYU1_G001740
Length=206

 Score = 214 bits (545),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 3/164 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQ+V+LP PT+T  +KD +++PLAFLENQG++T  DFNA+ +S GYK+LRAFMD  
Sbjct  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83

Query  84   K-YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            K Y V   AD+ CG+TN +   Q IP     R+TGYTHDGPCEVWLD T+VL+  NCH+ 
Sbjct  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
              GK + + Y++C G+CTL WYWMG+R+LK  +SWQVYK CVPL
Sbjct  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PITG_13520
Length=171

 Score = 203 bits (517),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 101/133 (76%), Gaps = 0/133 (0%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLLP P +TT  KDTKY PLAFLENQGF+T  DF AWR  NGYK+LR FMD 
Sbjct  23   PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR  82

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP G AMRSTGYTHDGPCEVWLD   VL  DNCHE 
Sbjct  83   AKYDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEK  142

Query  143  ISGKDYTIDYSSC  155
              GKDYT+DYSSC
Sbjct  143  FPGKDYTVDYSSC  155

>PHYSO_343376
Length=172

 Score = 202 bits (514),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 0/131 (0%)

Query  35   APTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYY  94
            A  +TT+ K+TKY PLAFLENQGF T  DF AWR  NGYKTLR FMD  KYTV  GAD+ 
Sbjct  33   AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFS  92

Query  95   CGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSS  154
            CG+T+   TPQ IPDG+AMRSTGYTHDGPCEVW+D TRVL  DNCHE I+ K YTIDYS+
Sbjct  93   CGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSA  152

Query  155  CTGTCTLHWYW  165
            C GTCTL WYW
Sbjct  153  CKGTCTLRWYW  163

>PPTG_08820
Length=250

 Score = 203 bits (517),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 118/170 (69%), Gaps = 6/170 (4%)

Query  25   TDAHQVVLLPAPTYT--TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
             DAHQ++L P P +    + +DT++ PLAFLE+QGF    DFN WR  +GYK LR FMD 
Sbjct  25   VDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDR  84

Query  83   AKYT--VADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCH  140
            AKYT  V  GAD  CG T     P+ IP    M+STGYTHDGPC V+LD   VL +DNCH
Sbjct  85   AKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCH  144

Query  141  EAISGKDYTIDYSSC--TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            E + GK Y IDYSSC   G CTL+W+W+G+R++K+ +SWQVYK CVPL+A
Sbjct  145  EKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  194

>PHYSO_254168
Length=170

 Score = 198 bits (503),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 111/155 (72%), Gaps = 17/155 (11%)

Query  41   DSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNA  100
            + KDTKY PLAFLE QGF T   F+A RR NGYKTLR FMD  KYTV  GADY+CG+TN 
Sbjct  29   EDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTNP  88

Query  101  DATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSC--TGT  158
              TPQ IP     RSTGYTHDGPCE+WLD  RVL           +  TIDYSSC   G 
Sbjct  89   KGTPQPIP-----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGG  133

Query  159  CTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
            CT+HWYW+GVR+LKN+YSWQVYK C+PL+A+ +RL
Sbjct  134  CTMHWYWLGVRFLKNSYSWQVYKECIPLTAAPKRL  168

>PYU1_G001739
Length=266

 Score = 198 bits (504),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 112/168 (67%), Gaps = 1/168 (1%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQ+++ P P +  D KD ++ PLAFLENQG  T  D   + +  GY  LRA MD  
Sbjct  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79

Query  84   K-YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            K Y V   A + CG+T+     Q IP    +RSTGYTHDGPCEVWLD  +V++ DNCH+ 
Sbjct  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
              GK + +DYSSC G+CTL WYW+GVRYLK  YSWQ+YK CV LS +A
Sbjct  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  187

>PPTG_14255
Length=268

 Score = 196 bits (499),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 119/168 (71%), Gaps = 5/168 (3%)

Query  24   MTDAHQVVLLPAPTYT-----TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRA  78
             T AHQVV +P+PT+T     +  +   + PL+FLE +G+ T  +F  ++  NGYK+LR 
Sbjct  18   QTQAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRD  77

Query  79   FMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            FMD AKY+V DGAD  CG+T+    PQ IP+   MR++GYTHDGPCE+++  T  L++ N
Sbjct  78   FMDNAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLN  137

Query  139  CHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            CHE+I+ + + +DYS+C  +C L+WYW+GVRYLK  YSWQVYK C+PL
Sbjct  138  CHESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PHYCA_510817
Length=188

 Score = 193 bits (491),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 117/167 (70%), Gaps = 5/167 (3%)

Query  25   TDAHQVVLLPAPTYTTDSKDTK-----YAPLAFLENQGFETVGDFNAWRRSNGYKTLRAF  79
            T+AHQVV +P+PT+T  +  +K     + PL+FLE +GF+T  +F  ++  NGYK+LR F
Sbjct  20   TEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDF  79

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            M+ AKY V+DGAD  CG+++    PQ IP    MR++GYTHDGPCE+W+     L++ NC
Sbjct  80   MEKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNC  139

Query  140  HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            HE+I  + + +DYS C  +C L+WYW+GVR LK  YSWQVYK C+PL
Sbjct  140  HESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PPTG_14254
Length=188

 Score = 191 bits (486),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 117/167 (70%), Gaps = 5/167 (3%)

Query  25   TDAHQVVLLPAPTYTTDSKDTK-----YAPLAFLENQGFETVGDFNAWRRSNGYKTLRAF  79
            T+AHQVV +PAPT+T  +  +K     + PL+FLE +GF+T  +F  ++  NGYK+LR F
Sbjct  20   TEAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDF  79

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            MD AKY V +GAD  CG+T+    PQ IP+   MR+TGYTHDGPCE+++     L++ NC
Sbjct  80   MDRAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNC  139

Query  140  HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            HE+I  + + +DYS C  +C L+WYW+GVR LK  YSWQVYK C+P+
Sbjct  140  HESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PHYSO_417649
Length=185

 Score = 186 bits (471),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 115/167 (69%), Gaps = 5/167 (3%)

Query  25   TDAHQVVLLPAPTYT-----TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAF  79
             +AHQVV +P+PT+T        +   + PL+FLE +GF+T  +F  ++  NGYK+LR F
Sbjct  18   VEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDF  77

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            M+ AKY + DGAD  CG+T+    PQ IP+   MR++GYTHDGPCE+++     L++ NC
Sbjct  78   MERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNC  137

Query  140  HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            HE+I+ + + +DYS C  +C L+WYW+GVR LK  +SWQVYK C+PL
Sbjct  138  HESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PHYKE_9185
Length=281

 Score = 189 bits (479),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 118/167 (71%), Gaps = 5/167 (3%)

Query  25   TDAHQVVLLPAPTYTTDSKDTK-----YAPLAFLENQGFETVGDFNAWRRSNGYKTLRAF  79
            T+AHQVV +P+PT+T  +  +K     + PL+FLE +G +T  +F  ++  N Y +LR F
Sbjct  22   TEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDF  81

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            MD AKY V+DGAD  CG+T+    PQ IP+   MR++GYTHDGPCE+++     L++ NC
Sbjct  82   MDKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNC  141

Query  140  HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            HE+I+ + + +DYS+C  +C L+WYW+GVR LK +YSWQ+YK C+PL
Sbjct  142  HESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PITG_10499
Length=323

 Score = 188 bits (477),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 112/161 (70%), Gaps = 6/161 (4%)

Query  34   PAPTYT--TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY--TVAD  89
            P P +    + +DT++ PLAFLE+QGF    DFN WR  NGYK LR FMD AKY  +V  
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  90   GADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT  149
            GAD  CG T     P+ IP   AMRSTGYTHDGPC ++LD   V+ +DNCHE+I G+ Y 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  150  IDYSSC--TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            ID+SSC   G CTL+W+W+G+R++K+ +SWQVYK C+ L+A
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLTA  164

>PHYSO_341596
Length=231

 Score = 184 bits (466),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 94/127 (74%), Gaps = 8/127 (6%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLL         KDTKY PLAFLENQGFET  DF +WR  NGYK+LR FMD 
Sbjct  23   PTADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK  74

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKYTV  GAD+ CGFT+   TPQ IP G+AMRSTGYTHDGPCEVWLD T+VL  DNCHE 
Sbjct  75   AKYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEK  134

Query  143  ISGKDYT  149
              GKDYT
Sbjct  135  FPGKDYT  141

>PYAR_24096
Length=227

 Score = 183 bits (465),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 110/165 (67%), Gaps = 3/165 (2%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AK  84
            +AHQ V LP   YT  +++T + P A LE QG++T  DFNA+ ++N YKTLR FMD    
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            Y    GA + CGFT+  A  Q IP   A R++GYTH+GPCE+W+D  RV   DNCH  IS
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  145  GKDYT--IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
               +T  IDYS+C GTC L WYW+G+R    +YSWQ+YKAC+PLS
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PHYCA_536934
Length=983

 Score = 195 bits (496),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 117/167 (70%), Gaps = 5/167 (3%)

Query  25   TDAHQVVLLPAPTYT-----TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAF  79
            T+AHQVV +P+PT+T     +  +   + PL+FLE +G+ T  +F  ++  NGYK LR F
Sbjct  36   TEAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDF  95

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            MD AKY V DGAD  CG+++ +  PQ IP+   MR++GYTHDGPCE+W+     L++ NC
Sbjct  96   MDNAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNC  155

Query  140  HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            HE+I+ + + +DYS C  +C L+WYW+GVRYLK  YSWQVYK C+PL
Sbjct  156  HESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PYAP_22273
Length=268

 Score = 182 bits (462),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 112/179 (63%), Gaps = 3/179 (2%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-  82
            + +AHQ V  P   YT   + T + P A LENQG++T  DFNA+  +NGYKTLR FMD  
Sbjct  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
              Y    GA   CG+T+ +A PQ IP     R++GYTH+GPCE+W+D   V +  NCH  
Sbjct  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141

Query  143  ISGKDYT--IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLTNESAV  199
            IS K +T  IDYS+C G C L WYW+G+R +   YSWQ+YKAC+PL+       N++ V
Sbjct  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGGNNKTKV  200

>PYAP_22278
Length=289

 Score = 182 bits (463),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 109/173 (63%), Gaps = 7/173 (4%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-A  83
             DAHQ V +PAPT+T + ++  + PLAFLENQG +   D   + RS G KTLR +MD  A
Sbjct  22   VDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKA  81

Query  84   KYTV-ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTH--DNCH  140
             Y + A GA + CG+TN +   Q IP    MRSTGYTHDGPCEVWLD TRVL     NCH
Sbjct  82   NYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCH  141

Query  141  EAISGK--DYTIDYSSCTGTCTLHWYWMGVRYL-KNAYSWQVYKACVPLSASA  190
              +  K   Y ID+S C G C L WYW+G R +    +SWQ+YKACVPL  S 
Sbjct  142  RDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  194

>PYAP_22279
Length=223

 Score = 178 bits (451),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 108/171 (63%), Gaps = 7/171 (4%)

Query  28   HQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYT  86
            HQ + +PAPT TTD ++T   PLAFLENQG +   D   + R  G KTLR FMD  A Y 
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  87   V-ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVL--THDNCHEAI  143
            V A GA + CG+T+ +   Q IP    MRSTGYTHDGPCEVWLD TRVL  T  +CH+ I
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  144  SGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARR  192
                  Y ID+S C G C L WYW+  R + + +SWQVYK CVPL  SA R
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAAR  191

>PYIR_26546
Length=239

 Score = 177 bits (450),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 110/164 (67%), Gaps = 4/164 (2%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQ-GFETVGDFNAWRRSNGYKTLRAFMDGAK-  84
            AHQ+V+LP PT+T + K  ++ P+A+LE Q GF    DFN +  S G+KT+R FMD  K 
Sbjct  27   AHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKL  86

Query  85   YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCH-EAI  143
            Y     AD+ CG+T  D  PQ IP  + +R+TGYTH+GPCE+WLD  +V    NCH +  
Sbjct  87   YRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVA  146

Query  144  SGKDY-TIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            SG ++  +D+SSC G CT++WYWMG+R    + SWQ+YK C+PL
Sbjct  147  SGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYCA_14368
Length=219

 Score = 177 bits (448),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 100/165 (61%), Gaps = 45/165 (27%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY  85
            +AHQ+VLLP P +TT+ KDTKY PLAFLENQGF+T  DF +WR  N YK+LR FMD AKY
Sbjct  26   EAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAKY  85

Query  86   TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  145
            TV DGAD+ CGFT+                                              
Sbjct  86   TVTDGADFSCGFTDP---------------------------------------------  100

Query  146  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            KDYT+DYSSC GTCTL WYW+G+R+LKN YSWQVYKAC+PLS S 
Sbjct  101  KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSG  145

>PYIW_18791
Length=194

 Score = 174 bits (441),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 109/171 (64%), Gaps = 3/171 (2%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY  85
            DAHQ V +P P +T   K T +APL+FLE  G +T    + + +  GY TLRA MD +K 
Sbjct  20   DAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKL  79

Query  86   --TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAI  143
              T ++  ++ CG+T+     Q IP  + MR+TGYTH GPCEVW+D  RV+  DNCHE +
Sbjct  80   YKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQV  139

Query  144  SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRLT  194
            S     +DYS+C G CT+ WYW+G+RYLK  +SWQVYK C+ L+     ++
Sbjct  140  SNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGAAIS  189

>PHYSO_262732
Length=188

 Score = 172 bits (437),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 108/166 (65%), Gaps = 19/166 (11%)

Query  26   DAHQVVLLPAPTYT-----TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T        +   + PLAFLENQGF+T               LR FM
Sbjct  20   EAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDFM  65

Query  81   DGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCH  140
            D AKYTV +GAD  CG+T+     Q IP    MR++GYTHDGPCE+++     L++ NCH
Sbjct  66   DNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  125

Query  141  EAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            E+I+ + + +DYS C  +CTL+WYW+GVR+L N YSWQVYK C+P+
Sbjct  126  ESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PHYSO_246676
Length=187

 Score = 165 bits (418),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 101/168 (60%), Gaps = 38/168 (23%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P  DAHQ+VLLP P +TT+ K TKY PLAFLENQGF+T  DF AWR+ NGY+TLR FMD 
Sbjct  6    PTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDK  65

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            AKY V  GAD+ CGFT+   TPQ IP+GN MRSTGYTHDG           L H +    
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG-----------LVHAS----  110

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
                                   + +  +KN+YSW+VYKAC+PLS S 
Sbjct  111  -----------------------LVLDGMKNSYSWKVYKACIPLSGSG  135

>PHYSO_527908
Length=174

 Score = 160 bits (404),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 102/153 (67%), Gaps = 5/153 (3%)

Query  25   TDAHQVVLLPAPTYTTDSKDTK-----YAPLAFLENQGFETVGDFNAWRRSNGYKTLRAF  79
             DAHQVV +P PT+T  +  +      + PLAFLE QGF T  +F  +   NGYK+LR F
Sbjct  19   VDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDF  78

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            MD   Y+V  GAD  CG+T+ +  PQ IP+   MR++G+THD PCE+++     L++ NC
Sbjct  79   MDNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNC  138

Query  140  HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLK  172
            HE+I+ + + +DYS+C  +C L+WYW+GVR++K
Sbjct  139  HESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PPTG_17123
Length=201

 Score = 155 bits (392),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 1/162 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87
            QVVL P P +  D  D +   LA+L+ QG  T  +  +W + +GY +LRA +D    Y V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147
             + A + CG T+     Q IP  N+ +++GYT DGPCEVWLD T+V +  NCH       
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
            + +DYSSC   CTL WYW+G++Y++  YSWQVYK CV LS +
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198

>PHYSO_340369
Length=200

 Score = 154 bits (388),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 101/168 (60%), Gaps = 19/168 (11%)

Query  24   MTDAHQVVLLPAPTYT-----TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRA  78
            +T A+QVV +PAPT+T     TD +   + PLA+ E+QGF T  +F  W+ +NG+KTLR 
Sbjct  21   ITRANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRD  80

Query  79   FMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            FMD   Y+V               +PQ IPD N MR+ GYT DGPCE+WLD T   +  +
Sbjct  81   FMDNGNYSVT--------------SPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVD  126

Query  139  CHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            C  ++    YT+DYS C  +C ++WY +GV      YSW+VYK C+PL
Sbjct  127  CLVSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PYU1_G001738
Length=226

 Score = 154 bits (389),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 97/167 (58%), Gaps = 1/167 (1%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-Y  85
            A   VL P P Y  D  + + AP+A LE QG +T  D + + +  GY  LRA +D  K Y
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  86   TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  145
             V   A   CG+T+     Q IP  NA  STGY  +GPCEVWLD  +V++  NCH    G
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  146  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARR  192
             ++ +DYSSC G+C L WYW+G++ +   YSWQVYK CV L  +  +
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ  187

>PHYCA_537323
Length=200

 Score = 152 bits (385),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 97/163 (60%), Gaps = 1/163 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87
            QVV  P P +  D  D +   LA+L+ QG  T  +  +W   +GY +LRA +D    Y V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147
             + A + CG T+     Q IP  N+ +++GYT DGPCEVWLD T+V    NCH       
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            + +DYSSC  +CTL WYW+G++Y++  YSWQVYK CV L  +A
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198

>PHYRA_81105
Length=201

 Score = 150 bits (379),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 1/163 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR+ +D    Y V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147
             + A + CG T+     Q IP  ++ +S+GYT DGPCEVWLD T+     NCH       
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            + IDYS+C   C L WYW+G++Y++ AYSWQVYK C+ L   A
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199

>PITG_18452
Length=856

 Score = 157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +  +W +  GY +LRA +D    Y V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147
             + A + CG T+     Q IP  N+ +++GYT DGPCE+WLD T+V +  NCH       
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
            + +DYSSC G+C L WYW+G++Y++  YSWQVYK CV LS
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

>HYAP_07096
Length=251

 Score = 145 bits (367),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 2/160 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMD-GAKYTV  87
            QVVL P+P +  D    +   LA+L+ QG +T  +  +W++ +GY +LRA +D  + Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  88   ADGADYYCGFTNADA-TPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  146
            +  A + CGFT+  + T Q IP    + S+GYT DGPCEVW D T+V +  NC       
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  147  DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
             + +DYSSC  +CTL WYW+G++Y+   YSWQVYK C+ L
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PHYSO_353401
Length=146

 Score = 142 bits (357),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 91/142 (64%), Gaps = 1/142 (1%)

Query  50   LAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTVADGADYYCGFTNADATPQAIP  108
            LA+L+ QG  T  +  +W + +GY +LRA +D    Y V + A + CG T+     Q IP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  109  DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGV  168
              ++ +++GYT DGPCEVWLD T+V    NCH       + IDYS+C  +CTL WYW+G+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  169  RYLKNAYSWQVYKACVPLSASA  190
            +Y++ AYSWQVYK CV LS +A
Sbjct  123  KYVEGAYSWQVYKNCVALSKTA  144

>PYVX_18179
Length=147

 Score = 122 bits (305),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 91/180 (51%), Gaps = 64/180 (36%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQ V+LP PT+T++  D  Y+PLAFLE+QGF T  DF                   
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF-------------------  64

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRS-TGYTHDGPCEVWLDTTRVLTHDNCHEA  142
                                       N+ RS  GY          DT R        +A
Sbjct  65   ---------------------------NSWRSANGY----------DTLRAFMD----QA  83

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199
            +SGKD  +DYSSC+G+CTL+W+WMGVRYLK AYSWQVYK CVPLS SAR L    N SA+
Sbjct  84   VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143

>PYIW_18788
Length=244

 Score = 123 bits (308),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 87/163 (53%), Gaps = 2/163 (1%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-Y  85
            A+  V  P P +  D      A +A LE+Q   T  D   + +  GY +LRA +D    Y
Sbjct  26   ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  85

Query  86   TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  145
             V   + + CG+T+     Q IP    +R TGY  DGPCE+W+D  ++L+  NC +   G
Sbjct  86   DVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145

Query  146  KDYTIDYSSCTGTCTLHWYWMGV-RYLKNAYSWQVYKACVPLS  187
                +DYSSC G CTL WY + V +    +YSW+VYK CV LS
Sbjct  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

>PYIW_18792
Length=125

 Score = 118 bits (295),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (68%), Gaps = 0/103 (0%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            + DAHQ V LPAPT+T  ++  ++ PLAFLE QG++   DF A+ +S GYK LR FMD  
Sbjct  20   LVDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDK  79

Query  84   KYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEV  126
            K    DG ++ CG+++   TPQ IP G A+RSTGYTHDGP  +
Sbjct  80   KAYKVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PYVX_18175
Length=147

 Score = 114 bits (284),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 89/181 (49%), Gaps = 63/181 (35%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P+ DAHQ V+LP P++TT  +D  Y+PLAFLENQ               G+KT   F   
Sbjct  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDF---  64

Query  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142
            + +  A+G      F               M S  YT                       
Sbjct  65   SAWRRANGYKTLRSF---------------MDSGKYT-----------------------  86

Query  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199
                D  IDYSSC G+CTL+WYWMGVRYLK AYSWQVYK CVPLS SAR L   +NESA+
Sbjct  87   ----DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142

Query  200  I  200
            I
Sbjct  143  I  143

>PYAP_18131
Length=226

 Score = 112 bits (281),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 71/115 (62%), Gaps = 7/115 (6%)

Query  81   DGAKYTV-ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHD--  137
            D A Y V A GA + CG T+ +   Q IP    MRSTG+THDG   VW+D TRVL     
Sbjct  3    DKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSKLG  60

Query  138  NCHEAISGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            NCH++I      Y ID+S C G C + WYW+G+R L   +SWQVYKAC+P+ AS 
Sbjct  61   NCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASG  115

>PHYRA_78625
Length=434

 Score = 114 bits (284),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 50/166 (30%)

Query  26   DAHQVVLLPAPTYTTDSKDTK-----YAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  +  +      + PL+FLE +GFET  +F  ++  NGY +LR F+
Sbjct  239  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  298

Query  81   DGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCH  140
            D AKY +A                                             L++ NCH
Sbjct  299  DKAKYKLA---------------------------------------------LSYLNCH  313

Query  141  EAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            E+I+ + + +DYS C  +C L+WYW+G RYLK +YSWQVYK C+ L
Sbjct  314  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYRA_78626
Length=473

 Score = 114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 50/166 (30%)

Query  26   DAHQVVLLPAPTYTTDSKDTK-----YAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFM  80
            +AHQVV +P+PT+T  +  +      + PL+FLE +GFET  +F  ++  NGY +LR F+
Sbjct  278  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  337

Query  81   DGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCH  140
            D AKY +A                                             L++ NCH
Sbjct  338  DKAKYKLA---------------------------------------------LSYLNCH  352

Query  141  EAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            E+I+ + + +DYS C  +C L+WYW+G RYLK +YSWQVYK C+ L
Sbjct  353  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PYU1_G007476
Length=195

 Score = 107 bits (268),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 77/143 (54%), Gaps = 16/143 (11%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGN---AMRST  116
            + DF    +  GYKTLR+F++        GA   CG+T  + TP+AIP DG    A  + 
Sbjct  63   MNDFARISKQKGYKTLRSFLEN------KGAS--CGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTGTCTLHWYWMGVRYLKNA  174
            G+ H GPCE+WLD   +L  DNC +A  G      +D+SSC GTC L  YW+G  +    
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  175  YSWQVYKACVPLSASARRLTNES  197
              WQ YK CVP+    +RL  + 
Sbjct  173  QRWQTYKYCVPVKKGGKRLLRDE  195

>PHYSO_342364
Length=194

 Score = 105 bits (261),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 96/181 (53%), Gaps = 20/181 (11%)

Query  23   PMTDAHQVVLLPAPTY--TTDSKDTKYAPLAFLENQGF----ETVGDFNAWRRSNGYKTL  76
            P  DAH  + +P   +    +S+ +   P  +  N  +    ++V  FN+ + S+ YK L
Sbjct  19   PGADAHGYIYVPQSQFFGGENSQWSVQIPPVWPSNDWYGNTQKSVQVFNSLKTSHNYKDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            R  +D    T   G +  CG+TN + TPQ IP +G A+ S G  H GPCE+WLD  +V+ 
Sbjct  79   RTLLDN---TAVYGPN--CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDDKKVMA  133

Query  136  HDNC-----HEAISGK-DYTIDYSSC--TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             D+C     H  ++ K ++ +DYS C   G C + +YW+G + L     WQ YK C+PL 
Sbjct  134  ADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPLK  193

Query  188  A  188
            A
Sbjct  194  A  194

>PYIR_16435
Length=304

 Score = 107 bits (267),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 13/127 (10%)

Query  63   DFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTHD  121
            +F    +  GY TLR++++  K T+       CG TN DATP+AIP  N ++ S    H 
Sbjct  66   NFATVSKEKGYSTLRSYIED-KGTL-------CGRTNPDATPKAIPSDNTVKFSRAIVHP  117

Query  122  GPCEVWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQV  179
            GPCE+WLD  RV+  DNC      K   + ID+SSC G+C L W+W+G++   +   WQV
Sbjct  118  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQV  175

Query  180  YKACVPL  186
            YK CVPL
Sbjct  176  YKNCVPL  182

>PYIR_16444
Length=182

 Score = 103 bits (256),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 85/172 (49%), Gaps = 15/172 (9%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLE--NQGFETVGDFNAWRRSNGYKTLRAFM  80
            P  DAH  V +P   +   + +     + F    +  ++   +F    +  G+ TLR+++
Sbjct  21   PQVDAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPKNFAKVAKQKGFPTLRSYI  80

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            +        GA   CG TNA ATP+ IP DG    S    H GPCE+WLD  RV  +DNC
Sbjct  81   EN------KGA--ICGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELWLDNKRVYQNDNC  132

Query  140  HEAISGKD--YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
                  K   + ID+SSC G C L ++W+G++       WQVYK CVP+   
Sbjct  133  EGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVPVKGK  182

>PHYRA_73582
Length=326

 Score = 105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 94/188 (50%), Gaps = 22/188 (12%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGF-ETVGD------FNAWRRSNGYKTLRAF  79
            AH  +  PAPT+  +  +     +A L   G+ E+ GD      F     +N YK L+  
Sbjct  23   AHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTL  82

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            MDG ++    G D  CGFT+ + TP   P DG A  S G  H GPCE+WLD   VL +D+
Sbjct  83   MDGPEF----GED--CGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  136

Query  139  CHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            C  A   G   TI      DYS C  G C L +YW+ ++ L     WQ YK C+PL+  A
Sbjct  137  CQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPLTGPA  196

Query  191  RRLTNESA  198
                +++A
Sbjct  197  GGGASQTA  204

>PHYRA_74651
Length=344

 Score = 105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 13/134 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            + + + SNGY  +R  +D    T   GAD  CGFT+ +ATP+  P  G+A  S G  H G
Sbjct  69   YTSLKESNGYSDIRTLLDSD--TSLYGAD--CGFTDPNATPKDPPSTGDATFSRGMVHAG  124

Query  123  PCEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD T+VL++DNC  A              +DYSSC +G CTL +YW+  + L ++
Sbjct  125  PCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSS  184

Query  175  YSWQVYKACVPLSA  188
              WQVYK CVPL+ 
Sbjct  185  TVWQVYKNCVPLTG  198

>PHYKE_10578
Length=239

 Score = 103 bits (256),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 86/182 (47%), Gaps = 27/182 (15%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLA---FLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            DAH  + +P PT+   +  + +  L    +    G + VG F       G       +D 
Sbjct  21   DAHGALKVPEPTFEQGASHSNWVTLVDNYWDIGSGGDQVGKFKTMATEKGMSVKDVILDM  80

Query  83   AKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLTHD  137
             K       D  CGFT ADA PQ +P DG  +     + G+TH GPCEV++D   VL  D
Sbjct  81   VK-------DKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGD  133

Query  138  NCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
            NC +   G         + TIDYSSC G C L +YW+G +  +    WQ Y  CVPL+ S
Sbjct  134  NCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLTGS  189

Query  190  AR  191
             +
Sbjct  190  GK  191

>PPTG_04622
Length=273

 Score = 101 bits (252),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 80/137 (58%), Gaps = 13/137 (9%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            + + + SNGY  +RA +D    T   GA+  CGFT+ DATP+  P  G+A  S G  H G
Sbjct  69   YTSLKESNGYSDIRALLDSD--TDLYGAN--CGFTDPDATPKDPPTTGDATFSRGMVHAG  124

Query  123  PCEVWLDTTRVLTHDNCHEAI------SGKDYT-IDYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD T VL++D+C  A           +T +DYSSC TG C L +YW+  + + + 
Sbjct  125  PCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSK  184

Query  175  YSWQVYKACVPLSASAR  191
              WQVYK CVPL+  A 
Sbjct  185  MVWQVYKDCVPLTGPAE  201

>PYAP_24689
Length=252

 Score = 100 bits (250),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 88/179 (49%), Gaps = 22/179 (12%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQG------FETVGDFNAWRRSNGYKTL  76
            P  DAH  V  P   +      TKY P +++   G        T   ++A R+ +G KTL
Sbjct  21   PQADAHTYVSQPRAEF---KPGTKY-PSSWVAEFGPPWPGTIRTGAQYDAVRKKHGVKTL  76

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            RAF++ +K  V       CG TN +A  + IP DG     +   H GPCE+W D TRV  
Sbjct  77   RAFLE-SKGPV-------CGSTNPNAKRKPIPRDGLIKFGSSMEHPGPCEIWFDNTRVFV  128

Query  136  HDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
              +C++   S   + IDYS C G C L +YW+G++       WQ YK CVPL    R L
Sbjct  129  DADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYKNCVPLGNDKRML  185

>PHYKE_8104
Length=86

 Score = 96.3 bits (238),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 48/63 (76%), Gaps = 0/63 (0%)

Query  23  PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
           P  DAHQ+VLLP PT+TT+ KDTKY PLAFLE +GF    DF AWR  NGYK+LR FMD 
Sbjct  23  PTADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN  82

Query  83  AKY  85
           AKY
Sbjct  83  AKY  85

>PHYRA_73607
Length=343

 Score = 102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 80/136 (59%), Gaps = 13/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            +++ + SNGY  +R  +D    T   GAD  CGFTN DAT +  P  G+A  S G  H G
Sbjct  69   YSSLKSSNGYSDIRTLLDSD--TSLYGAD--CGFTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD T+VL++DNC  A   G   T      +DYSSC T  C L +YW+  + + ++
Sbjct  125  PCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSS  184

Query  175  YSWQVYKACVPLSASA  190
              WQVYK CVPL+  A
Sbjct  185  MVWQVYKNCVPLTGPA  200

>PHYCA_12942
Length=353

 Score = 102 bits (253),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 81/177 (46%), Gaps = 28/177 (16%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLR  77
            P  DAH  +  P PT+   S +     +  ++N      G + VG F       G     
Sbjct  18   PNADAHGSLKQPKPTFDGSSAEW----VTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKD  73

Query  78   AFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTR  132
              +D  K       D  CG+T ADA PQ IP    ++       G+TH GPCE+++D   
Sbjct  74   VILDMVK-------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKM  126

Query  133  VLTHDNCHEAISG---KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            VL  DNC E   G    D  IDYSSC G C L  YW+G    +NA  WQ Y  CVPL
Sbjct  127  VLHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLG---FQNA-QWQAYVNCVPL  179

>PHYCA_130365
Length=266

 Score = 100 bits (249),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 77/144 (53%), Gaps = 15/144 (10%)

Query  54   ENQGFE-TVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGN  111
            E++G E  +  F     SN YK +R+ MDG      D     CGFT+ + TP   P DG 
Sbjct  55   ESKGDEGLLATFKELAASNNYKDVRSMMDGNSVYGED-----CGFTDPNGTPVDPPTDGT  109

Query  112  AMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHW  163
            A  S G  H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C L +
Sbjct  110  ATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRF  169

Query  164  YWMGVRYLKNAYSWQVYKACVPLS  187
            YW+G++ L     WQ YK C+PL+
Sbjct  170  YWLGLQRLDGKTVWQAYKNCIPLT  193

>PHYRA_78689
Length=296

 Score = 100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 88/179 (49%), Gaps = 20/179 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFL------ENQGFETVGDFNAWRRSNGYKTL  76
            P  DAH  +L+P   +   +       +  +      +    ++V  F + + +N +K L
Sbjct  19   PSADAHGYMLIPESQFKGSASSAWVVQIDPVWTSDKWDGNNPQSVDTFKSLKTANNFKDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+ D TPQ IP DG A  S    H GPCE+WLD T+VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDDTKVLY  133

Query  136  HDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPL  186
             D+C      ++      + +DYSSC +G C  + +YW+  + L +   WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>PPTG_04618
Length=326

 Score = 100 bits (248),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 87/180 (48%), Gaps = 21/180 (12%)

Query  27   AHQVVLLPAPTYTTDSKD---TKYAPL---AFLENQGFETV-GDFNAWRRSNGYKTLRAF  79
            AH  +  PAP++     +    +  P     + E++G E +   F      N YK +R+ 
Sbjct  23   AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKDVRSL  82

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            MDG      D     CGFT+   TP   P DG A  S G  H GPCE+WLD   VL +D+
Sbjct  83   MDGNPVYGED-----CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  139  CHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            C  A   G   TI      DYSSC +G C L +YW+ ++ L     WQ YK C+PL+  A
Sbjct  138  CQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  197

>PHYKE_6002
Length=197

 Score = 97.1 bits (240),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 92/189 (49%), Gaps = 23/189 (12%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFL------ENQGFETVGDFNAWRRSNGYKTL  76
            P  +AH  +L+P   +  D        +A +      +    ++V  F++ +++N +  L
Sbjct  19   PQVNAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+   TPQ IP DG A  S    H GPCE+WLD+T+  +
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFS  133

Query  136  HDNCHEAISGKDYTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPLSASARRL  193
             DNC +    + + +DYSSC +G C  + +YW+  + L +   WQ Y+         R L
Sbjct  134  KDNCADM---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR------IGWRHL  184

Query  194  TNESAVIDF  202
             N   +IDF
Sbjct  185  ANVPVIIDF  193

>PYIR_16443
Length=275

 Score = 99.0 bits (245),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 89/170 (52%), Gaps = 22/170 (13%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLE-----NQGFETVGDFNAWRRSNGYKTLR  77
            P  +AH  + +P   +    K TKY     +E        ++   +F    +  G++TLR
Sbjct  21   PQVNAHGFIEVPKSEFV---KGTKYPSEWIVEFPPPWEGNWKDPKNFATVSKQKGFETLR  77

Query  78   AFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTHDGPCEVWLDTTRVLTH  136
            ++++        GA   CG TN +A+P+AIP  + ++ S    H GPCE+WLD  RV+  
Sbjct  78   SYIEDK------GA--LCGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQD  129

Query  137  DNCHEAISGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY-KAC  183
            DNC      K   + ID+SSC G+C L W+W+G++   +   WQVY K+C
Sbjct  130  DNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PITG_04948
Length=232

 Score = 97.8 bits (242),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 75/139 (54%), Gaps = 13/139 (9%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYT  119
            V  +   + SN  K +R  +D    T   GAD  CG+TN D +P+  P DG A  S G  
Sbjct  64   VALYKELKASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIV  119

Query  120  HDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C L +YW+ ++ L
Sbjct  120  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRL  179

Query  172  KNAYSWQVYKACVPLSASA  190
                 WQVYK C+PLS  A
Sbjct  180  DGKTYWQVYKNCIPLSGPA  198

>PPTG_04619
Length=276

 Score = 98.6 bits (244),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 78/146 (53%), Gaps = 13/146 (9%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYT  119
            V  +   + SN  K +R  +D    T   GAD  CG+TN D TP+  P DG A  S G  
Sbjct  64   VALYKELKASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIV  119

Query  120  HDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C   +YW+ ++ L
Sbjct  120  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  179

Query  172  KNAYSWQVYKACVPLSASARRLTNES  197
                 WQVYK C+PLS  A   T+++
Sbjct  180  DGKTYWQVYKNCIPLSGPAGGGTSQT  205

>PHYCA_127270
Length=279

 Score = 98.2 bits (243),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFL------ENQGFETVGDFNAWRRSNGYKTL  76
            P  DAH  +L+P   +   +       +  +      +    ++V  F + + +N +K L
Sbjct  19   PSVDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNPQSVDTFKSLKAANNFKDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+ + TPQ IP DG A  S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDDKKVLY  133

Query  136  HDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPL  186
             D+C      K+      + +DYSSC  G C  + +YW+  + L     WQ YK C+PL
Sbjct  134  EDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKDCIPL  192

>PHYSO_438103
Length=238

 Score = 97.4 bits (241),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 88/180 (49%), Gaps = 22/180 (12%)

Query  23   PMTDAHQVVLLPAPTYTTDSK-------DTKYAPLAFLENQGFETVGDFNAWRRSNGYKT  75
            P  DAH  +L+P   +T  +        D  +A   +  N    +V  F + + +N +K 
Sbjct  18   PSADAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNA-GSVEVFKSLKSANNFKD  76

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVL  134
            L+  MD       D     CGFT+ + TPQ IP DG A  S    H GPCE+WLD T+VL
Sbjct  77   LKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVL  131

Query  135  THDNCHEAISGKD------YTIDYSSCT-GTCT-LHWYWMGVRYLKNAYSWQVYKACVPL  186
              D+C      ++      + +DYSSC  G C  + +YW+  + L +   WQ YK C+PL
Sbjct  132  YEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PHYSO_485524
Length=278

 Score = 98.2 bits (243),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 75/139 (54%), Gaps = 13/139 (9%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYT  119
            V  +   + SN  K +R  +D    T   GA+  CG+TN DATP+  P DG A  S G  
Sbjct  64   VALYKELKDSNNAKDIRTLLDSD--TKLYGAN--CGYTNPDATPEDPPTDGTATFSRGIV  119

Query  120  HDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C   +YW+ ++ L
Sbjct  120  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  179

Query  172  KNAYSWQVYKACVPLSASA  190
                 WQVYK C+PLS  A
Sbjct  180  DGKTYWQVYKNCIPLSGPA  198

>PYU1_G005324
Length=191

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 12/141 (9%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP DG    ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C L +YW+G++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  176  SWQVYKACVPLSASARRLTNE  196
             WQ YK CVPL +S  R   E
Sbjct  165  RWQSYKNCVPLKSSKLRSLEE  185

>PYU1_G005326
Length=191

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 12/141 (9%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP DG    ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C L +YW+G++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  176  SWQVYKACVPLSASARRLTNE  196
             WQ YK CVPL +S  R   E
Sbjct  165  RWQSYKNCVPLKSSKLRSLEE  185

>PYU1_G005328
Length=191

 Score = 95.9 bits (237),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 73/141 (52%), Gaps = 12/141 (9%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP DG    ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C L +YW+G++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  176  SWQVYKACVPLSASARRLTNE  196
             WQ YK CVPL +S  R   E
Sbjct  165  RWQSYKNCVPLKSSKLRSLEE  185

>PYIW_19151
Length=248

 Score = 97.4 bits (241),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 79/131 (60%), Gaps = 13/131 (10%)

Query  63   DFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTHD  121
            +F A  +  G+ TLR++++        GA   CGFT+   +P+AIP    +R S    H 
Sbjct  60   NFAAAAKEKGFSTLRSYLED------KGA--VCGFTDPKVSPRAIPADRTIRFSRDIPHP  111

Query  122  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQV  179
            GPCE+++D TRV  +D+C  A +G    + +D+S C G C + +YW+G++   +   WQV
Sbjct  112  GPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQV  169

Query  180  YKACVPLSASA  190
            YK+CVP+S+SA
Sbjct  170  YKSCVPVSSSA  180

>PHYSO_483955
Length=320

 Score = 98.6 bits (244),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 76/147 (52%), Gaps = 15/147 (10%)

Query  54   ENQGFETV-GDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGN  111
            E++G E +   F     +N YK +R+ MDG      D     CGFT+    P A P DG 
Sbjct  56   ESKGDEGLLATFKELSAANNYKDVRSLMDGNPVYGED-----CGFTDPKGKPVAPPTDGT  110

Query  112  AMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHW  163
            A  S G  H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C L +
Sbjct  111  ATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRF  170

Query  164  YWMGVRYLKNAYSWQVYKACVPLSASA  190
            YW+ ++ L     WQ YK C+PL+  A
Sbjct  171  YWLALQRLDGKTVWQAYKNCIPLTGPA  197

>PHYCA_531163
Length=314

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 13/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            + + + SNGY  +R  +D    T   GAD  CG+TNADAT +  P  G+A  S G  H G
Sbjct  69   YTSLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNADATAKDPPSTGDATFSRGMVHVG  124

Query  123  PCEVWLDTTRVLTHDNCHEA-----ISGKDY--TIDYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD T VL++D+C  A     +  K     +DYSSC T  C L +YW+  + + +A
Sbjct  125  PCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSA  184

Query  175  YSWQVYKACVPLSASA  190
              WQVYK CVPL+  A
Sbjct  185  IVWQVYKDCVPLTGPA  200

>PHYRA_73584
Length=287

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 78/136 (57%), Gaps = 13/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            +++ ++SNGY  +R  +D    T   GA+  CGFTN DAT +  P  G+A  S G  H G
Sbjct  66   YSSLKKSNGYSDIRTLLDSD--TTLYGAN--CGFTNPDATAKDPPTTGDATFSRGMVHAG  121

Query  123  PCEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGT-CTLHWYWMGVRYLKNA  174
            PCE+WLD T VL++D+C  A              +DYSSC+ + C L +YW+  + + + 
Sbjct  122  PCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSK  181

Query  175  YSWQVYKACVPLSASA  190
              WQVYK CVPL+  A
Sbjct  182  TVWQVYKDCVPLTGPA  197

>PITG_04949
Length=337

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 84/180 (47%), Gaps = 21/180 (12%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGF-ETVGD------FNAWRRSNGYKTLRAF  79
            AH  +  PAP++     +     +      G+ E+ GD      F      N +K +R+ 
Sbjct  23   AHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKDVRSL  82

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            MDG      +     CGFT+    P   P DG A  S G  H GPCE+WLD   VL +D+
Sbjct  83   MDGNPVFGEE-----CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  139  CHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            C  A   G   TI      DYSSC  G C L +YW+ ++ LK    WQ YK C+PL+  A
Sbjct  138  CQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPLTGPA  197

>PYAP_18711
Length=210

 Score = 95.5 bits (236),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 85/174 (49%), Gaps = 22/174 (13%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQG------FETVGDFNAWRRSNGYKTLRAF  79
            DAH  V  P   +      TKY P  ++   G      F T   ++A R+  G K LRAF
Sbjct  21   DAHTYVKSPLAEFKAG---TKY-PSEWVAEFGPPWSGTFRTGAQYDAERKKRGIKNLRAF  76

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            ++      + G +  CG TN +A  + IP DG     +   H GPCEVW D T V +  +
Sbjct  77   LE------SKGPE--CGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEVWFDNTLVFSEVD  128

Query  139  CHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASAR  191
            C +   S   + IDYS C G C L +YW+G++       WQ YK CVP+ ++ +
Sbjct  129  CEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIGSATK  180

>PHYKE_6001
Length=289

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 88/183 (48%), Gaps = 20/183 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKD---TKYAPLAFLEN---QGFETVGDFNAWRRSNGYKTL  76
            P  DAH  +L+P   +   +      +  P+   E+      ++V  FNA +++N Y  L
Sbjct  19   PRADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTAFNALKKANNYVDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+ + TPQ IP DG A  S    H GPCE+WLD   V +
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDDKMVFS  133

Query  136  HDNCHEAISGKD------YTIDYSSCTGTC--TLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             ++C+     ++      + +DYSSC G     + +YW+  + +     WQ YK C+PL 
Sbjct  134  DEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPLE  193

Query  188  ASA  190
             S 
Sbjct  194  GSG  196

>PITG_19818
Length=147

 Score = 92.8 bits (229),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 46/61 (75%), Gaps = 0/61 (0%)

Query  23  PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
           P  DAHQ+VLLP P +TT  KDTKY PLAFLENQGF+   DF AWR  NGYK+LR FMD 
Sbjct  21  PTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDR  80

Query  83  A  83
           A
Sbjct  81  A  81

>PHALS_03176
Length=207

 Score = 94.0 bits (232),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 85/183 (46%), Gaps = 21/183 (11%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFL------ENQGFETVGDFNAWRRSNGYKTLRA  78
            TD H  +L+P   +   +       +  L           ++V  F   + +N +K L+ 
Sbjct  21   TDGHGYMLIPQAQFKGSANSAWIVQIDPLWKSSDWNGNTQKSVKTFQKLKAANKFKDLKT  80

Query  79   FMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHD  137
             MD    T A GA   CGF++    PQ IP DG A  S    H GPCE+WLD  +VL  D
Sbjct  81   LMD----TSAFGAK--CGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWLDNKKVLYED  134

Query  138  NCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
            +C+      D      + +DYSSC  G C  + +YW+  + +     WQ YK C+PL  S
Sbjct  135  DCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSYKNCIPLQGS  194

Query  190  ARR  192
            + +
Sbjct  195  SGK  197

>PITG_05271
Length=278

 Score = 95.5 bits (236),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 90/189 (48%), Gaps = 20/189 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKD---TKYAPLAFLENQGFETVGDFNAWRR---SNGYKTL  76
            P TDAH  +L+P   +   +      +  P+   E+      G  NA++    +N +K L
Sbjct  19   PSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVNAFKALKTANKFKDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+ +   Q IP DG A  S    H GPCE+WLD T+VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDDTKVLY  133

Query  136  HDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPLS  187
             D+C      ++      + +DYSSC  G C  + +YW+  + +     WQ YK C+PL 
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPLE  193

Query  188  ASARRLTNE  196
             S    T++
Sbjct  194  GSGGGGTSQ  202

>PYU1_G014690
Length=295

 Score = 95.5 bits (236),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 74/129 (57%), Gaps = 15/129 (12%)

Query  62   GDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTH  120
             +F    +  G+ TLR++++        GA   CG T+ +ATP+AIP  N +  S    H
Sbjct  61   ANFAKVSKEKGFDTLRSYIEDK------GA--LCGKTDPNATPKAIPSDNKVHFSRPIVH  112

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGTCTLHWYWMGVRYLKNAYSW  177
             GPCE+WLD  RV+  D+C EA  G +   + ID+SSC   C L ++W+G++   +   W
Sbjct  113  PGPCEIWLDDKRVMQDDDC-EATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRW  169

Query  178  QVYKACVPL  186
            QVYK CVPL
Sbjct  170  QVYKNCVPL  178

>PHYSO_533903
Length=208

 Score = 93.2 bits (230),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 15/139 (11%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTG  117
            ++V  F + + +N +K L+  +D       D     CGFT+ + TPQ IP DG A+ S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  118  YTHDGPCEVWLDTTRVLTHDNC-----HEAISGK-DYTIDYSSC-TGTCT-LHWYWMGVR  169
              H GPCE WLD  +VL  D+C     H  ++ K ++ IDYSSC  G C  + +YW+G +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  170  YLKNAYS-WQVYKACVPLS  187
             L +  + WQ YK C+PL 
Sbjct  177  ALDDKKTVWQTYKDCIPLQ  195

>PHYKE_3913
Length=321

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYT  119
            V  +   + +N  K +R   D       +     CGFTN DATP+  P DG A  S G  
Sbjct  91   VALYKELKVANNAKDIRTLFDSDTSLYGEN----CGFTNPDATPKDPPTDGTATFSRGIV  146

Query  120  HDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD   VL +D+C  A   G   TI      DYSSC  G C   +YWM ++ L
Sbjct  147  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRL  206

Query  172  KNAYSWQVYKACVPLSA  188
                 WQVYK CVPL+ 
Sbjct  207  DGKTYWQVYKNCVPLTG  223

>PHYSO_340333
Length=284

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 20/179 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFL------ENQGFETVGDFNAWRRSNGYKTL  76
            P  DAH  +L+P   +   +       +  +      +     +V  F A + +N +K L
Sbjct  19   PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+ + TPQ IP DG A  S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLY  133

Query  136  HDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPL  186
             D+C      ++      + +DYSSC  G C  + +YW+  + +     WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PYAP_18709
Length=235

 Score = 93.2 bits (230),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 87/169 (51%), Gaps = 15/169 (9%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLE---NQGFETVGDFNAWRRSNGYKTLRAFM  80
            + D H  V L  P     +  +K + +A  +   +  F+T   + A     G+K LR+F+
Sbjct  17   VADVHAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSFL  76

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            +    T        CG +  +A+P+ IP DG    ++   H GPCEVWLD TR   +D+C
Sbjct  77   EDKGPT--------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRAFHNDDC  128

Query  140  HEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             +A  S   + +D+ +C G+C L +YW+G++       WQ YK C+PL+
Sbjct  129  EKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PHYSO_340332
Length=295

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 20/179 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFL------ENQGFETVGDFNAWRRSNGYKTL  76
            P  DAH  +L+P   +   +       +  +      +     +V  F A + +N +K L
Sbjct  19   PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLT  135
            +  MD      AD     CGFT+ + TPQ IP DG A  S    H GPCE+WLD  +VL 
Sbjct  79   KTLMDDTSVYGAD-----CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLY  133

Query  136  HDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNAYSWQVYKACVPL  186
             D+C      ++      + +DYSSC  G C  + +YW+  + +     WQ YK C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYSO_484051
Length=285

 Score = 94.0 bits (232),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 73/133 (55%), Gaps = 13/133 (10%)

Query  68   RRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDGPCEV  126
            + SNGY  +R  +D    T   GAD  CGFTN DA+P+  P  G+   S    H  PCE+
Sbjct  73   KESNGYSDIRTLLDSD--TSLYGAD--CGFTNPDASPKDPPTTGDPTFSRCMVHASPCEI  128

Query  127  WLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLHWYWMGVRYLKNAYSWQ  178
            WLD T VL++D+C  A   G   T      +DYSSC T  C L +YW+  + + +   WQ
Sbjct  129  WLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  188

Query  179  VYKACVPLSASAR  191
            VYK CVPL+  A 
Sbjct  189  VYKDCVPLTGPAE  201

>PYIW_18790
Length=86

 Score = 88.6 bits (218),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 0/78 (0%)

Query  31   VLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADG  90
            VLLP PT+T  ++  ++ PLAFLENQGF+T  DF A+ R  GYKTLR FMD       DG
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVDG  64

Query  91   ADYYCGFTNADATPQAIP  108
             D+ CG++    TPQ IP
Sbjct  65   GDFECGWSTLKGTPQPIP  82

>PPTG_04647
Length=327

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 75/133 (56%), Gaps = 13/133 (10%)

Query  68   RRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDGPCEV  126
            + SNGY  +R  +D    T   GAD  CG+TN DAT +  P  G+A  S G  H GPCE+
Sbjct  72   KSSNGYSDIRTLLD--SDTDLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  127

Query  127  WLDTTRVLTHDNCHEA-----ISGKDY--TIDYSSC-TGTCTLHWYWMGVRYLKNAYSWQ  178
            WLD T VL++DNC  A     +  K     +DYSSC T  C L +YW+  + + +   WQ
Sbjct  128  WLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  187

Query  179  VYKACVPLSASAR  191
            VYK CVPL+  A 
Sbjct  188  VYKDCVPLTGPAS  200

>PYAR_24113
Length=192

 Score = 91.7 bits (226),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 83/174 (48%), Gaps = 16/174 (9%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFET--------VGDFNAWRRSNGYKTLR  77
            DAH  ++ PAP YTT++ ++    +  L+    +T           FNA  +++ YK+L+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  78   AFMDGAKYTVADGADYYCGF-TNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTH  136
              +      V+ GA   CGF T + ATPQ +PD         +H GPCEVW D       
Sbjct  80   ELVL-QNQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCEVWCDNNLAFQD  138

Query  137  DNCHEAISGKDYTIDYS--SCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            DNC + I G    ++Y   +C G   L  YW+ +   +    WQVY  C PLS 
Sbjct  139  DNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAPLSG  188

>PYU1_G005325
Length=207

 Score = 91.7 bits (226),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 69/131 (53%), Gaps = 12/131 (9%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F T   + A     GYK L++F+D    T        CG T ++A  +AIP DG    ++
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  106

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
               H GPCE+WL  TR   +D+C +   S   + ID+S+C G C L +YW+G++      
Sbjct  107  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  164

Query  176  SWQVYKACVPL  186
             WQ YK C+PL
Sbjct  165  RWQSYKNCIPL  175

>PPTG_14221
Length=275

 Score = 92.8 bits (229),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 70/137 (51%), Gaps = 14/137 (10%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTG  117
            ++V  F + + +N +K L+  MD      AD     CGFTN + TPQ IP DG A  S  
Sbjct  61   KSVDTFKSLKAANNFKDLKTLMDDTSVYGAD-----CGFTNPNGTPQPIPTDGKATFSRA  115

Query  118  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTC-TLHWYWMGVR  169
              H GPC +WLD   VL  D+C      ++      + +DYSSC  G C  + +YW+  +
Sbjct  116  LVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQ  175

Query  170  YLKNAYSWQVYKACVPL  186
             L     WQ YK C+PL
Sbjct  176  GLNKKTVWQSYKDCIPL  192

>CCI47381
Length=211

 Score = 91.3 bits (225),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 91/192 (47%), Gaps = 21/192 (11%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82
            P   +H  +  P     T+ KD      ++++       G F+   + N    L AF   
Sbjct  15   PQAQSHGYITSP----MTEFKDGTGMKTSYIDRFSPTFSGKFDGSPKDNTATFLTAFASS  70

Query  83   AKYTVAD---GADYYCGFTNADATPQAIPDGNAM------RSTGY--THDGPCEVWLDTT  131
               T+ D       YCG TN +A+P+ IP  NA+         G+  +H GPCEVWL  T
Sbjct  71   PFRTLRDFLKDKGPYCGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGPCEVWLGET  130

Query  132  RVLTHDNC--HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
            RV   DNC  H   S     I++SSC+G C L ++W+ +   +    WQVYK C+P++ +
Sbjct  131  RVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYKNCIPIAPN  186

Query  190  ARRLTNESAVID  201
              RL + S  ++
Sbjct  187  GIRLASISPSMN  198

>PHYKE_2937
Length=366

 Score = 94.0 bits (232),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 79/136 (58%), Gaps = 13/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            + + + SNGY  +R  +D    T   GAD  CG+TN DAT +  P  G+A  S G  H G
Sbjct  73   YTSLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVG  128

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSCTGT-CTLHWYWMGVRYLKNA  174
            PCE+WLD T VL++D+C  A   G   T      +DYSSC+ + C L +YW+  + + ++
Sbjct  129  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSS  188

Query  175  YSWQVYKACVPLSASA  190
              WQVYK CVPL+  A
Sbjct  189  MVWQVYKDCVPLTGPA  204

>PHYSO_533682
Length=278

 Score = 92.8 bits (229),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 70/132 (53%), Gaps = 14/132 (11%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDG  122
            F +++  N +K L+  MD       D     CGFT+ + TPQ IP DG A  S G  H G
Sbjct  66   FTSFKSVNNFKDLKTLMDDTSVYGQD-----CGFTDPNGTPQPIPTDGKATFSRGLIHVG  120

Query  123  PCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRYLKNA  174
            PCE+WLD  +VL+ D+C+      +      + +DYSSC  G C  +  Y +G + L + 
Sbjct  121  PCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDK  180

Query  175  YSWQVYKACVPL  186
              WQ YK C+PL
Sbjct  181  TVWQSYKNCIPL  192

>PPTG_07509
Length=299

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 83/186 (45%), Gaps = 31/186 (17%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLR  77
            P+ DAH  +  P  T+   +   ++  +  ++N      G + VG F    +  G     
Sbjct  17   PIADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  74

Query  78   AFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTR  132
              +D  K       D  CG+T  D  P+ IP    ++       G+TH GPCE+++D   
Sbjct  75   VVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  133  VLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            VL  DNC E   G         +  +D+SSC G CTL  YW+G    +NA  WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLG---FQNAQ-WQAYVNCV  183

Query  185  PLSASA  190
            PL  S 
Sbjct  184  PLQGSG  189

>PHALS_05392
Length=367

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 70/136 (51%), Gaps = 14/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDG  122
            F     +N +K +R+ MDG      D     CG+T+ + TP A P +G A  S G  H G
Sbjct  150  FKELATANNFKDVRSLMDGNPVYGED-----CGYTDPNGTPVAPPSNGEATFSRGIVHAG  204

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSCTGT-CTLHWYWMGVRYLKNA  174
            PCE+WLD   VL +D+C  A   G   TI      DYSSC    C L +YW+ ++ L   
Sbjct  205  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGK  264

Query  175  YSWQVYKACVPLSASA  190
              WQ YK C+PL+  A
Sbjct  265  TVWQAYKNCIPLNGPA  280

>PHYKE_2809
Length=291

 Score = 92.4 bits (228),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 70/134 (52%), Gaps = 13/134 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDG  122
            +   + +N  K +R  +D    T   G D  CGFT+  ATP+  P DG A  S G  H G
Sbjct  54   YKELKAANNVKDIRTMLDSD--TKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAG  109

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD   VL +D+C  A   G   TI      DYSSC  G C   +YW+ ++ L   
Sbjct  110  PCEIWLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGK  169

Query  175  YSWQVYKACVPLSA  188
              WQVYK CVPLS 
Sbjct  170  KFWQVYKNCVPLSG  183

>PHYRA_73583
Length=630

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 75/139 (54%), Gaps = 13/139 (9%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYT  119
            V  +   + SN  K +R  +D    T   GA+  CG+TN DA+P+  P  G+A  S G  
Sbjct  64   VALYKELKASNNAKDIRTLLDSD--TTLYGAN--CGYTNPDASPKDPPSTGDATFSRGIV  119

Query  120  HDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C   +YW+ ++ L
Sbjct  120  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  179

Query  172  KNAYSWQVYKACVPLSASA  190
                 WQVYK C+PLS  A
Sbjct  180  DGKTWWQVYKNCIPLSGPA  198

 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 77/147 (52%), Gaps = 14/147 (10%)

Query  54   ENQGFE-TVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GN  111
            E +G E  V  +   + SN  K +R  +D    T   GAD  CGFT+  ATP+  P  G+
Sbjct  357  EAKGDEGLVALYKELKASNNIKDIRTMIDSD--TKLYGAD--CGFTDPKATPKDPPSTGD  412

Query  112  AMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLHW  163
            A  S G  H GPCEVWLD   VL +D+C  A   G   T      IDYSSC  G C   +
Sbjct  413  ATFSRGMVHAGPCEVWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRF  472

Query  164  YWMGVRYLKNAYSWQVYKACVPLSASA  190
            +W+ ++   +   WQVYK CVPLS  A
Sbjct  473  FWLALQRRDSKTWWQVYKNCVPLSGPA  499

>PHYRA_73606
Length=366

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 75/134 (56%), Gaps = 13/134 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            +   + SNGY  +R  +D    T   GAD  CG+TN DAT +  P  G+A  S G  H G
Sbjct  69   YTGLKSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVG  124

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD T VL++D+C  A   G   T      +DYSSC T  C L +YW+  + + + 
Sbjct  125  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSE  184

Query  175  YSWQVYKACVPLSA  188
              WQVYK CVPL+ 
Sbjct  185  IVWQVYKDCVPLTG  198

>PHYCA_534296
Length=309

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 14/136 (10%)

Query  60   TVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGY  118
            +V  F + + +N +K L+  MD      AD     CGFTN   T Q IP DG A  S   
Sbjct  36   SVETFKSLKSANNFKDLKTLMDDTSVYGAD-----CGFTNPSGTAQPIPTDGKATFSRAL  90

Query  119  THDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVRY  170
             H GPCE+WLD T+VL  D+C+     ++      + +DYSSC  G C  + +YW+  + 
Sbjct  91   VHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQG  150

Query  171  LKNAYSWQVYKACVPL  186
            +     WQ YK C+PL
Sbjct  151  VDGKTVWQSYKDCIPL  166

>PHYCA_534473
Length=1050

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (53%), Gaps = 19/139 (14%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYY---CGFTNADATPQAIPD-GNAMRSTGYT  119
            + + + SNGY  +R  +D          D Y   CGFT+ D T +  P  G+A  S G  
Sbjct  841  YASLKESNGYSDIRTLLDS-------DTDLYGANCGFTDPDVTAKDPPTTGDATFSRGMV  893

Query  120  HDGPCEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD T+VL++D+C  A              +DYSSC T  C L +YW+  + +
Sbjct  894  HAGPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGV  953

Query  172  KNAYSWQVYKACVPLSASA  190
             +   WQVYK CVPL+  A
Sbjct  954  DSKIVWQVYKDCVPLTGPA  972

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 68/136 (50%), Gaps = 13/136 (10%)

Query  61   VGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYT  119
            V  +   ++SN  K +R  +D       +     CG T+  A P+  P  G+A  S G  
Sbjct  533  VAMYKQLKKSNNVKDIRTMIDADPKLYGED----CGNTDPKAKPKDPPSTGDATFSRGIV  588

Query  120  HDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYL  171
            H GPCE+WLD   VL +D+C  A   G   TI      DYSSC  G C   +YW+ ++  
Sbjct  589  HAGPCEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRR  648

Query  172  KNAYSWQVYKACVPLS  187
             +   WQVYK C+PL+
Sbjct  649  DSKTLWQVYKNCIPLT  664

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 77/168 (46%), Gaps = 21/168 (13%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGF-ETVGD------FNAWRRSNGYKTLRAF  79
            AH  +  PAP++     +     +      G+ E+ GD      F      N YK +R  
Sbjct  23   AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDPGLLSTFKELAAKNNYKDVRTL  82

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            MDG      D     CGFT+   TP   P DG A  S G  H GPCE+WLD   VL +D+
Sbjct  83   MDGNPVYGED-----CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  137

Query  139  CHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNAYSWQ  178
            C  A   G   TI      DYSSC +G C L +YW+ ++ LK   + Q
Sbjct  138  CQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGGGASQ  185

 Score = 77.8 bits (190),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 13/125 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDG  122
            +   + SN  K +R  +D    T   GAD  CG+TN D TP+  P DG A  S G  H G
Sbjct  273  YKELKASNNAKDIRTLLDSD--TKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAG  328

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD   VL++D+C  A   G   TI      DYSSC +G C   +YW+ ++ L   
Sbjct  329  PCEIWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGG  388

Query  175  YSWQV  179
             + Q 
Sbjct  389  GASQT  393

>PYU1_G005985
Length=200

 Score = 89.7 bits (221),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 86/192 (45%), Gaps = 33/192 (17%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAP-LAFLENQGF----------ETVGDFNAWRRSN  71
            P  +AH  + +P  TY  D   T +   L    N  F          E    F +   + 
Sbjct  19   PQVEAHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKWDGSPQENTQQFTSGFHAA  78

Query  72   GYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGP  123
            GY +L+A +D     VA G    CG +  D  P  +    AM         G+  +H GP
Sbjct  79   GYSSLKALLD----PVAPG----CGNSRVDVPPVGVSRLAAMEFRNDEFHEGFVNSHHGP  130

Query  124  CEVWLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYK  181
            CEVW+D  R+   D+C    +G   TI  ++S C G CTL +YW+ +    +  +WQVYK
Sbjct  131  CEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL----HEPTWQVYK  186

Query  182  ACVPLSASARRL  193
             CVP+    +RL
Sbjct  187  QCVPIENQGKRL  198

>PPTG_07507
Length=299

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 82/186 (44%), Gaps = 31/186 (17%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLR  77
            P  DAH  +  P  T+   +   ++  +  ++N      G + VG F    +  G     
Sbjct  17   PTADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  74

Query  78   AFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTR  132
              +D  K       D  CG+T  D  P+ IP    ++       G+TH GPCE+++D   
Sbjct  75   VVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  133  VLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            VL  DNC E   G         +  +D+SSC G CTL  YW+G    +NA  WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLG---FQNAQ-WQAYVNCV  183

Query  185  PLSASA  190
            PL  S 
Sbjct  184  PLQGSG  189

>PHALS_03179
Length=372

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 76/145 (52%), Gaps = 15/145 (10%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTG  117
            ++V  + + + +N +K L+  M+    T A G +  CGF++    PQ IP DG A  S  
Sbjct  102  QSVKAYQSLKAANNFKDLKTLME----THALGPE--CGFSDPKGKPQPIPKDGKATLSRA  155

Query  118  YTHDGPCEVWLDTTRVLTHDNCHEAISGKDYTI------DYSSC-TGTCT-LHWYWMGVR  169
              H GPCE+WLD  +VL  D+C+     +D  I      DYSSC  G C  + +YW+  +
Sbjct  156  IVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQ  215

Query  170  YLKNAYSWQVYKACVPLSASARRLT  194
             +K    WQ YK C+PL  S   +T
Sbjct  216  GIKGITFWQSYKNCIPLQGSGGGVT  240

>PYVX_14662
Length=540

 Score = 92.4 bits (228),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 81/167 (49%), Gaps = 24/167 (14%)

Query  31   VLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADG  90
            V+   P + +DS D          NQG  +V  + +     G   +R+ +D       D 
Sbjct  44   VVQIEPQWASDSWDGN--------NQG--SVDTYKSLAAEKGVTEIRSLLDDTSIYGQD-  92

Query  91   ADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD--  147
                CGFT+ D T Q IP DG A  S G  H GPCE+WLD T VL  D+C+    G D  
Sbjct  93   ----CGFTDPDGTAQDIPTDGKATFSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQD  148

Query  148  ----YTIDYSSC-TGTC-TLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
                + +DYSSC +G C  + +YW+  + +     WQVYK C+PL  
Sbjct  149  VKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGDTVWQVYKNCIPLKG  195

>PYU1_G007364
Length=316

 Score = 90.9 bits (224),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 23/177 (13%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY  85
            +AH  + +P   ++  +  T      F+        G FN   ++N     +AF    KY
Sbjct  35   NAHGYITVPMAEFSDGAMKTN-----FIAKMDPAFPGKFNDNPQANVDTFTKAFQASGKY  89

Query  86   T----VADGADYYCGFTNADATPQAIP-DG-----NAMRSTGY--THDGPCEVWLDTTRV  133
                 +  G    CG T  DATP+ IP DG     N   + G+  +H GPCE+WLD T V
Sbjct  90   ASLRDLLQGHGEDCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGPCEIWLDDTPV  149

Query  134  LTHDNCHEAISGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            L  +NC     G      +D+SSCTG C + +YW+ ++      +WQ+YK C+PL+ 
Sbjct  150  LKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQIYKNCIPLAG  202

>PYAR_14260
Length=212

 Score = 88.6 bits (218),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 70/137 (51%), Gaps = 12/137 (9%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F+T   + A     G+K LR+F++    T        CG + + A P+ IP DG    ++
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT--------CGNSLSSAKPKPIPSDGMVKFAS  82

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
               H GPCE+WLD T     D+C +   S     +++S+C G+C L +YW+G++   +  
Sbjct  83   TLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGT  140

Query  176  SWQVYKACVPLSASARR  192
             WQ YK CVPL     R
Sbjct  141  RWQSYKNCVPLGGGKSR  157

>PYIW_27477
Length=180

 Score = 87.8 bits (216),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 68/117 (58%), Gaps = 17/117 (15%)

Query  69   RSNGYKTLRAFMD--GAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTHDGPCE  125
            +  G++TLR++++  GAK          CG T+ +A  +AIP  N ++ S    H GPCE
Sbjct  46   KEKGFETLRSYIEDKGAK----------CGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCE  95

Query  126  VWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
            +W+D TRV+  DNC +    K   + ID+S+C G C L W+W+G++   +   WQVY
Sbjct  96   LWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>PPTG_04620
Length=342

 Score = 90.9 bits (224),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 73/137 (53%), Gaps = 15/137 (11%)

Query  61   VGDFNAWRRSNGYKTLRAFMDG-AKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGY  118
            V  +   ++SN  K +R  +DG AK    D     CG T+  ATP+  P  G+A  S G 
Sbjct  66   VALYKELKKSNNVKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPSTGDATFSRGI  120

Query  119  THDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRY  170
             H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C   +YW+ ++ 
Sbjct  121  VHAGPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQR  180

Query  171  LKNAYSWQVYKACVPLS  187
              +   WQVYK C+PLS
Sbjct  181  RDSKTLWQVYKNCIPLS  197

>PHYKE_7717
Length=568

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)

Query  142  AISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            A  GKDYTIDYS+C GTCTL WYW+GVR+LKNAYSWQVYKAC+PL+ 
Sbjct  1    AFPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLTG  47

>PYIW_16810
Length=216

 Score = 88.2 bits (217),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 87/197 (44%), Gaps = 32/197 (16%)

Query  23   PMTDAHQVVLLPAPTYTTDSK-----------DTKYAPLAFLENQGFETVGDFNAWRRSN  71
            P  DAH  + LPAPT+   +K           +TK  P A        T   F A  + N
Sbjct  21   PNVDAHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRA--------TAATFAANYKKN  72

Query  72   GYKTLRAF-MDG---AKY-TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEV  126
            G+K+LRAF MD     KY     G    CGFT+ + TPQ +PD        + H+GPCE 
Sbjct  73   GFKSLRAFIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEA  132

Query  127  WLDTTRVLTHD---NCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKAC  183
            W D   V+        +E  +      D + C G   LH+YW+          +Q Y  C
Sbjct  133  WCDDVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATF----VSPFQAYTNC  188

Query  184  VPL-SASARRLTNESAV  199
            VP+ S +AR L  E ++
Sbjct  189  VPIKSGAARSLDGERSL  205

>PHALS_03177
Length=259

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 15/137 (11%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTG  117
            ++V  F + + +N +K L+  MD        G D  CG+++ +  PQ IP DG A  S  
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMDNPVL----GRD--CGYSDPNGKPQPIPKDGKATFSRA  114

Query  118  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC-TGTCT-LHWYWMGVR  169
              H GPCE+WLD  +VL  D+C+      D      + +DYSSC  G C  + +YW+  +
Sbjct  115  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  174

Query  170  YLKNAYSWQVYKACVPL  186
             +     WQ YK C+PL
Sbjct  175  GINGKTFWQSYKMCIPL  191

>PHYRA_85794
Length=230

 Score = 88.2 bits (217),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 85/191 (45%), Gaps = 30/191 (16%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            +AH  +  P PT+   +    +  +  ++N      G + VG +       G       +
Sbjct  21   EAHGHLNQPQPTFQDGASTVNW--VVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVVL  78

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLT  135
            D        GAD  CGFT  D  PQ +P +G A+       GYTH GPCE+++D   VL 
Sbjct  79   DMV------GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLH  132

Query  136  HDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             DNC     G         +  +DYSSC G CT   YW+G    +NA  WQ Y  CVPLS
Sbjct  133  SDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-QWQAYINCVPLS  188

Query  188  ASARRLTNESA  198
             +      +++
Sbjct  189  GTGETTQTQAS  199

>PHYRA_77971
Length=230

 Score = 88.2 bits (217),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 85/191 (45%), Gaps = 30/191 (16%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            +AH  +  P PT+   +    +  +  ++N      G + VG +       G       +
Sbjct  21   EAHGHLDQPQPTFQDGASTVNW--VVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVVL  78

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLT  135
            D        GAD  CGFT  D  PQ +P +G A+       GYTH GPCE+++D   VL 
Sbjct  79   DMV------GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLH  132

Query  136  HDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             DNC     G         +  +DYSSC G CT   YW+G    +NA  WQ Y  CVPLS
Sbjct  133  SDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-QWQAYINCVPLS  188

Query  188  ASARRLTNESA  198
             +      +++
Sbjct  189  GTGETTQTQAS  199

>PITG_04947
Length=298

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 71/136 (52%), Gaps = 15/136 (11%)

Query  61   VGDFNAWRRSNGYKTLRAFMDG-AKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGY  118
            V  +   ++SN  K +R  +DG AK    D     CG T+  ATP+  P  G+A  S G 
Sbjct  39   VALYKQLKKSNNIKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPTTGDATFSRGI  93

Query  119  THDGPCEVWLDTTRVLTHDNCHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRY  170
             H GPCE+WLD   VL +D+C  A   G   TI      DYSSC +G C   +YW+ ++ 
Sbjct  94   VHAGPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQR  153

Query  171  LKNAYSWQVYKACVPL  186
                  WQVYK C+PL
Sbjct  154  RDQKTLWQVYKNCIPL  169

>PHYRA_86151
Length=170

 Score = 85.5 bits (210),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 0/74 (0%)

Query  50   LAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD  109
            L+FLE +GFET  +F  ++  NGY +LR F+D AKY V+DGAD  CG+++    PQ IP+
Sbjct  29   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  88

Query  110  GNAMRSTGYTHDGP  123
               M  +GYTHD P
Sbjct  89   DGTMSPSGYTHDAP  102

>PHYRA_87941
Length=157

 Score = 85.1 bits (209),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 0/74 (0%)

Query  50   LAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD  109
            L+FLE +GFET  +F  ++  NGY +LR F+D AKY V+DGAD  CG+++    PQ IP+
Sbjct  16   LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  75

Query  110  GNAMRSTGYTHDGP  123
               M  +GYTHD P
Sbjct  76   DGTMSPSGYTHDAP  89

>PHYSO_459106
Length=223

 Score = 86.7 bits (213),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 71/136 (52%), Gaps = 13/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD-GNAMRSTGYTHDG  122
            +   +++N  K +R  +D    T   G D  CGFT+    PQ  P  G+A  S G  H G
Sbjct  67   YKQLKKANNVKDIRTMIDSD--TKLYGED--CGFTDPKGKPQDPPTTGDATFSRGIVHAG  122

Query  123  PCEVWLDTTRVLTHDNCHEAIS-GKDYT------IDYSSC-TGTCTLHWYWMGVRYLKNA  174
            PCE+WLD   VL +D+C  A   G   T      +DYSSC +G C   +YW+ ++   + 
Sbjct  123  PCEIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSK  182

Query  175  YSWQVYKACVPLSASA  190
              WQVYK C+PL+  A
Sbjct  183  TYWQVYKNCIPLTGPA  198

>PHYKE_1913
Length=280

 Score = 87.8 bits (216),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 83/179 (46%), Gaps = 31/179 (17%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            DAH  +  P PT+   +   ++  +  +EN      G + VG +       G       +
Sbjct  21   DAHGHLKSPEPTFEDGAPTVEW--VTLIENYWDIGSGGDQVGKYKTMAAEKGMSVKDVVL  78

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLT  135
            D  K       D  CG+T ADA P+ +P DG A+       G+TH GPCEV+++   VL 
Sbjct  79   DMVK-------DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLH  131

Query  136  HDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
             D+C +   G         +  IDYSSC G CTL  YW+     +NA  WQ Y  CVPL
Sbjct  132  GDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLA---FQNA-QWQAYINCVPL  186

>PYIR_19612
Length=260

 Score = 87.4 bits (215),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 94/187 (50%), Gaps = 36/187 (19%)

Query  23   PMTDAHQVVLLPAPTYTTDSKD------TKYAPL---AFLENQGFETVGDFNAWRRSNGY  73
            P  DAH  ++  +P   T+SK         Y P    ++ + + F T        +  G+
Sbjct  21   PQVDAHGYII--SPKAQTNSKGHPGTFVIVYPPPWAGSWKDPKNFATAA------KEKGF  72

Query  74   KTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTHDGPCEVWLDTTR  132
             TLR++++    T        CGFT+ +  P+AIP    +R S   +H GPCE+W+D  R
Sbjct  73   ATLRSYLEDKGAT--------CGFTDPNVAPRAIPADRKVRFSRDISHPGPCELWIDDKR  124

Query  133  VLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKA------CV  184
            V  +D+C  A +G    + +D++ C+G C + +YW+ ++   +   WQVY++      CV
Sbjct  125  VYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQVYRSELTRDLCV  182

Query  185  PLSASAR  191
            P+S S +
Sbjct  183  PVSGSGK  189

>H257_13550
Length=266

 Score = 87.0 bits (214),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 77/142 (54%), Gaps = 26/142 (18%)

Query  59   ETVGDFN-AWR--RSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAM-  113
            + V  FN A+R  ++ G+KTLRA +D        G D  CG++  D   + IP DGN + 
Sbjct  90   KNVAAFNKAFRDQQATGFKTLRAMLD------PQGPD--CGYSKLDVPAKPIPSDGNVVW  141

Query  114  ----RSTGY--THDGPCEVWLDTTRVLTHDNCHEAISGKD---YTIDYSSCTGTCTLHWY  164
                   G+  +H GPCE+WLD TRV  +D+C      K      +D++SC G+CT+ +Y
Sbjct  142  QNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFY  201

Query  165  WMGVRYLKNAYSWQVYKACVPL  186
            W+ +    +   WQVYK C PL
Sbjct  202  WIAL----HQDLWQVYKNCAPL  219

>PYAR_20617
Length=254

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 79/168 (47%), Gaps = 15/168 (9%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLE---NQGFETVGDFNAWRRSNGYKTLRAFM  80
            + DAH  V L  P        +K + +A  +      F+T   + A  ++ G   LR F+
Sbjct  18   IHDAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFL  77

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNC  139
            +             CG +  DATP+AIP  G    ++   H GPCEVW D       D+C
Sbjct  78   EDKGPV--------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDC  129

Query  140  HEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
             +   S   + +D+S C+G+C L +YW+G++       WQ YK CVPL
Sbjct  130  EKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005871
Length=284

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 91/201 (45%), Gaps = 36/201 (18%)

Query  26   DAHQVVLLPAPTYTTDSKDTKY-APLAFLENQGF----------ETVGDFNAWRRSNGYK  74
            +AH  V  P  TY   S  T Y A +    N+GF          +    F A     GYK
Sbjct  22   EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            +L+  MD A           CG++N +A P  +   +AM+        G+  +H GPCE 
Sbjct  82   SLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  133

Query  127  WLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            W+D TRV  +D+C     G   TI   Y SC GTC L +YW+ +   K    WQ YK+CV
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  185  PLSASA---RRLTNESAVIDF  202
             +  +A    R ++   + DF
Sbjct  190  AIKNNAYSEERSSDPEDLEDF  210

>PYU1_G005872
Length=297

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 91/201 (45%), Gaps = 36/201 (18%)

Query  26   DAHQVVLLPAPTYTTDSKDTKY-APLAFLENQGF----------ETVGDFNAWRRSNGYK  74
            +AH  V  P  TY   S  T Y A +    N+GF          +    F A     GYK
Sbjct  22   EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            +L+  MD A           CG++N +A P  +   +AM+        G+  +H GPCE 
Sbjct  82   SLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  133

Query  127  WLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            W+D TRV  +D+C     G   TI   Y SC GTC L +YW+ +   K    WQ YK+CV
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  185  PLSASA---RRLTNESAVIDF  202
             +  +A    R ++   + DF
Sbjct  190  AIKNNAYSEERSSDPEDLEDF  210

>PHYCA_97965
Length=288

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 84/195 (43%), Gaps = 31/195 (16%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLR  77
            P  +AH  +  P  T+   +   ++  +  ++N      G + VG F    +  G     
Sbjct  20   PDANAHGNLKQPEATFKDGAPTVEW--VTLIDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  77

Query  78   AFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTR  132
              +D  K       D  CG+T  D  PQ IP    ++       G+TH GPCE+++D   
Sbjct  78   VVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKM  130

Query  133  VLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            VL  D+C +   G         + ++D+SSC G CTL  YW+  +  +    WQ Y  CV
Sbjct  131  VLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCV  186

Query  185  PLSASARRLTNESAV  199
            PL         +++V
Sbjct  187  PLQGDGSATQTQTSV  201

>PHYRA_79140
Length=424

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 91/196 (46%), Gaps = 43/196 (22%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNG------YKTLRAF  79
            +AH  +  P P++T+ S            N G+ T+ D N W   +G      YKT+ A 
Sbjct  21   NAHGYLEEPKPSWTSGSA-----------NPGWITMVD-NYWDIGSGGDQCGLYKTMAAE  68

Query  80   MDGAKYTVADGA-----DYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLD  129
                K TV D          CG T+  A+PQ IP DG A        G+TH GPCE++LD
Sbjct  69   K---KMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLD  125

Query  130  TTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYK  181
             T VL  DNC +   G         D  +DYSSC G CTL  YW+     +NA  WQ Y 
Sbjct  126  DTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLA---FQNAQ-WQAYV  181

Query  182  ACVPLSASARRLTNES  197
             CVPLS S      +S
Sbjct  182  NCVPLSGSGSATQTQS  197

>PHYCA_12943
Length=287

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 84/195 (43%), Gaps = 31/195 (16%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLR  77
            P  +AH  +  P  T+   +   ++  +  ++N      G + VG F    +  G     
Sbjct  20   PDANAHGNLKQPEATFKDGAPTVEW--VTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  77

Query  78   AFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTR  132
              +D  K       D  CG+T  D  PQ IP    ++       G+TH GPCE+++D   
Sbjct  78   VVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKM  130

Query  133  VLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            VL  D+C +   G         + ++D+SSC G CTL  YW+  +  +    WQ Y  CV
Sbjct  131  VLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCV  186

Query  185  PLSASARRLTNESAV  199
            PL         +++V
Sbjct  187  PLQGDGSATQTQTSV  201

>PYAP_18221
Length=226

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 71/141 (50%), Gaps = 26/141 (18%)

Query  69   RSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--TH  120
            + +G K+LR  MD  KY         CG TN + TP+ +     M         G+  +H
Sbjct  77   KQSGLKSLRELMD--KYVPG------CGNTNPNTTPRDVTKLKTMTYQNNEYKEGFLNSH  128

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLHWYWMGVRYLKNAYS  176
             GPCEVW+D TRV  +++C  A + K Y     +DYS C GTC L +YW+ +   K    
Sbjct  129  HGPCEVWIDNTRVFQNNDC--AANYKSYPAALPVDYSKCKGTCRLTFYWLALHSQK----  182

Query  177  WQVYKACVPLSASARRLTNES  197
            WQ YK CVP+   A R  +E 
Sbjct  183  WQAYKQCVPIKYGASRSMDEE  203

>PHYCA_69583
Length=224

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (56%), Gaps = 11/104 (11%)

Query  95   CGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT----  149
            CGF+N DA  +  P DG A    G  H GPCE+WLD   VL +D+C +A S  DY     
Sbjct  96   CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKS  155

Query  150  ----IDYSSCTGT-CTLHWYWMGVR-YLKNAYSWQVYKACVPLS  187
                IDYSSC+ + C   +YW+  +      Y WQ+YK C+PL+
Sbjct  156  VFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLT  199

>H310_06362
Length=197

 Score = 84.3 bits (207),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 71/138 (51%), Gaps = 23/138 (17%)

Query  68   RRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DG-----NAMRSTGY--T  119
            + + G+KTLRA +D        G D  CG+T  +   + IP DG     N     G+  +
Sbjct  47   QMATGFKTLRAMLD------PHGPD--CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPS  98

Query  120  HDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGTCTLHWYWMGVRYLKNAYS  176
            H GPCE+WLD TRV  ++NC      K      +D+SSC G+CT+ +YW+ +    +   
Sbjct  99   HTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDL  154

Query  177  WQVYKACVPLSASARRLT  194
            WQVYK C PL   A   T
Sbjct  155  WQVYKNCAPLVGLAASPT  172

>SDRG_16535
Length=313

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 89/191 (47%), Gaps = 24/191 (13%)

Query  23   PMTDAHQVVLLPAPTYTTDSKD-TKY-----APL-----AFLENQGFETVGDFNAWRRSN  71
            P  + H  ++ P PT+   + D TKY      P+     ++ ++  + T   F    R++
Sbjct  13   PFVNGHGFLINPTPTFNELNGDRTKYCGTIDGPVVLPGSSYNQDPAWNTR-QFTMQFRAS  71

Query  72   GYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD----GNAMRSTGYTHDGPCEVW  127
             ++TL +F+D   +         CG TNA+  PQ +P      N       +H+GPCEVW
Sbjct  72   KFQTLASFVDDPSFAPCG----TCGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVW  127

Query  128  LDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             D+TRV  +DNC         +ID + C G   L   W+ +    +  SWQVY  CVPLS
Sbjct  128  CDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPLS  183

Query  188  ASARRLTNESA  198
             S   +   S+
Sbjct  184  GSTIEIPPASS  194

>PPTG_03153
Length=314

 Score = 86.3 bits (212),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 78/177 (44%), Gaps = 20/177 (11%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGF---------ETVGDFNAWRRSNGYKTL  76
            +AH  +  PA  Y T    ++Y         GF         + V  F     S+ YK+L
Sbjct  19   NAHGWLTKPAAVYDTQMDKSQYIGTIESTTSGFKGTFTGAPADNVAAFTKAFESSKYKSL  78

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNA---MRSTGYT--HDGPCEVWLDTT  131
            +A +D     +  GA   CG  +  ATPQ +P         S G+T  H+GPCEVW D  
Sbjct  79   KAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEVWCDKE  138

Query  132  RVLTHDNC--HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            RV   DNC  H   +  +   + S CTG   L  YW+ +    +  SWQVY  C PL
Sbjct  139  RVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----HGPSWQVYVNCAPL  191

>PYAR_14256
Length=199

 Score = 84.0 bits (206),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 67/136 (49%), Gaps = 11/136 (8%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTG  117
            F T   + A     G+K LRAF++    T        CG T  +A P+         ++ 
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGPT--------CGNTLPNAKPKPXXXXLIKLAST  102

Query  118  YTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYS  176
              H GPCE+WLD +     D+C +   S   + +D+S+C G+C L +YW+G++   +   
Sbjct  103  IEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKR  160

Query  177  WQVYKACVPLSASARR  192
            WQ YK C+PL  +  R
Sbjct  161  WQSYKNCIPLGGAQSR  176

>PYU1_G005873
Length=214

 Score = 84.0 bits (206),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 85/186 (46%), Gaps = 33/186 (18%)

Query  26   DAHQVVLLPAPTYTTDSKDTKY-APLAFLENQGF----------ETVGDFNAWRRSNGYK  74
            +AH  +  P   YT  S  T Y A +    N+GF          +    F A     GYK
Sbjct  22   EAHGYISQPKAQYTGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  81

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            +L+  MD A      G    CG++  D  P  +   ++M+        G+  +H GPCE 
Sbjct  82   SLKQMMDKA----VPG----CGYSRTDIAPVDVSRMSSMKFQNNEYKEGFLASHHGPCEG  133

Query  127  WLDTTRVLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            W+D TRV  +D+C     G   TI   + +C GTC L +YW+ +   K    WQ YK+CV
Sbjct  134  WIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSPK----WQAYKSCV  189

Query  185  PLSASA  190
            P+  +A
Sbjct  190  PIKYNA  195

>PHYRA_86016
Length=236

 Score = 84.3 bits (207),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 57/111 (51%), Gaps = 17/111 (15%)

Query  92   DYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  145
            D  CG+T  D  PQ IP    ++       G+TH GPCE+++D T VL  D+C E   G 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  146  -------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
                    +  +DYSSC G CTL  YW+     +NA  WQ Y  CVPL  S
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNAQ-WQAYVNCVPLKGS  125

>PYU1_G005323
Length=251

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 12/132 (9%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F T   + A     GYK L++F++             CG +  DA  + IP DG    ++
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV--------CGNSLPDAKAKPIPSDGVIKLAS  105

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
               H GPCEVW D  R    D+C +   S   + +D+S+C G+C L +YW+G++      
Sbjct  106  TIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGK  163

Query  176  SWQVYKACVPLS  187
             WQ YK C+PL+
Sbjct  164  RWQSYKNCIPLT  175

>PYIW_15526
Length=256

 Score = 84.7 bits (208),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 85/183 (46%), Gaps = 33/183 (18%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKY-APLAFLENQGF----------ETVGDFNAWRRSNGY  73
            T+AH  +  P  TYT     T + A +    N+GF          +   +F A     GY
Sbjct  18   TEAHGFISEPKATYTGGGSYTSFSAEIGADVNKGFSGRIFNRSPEQNAAEFTAAWPKTGY  77

Query  74   KTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCE  125
             +L+  +D +      G    CG+TN +A P  +    +M+        G+  +H GPCE
Sbjct  78   TSLKEMLDKS----VSG----CGYTNPNAAPVDVSGLKSMKYQNNEYKEGFLGSHRGPCE  129

Query  126  VWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKAC  183
             W+D T++   D+C +   G   T  +DYS C GTC L +YW+ V   K    WQVYK C
Sbjct  130  AWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQVYKGC  185

Query  184  VPL  186
            V +
Sbjct  186  VAI  188

>PITG_11936
Length=333

 Score = 85.5 bits (210),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 81/176 (46%), Gaps = 21/176 (12%)

Query  28   HQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETV---------GDFNAWRRSNGYKTLRA  78
            H  +  P   +T +  +T+Y         GF  +          +FN    ++ YK+L+ 
Sbjct  24   HGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASKYKSLKE  83

Query  79   FMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTG------YTHDGPCEVWLDTTR  132
            FM+     V +     CG+TN DATPQ +P      S G       +H+GPCEV+ D TR
Sbjct  84   FMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYCDETR  143

Query  133  VLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            V   DNC +        +  D+ +C G+  L  YW+ +    ++ SWQVY  C PL
Sbjct  144  VFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HSPSWQVYINCAPL  195

>CCA17179
Length=185

 Score = 82.8 bits (203),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query  70   SNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAM------RSTGY--THD  121
            S+ ++ LR F+             YCG TN +A P+ IP  +A+         G+  +H 
Sbjct  43   SSPFQNLRDFLKDK--------GPYCGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHM  94

Query  122  GPCEVWLDTTRVLTHDNCHEAI--SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQV  179
            GPCEVWL+  RV   DNC E    S     ID+S+CT  C L ++W+ +   +    WQV
Sbjct  95   GPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQV  150

Query  180  YKACVPLSASARRLTNESAVID  201
            YK C+P++ +  +L + S  ++
Sbjct  151  YKNCIPIAPNGIKLASISPNMN  172

>PYVX_20783
Length=276

 Score = 84.7 bits (208),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 83/172 (48%), Gaps = 22/172 (13%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAP---LAFLENQGFETVGDF----NAWRRSNGYKTLRAF  79
             H  +++P PT  +D       P   +   E  G  + GD+    + W  +NG  +L+  
Sbjct  22   GHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISSLK--  79

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST-GYTHDGPCEVWLDTTRVLTHD  137
                +Y    G+   CG T  D TPQ +P DG A   T G +H GPCE+W D TRV T  
Sbjct  80   ----EYITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFTST  135

Query  138  NCHEAISGKD---YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            NC    SG+      ID ++CTG+    +YW+ +    +A  WQVY  CV L
Sbjct  136  NCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLAL----HAQPWQVYINCVAL  183

>PHYRA_83494
Length=224

 Score = 83.6 bits (205),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 59/113 (52%), Gaps = 17/113 (15%)

Query  90   GADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            G D  CG T+  A PQA+P DG A        G+TH GPCE+++D   VL  DNC +   
Sbjct  18   GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYP  77

Query  145  G--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
            G         D  +DYSSC G CT   YW+     +NA  WQ Y  CVPL+ S
Sbjct  78   GGDVGSTVTSDMPVDYSSCNGDCTFTIYWLA---FQNAQ-WQAYVNCVPLTGS  126

>PYIR_23585
Length=240

 Score = 84.0 bits (206),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 13/130 (10%)

Query  60   TVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGY  118
            +  DF       G+ T RAF++    T        CG T A+A+P+ IP  N ++ S   
Sbjct  58   SAADFAKTAPGKGFATTRAFLESRGPT--------CGNTLANASPKPIPSDNTVKFSRAI  109

Query  119  THDGPCEVWLDTTRVLTHDNCHEAI--SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYS  176
             H GPCE+W+D TRV  +D+C  A   S   + ID+S+C G+C L +YW+G++       
Sbjct  110  VHPGPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGAR  167

Query  177  WQVYKACVPL  186
            +Q Y  C+ L
Sbjct  168  FQSYSKCLAL  177

>PHALS_04411
Length=262

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 84/178 (47%), Gaps = 21/178 (12%)

Query  27   AHQVVLLPAPTYTTDSKD---TKYAPL---AFLENQGFE-TVGDFNAWRRSNGYKTLRAF  79
            AH  +  P PT+ +   +    +  PL    + +++G E  +  F      N YK +R  
Sbjct  23   AHGYIAKPPPTWKSKETNKWVVEIKPLWDGPWDKSKGDEGLLSTFKELAAKNNYKNVRTL  82

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDN  138
            MDG     A G D  CGFT+    P   P DG A  S G  H GPCE+W +   +L +D+
Sbjct  83   MDG---NPAFGED--CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMILQNDD  137

Query  139  CHEAIS-GKDYTI------DYSSC-TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            C  A   G   TI       YS C +G   L +YW+ ++ L+    WQ YK C+PL+ 
Sbjct  138  CQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIPLTG  195

>PHYRA_86752
Length=300

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 79/182 (43%), Gaps = 31/182 (17%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            DAH  +  P  T+   +   ++  +  ++N      G + VG +               +
Sbjct  21   DAHGNLKEPEATFEDGAPTVEW--VTLIDNYWDIGSGGDQVGKYKTMAAEKKMSVRDVVL  78

Query  81   DGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTRVLT  135
            D  K       D  CG+T  D  PQ IP    ++       G+TH GPCE+++D T VL 
Sbjct  79   DMVK-------DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLH  131

Query  136  HDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             D+C E   G         +  +DYSSC G CTL  YW+     +NA  WQ Y  CVPL 
Sbjct  132  GDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNAQ-WQAYVNCVPLK  187

Query  188  AS  189
             S
Sbjct  188  GS  189

>PHYRA_83500
Length=394

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 69/143 (48%), Gaps = 25/143 (17%)

Query  73   YKTLRAFMDGAKYTVADGA-----DYYCGFTNADATPQAIP-DGNAM----RSTGYTHDG  122
            YKT+ A     K TV D          CG T+  A+PQ IP DG A        G+TH G
Sbjct  62   YKTMAAEK---KMTVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVG  118

Query  123  PCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNA  174
            PCE++LD T VL  DNC +   G         D  +DYSSC G CTL  YW+     +NA
Sbjct  119  PCEIYLDDTMVLHSDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLA---FQNA  175

Query  175  YSWQVYKACVPLSASARRLTNES  197
              WQ Y  C PLS S      +S
Sbjct  176  Q-WQAYVNCAPLSGSGSATQTQS  197

>PYAP_22462
Length=210

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 91/194 (47%), Gaps = 37/194 (19%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPL----AFLENQGFETVGD-------FNAWRRSNGY  73
             DAH  + LP  +Y      T Y  +    A+   QGF+  G        F    R+ G+
Sbjct  27   VDAHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGF  86

Query  74   KTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCE  125
             +LRA +D A    A G    CG +  D  P  +   + M+        G+  +H GPCE
Sbjct  87   SSLRALLDPA----APG----CGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITSHHGPCE  138

Query  126  VWLDTTRVLTHDNCHEAISGKDYT--IDYSSCTG--TCTLHWYWMGVRYLKNAYSWQVYK  181
             W+D TRV   D+C    +G   T  I+Y++C    TC L +YW+ +    +  +WQVYK
Sbjct  139  AWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEANWQVYK  194

Query  182  ACVPL--SASARRL  193
             CVP+    SAR+L
Sbjct  195  QCVPIKRGGSARQL  208

>PHALS_05394
Length=288

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 68/136 (50%), Gaps = 14/136 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDG  122
            F     +N +K+ R+ MDG     AD     CG+T+ + TP   P DG A  S    H G
Sbjct  69   FKELGAANNFKSARSLMDGNPVYGAD-----CGYTDPNGTPVDPPSDGTATFSRPMKHAG  123

Query  123  PCEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTG-TCTLHWYWMGVRYLKNA  174
             CE+W++   VL +D+C  A   K          IDYSSC G  C L +YW+ ++ + + 
Sbjct  124  LCEIWINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDK  183

Query  175  YSWQVYKACVPLSASA  190
              WQ YK C+ +  S+
Sbjct  184  TVWQAYKNCISIKGSS  199

>PHYSO_255056
Length=269

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 58/101 (57%), Gaps = 9/101 (9%)

Query  90   GADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY  148
            GAD  CGF+N DA P+  P DG A    G  H GPCE+WLD T VL +D+C +A S +DY
Sbjct  94   GAD--CGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVEDY  151

Query  149  TIDYSSCTGTCTLHWYWMGVR-YLKNAYSWQVYKACVPLSA  188
                 S  G C   +YW+  +      Y WQ+YK C+PL+ 
Sbjct  152  M----SING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLTG  187

>PYIW_25463
Length=216

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 84/188 (45%), Gaps = 33/188 (18%)

Query  26   DAHQVVLLPAPTYTTDSKDTKY-APLAFLENQGF----------ETVGDFNAWRRSNGYK  74
            +AH  V  P   YT     T + A      N+GF          + V  F A     GYK
Sbjct  21   EAHGFVSQPKAQYTGGGSYTSFSAEFTASVNKGFSGYIFNRSPEQNVQQFTAAWSKTGYK  80

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            +L+  MD        G    CGF+  D     +   ++M+        G+  +H GPCE 
Sbjct  81   SLKELMD----KQVPG----CGFSRTDIAAVDVSGMSSMKFQNNEYKEGFLGSHHGPCEG  132

Query  127  WLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            W+D T+V   D+C ++  G   +  + Y++C GTC L +YW+ +   K    WQ YK CV
Sbjct  133  WIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQK----WQAYKHCV  188

Query  185  PLSASARR  192
            P+ A A R
Sbjct  189  PIKAGAAR  196

>PPTG_18166
Length=445

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 86/187 (46%), Gaps = 32/187 (17%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            DAH  +  P P +  DS +  +  +  ++N      G + VG F    +  G       +
Sbjct  20   DAHGYLKQPEPDWK-DSPNPGW--ITMVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVVL  76

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLT  135
            D  K       D  CG T  + +P+ IP DG       R  G+TH GPCE++LD   VL 
Sbjct  77   DMVK-------DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLH  129

Query  136  HDNCHEA--------ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             D+C E          SG +  +D+SSC G CTL  YW+     +NA  WQ Y  CVPLS
Sbjct  130  GDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLA---FQNAQ-WQTYVNCVPLS  185

Query  188  ASARRLT  194
             S+   T
Sbjct  186  GSSGSTT  192

>PYIR_22134
Length=300

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 86/181 (48%), Gaps = 25/181 (14%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYA-----PLAFLENQGFETVGD-------FNAWRRSNGY  73
            DAH  + +P PT+T     T+++     P       G     D       F A  +++ Y
Sbjct  27   DAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTY  86

Query  74   KTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP----DGNAMRSTGYT--HDGPCEVW  127
             ++RA ++ AK     GA   CG T+A  T Q +P    + +   S G+T  H GPCEVW
Sbjct  87   DSVRALVE-AKGVFISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVW  145

Query  128  LDTTRVLTHDNCHE--AISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVP  185
             D  +V + +NC +    +  +  ID++ C GT  L   W+ +    ++ +WQ+Y  C P
Sbjct  146  CDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIYINCAP  201

Query  186  L  186
            L
Sbjct  202  L  202

>PHYSO_533747
Length=206

 Score = 81.3 bits (199),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 73/132 (55%), Gaps = 15/132 (11%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTG  117
            ++V  F + + +N +K L+  +D       D     CGFT+ + TPQ IP DG A+ S G
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  116

Query  118  YTHDGPCEVWLDTTRVLTHDNC-----HEAISGK-DYTIDYSSC-TGTC-TLHWYWMGVR  169
              H GPCE WLD  +VL  D+C     H  ++ K ++ IDYSSC  G C  + +YW+G +
Sbjct  117  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  176

Query  170  YLKNAYS-WQVY  180
             L +  + WQ Y
Sbjct  177  ALDDKKTVWQTY  188

>PPTG_07516
Length=294

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 64/143 (45%), Gaps = 24/143 (17%)

Query  57   GFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAM--  113
            G + +G F A  +  G       +D  K       D  CG T  +  PQ IP DG     
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  --RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHW  163
                 G+TH GPCE++LD   VL  D+C +   G         D  +D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  164  YWMGVRYLKNAYSWQVYKACVPL  186
            YW+     +NA  WQ Y  CVPL
Sbjct  166  YWLA---FQNAQ-WQTYVNCVPL  184

>PPTG_07520
Length=294

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 64/143 (45%), Gaps = 24/143 (17%)

Query  57   GFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAM--  113
            G + +G F A  +  G       +D  K       D  CG T  +  PQ IP DG     
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  105

Query  114  --RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHW  163
                 G+TH GPCE++LD   VL  D+C +   G         D  +D+SSC G C L  
Sbjct  106  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  165

Query  164  YWMGVRYLKNAYSWQVYKACVPL  186
            YW+     +NA  WQ Y  CVPL
Sbjct  166  YWLA---FQNAQ-WQTYVNCVPL  184

>PHYSO_324715
Length=274

 Score = 82.0 bits (201),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 72/136 (53%), Gaps = 18/136 (13%)

Query  69   RSNGYKT-LRAFMDGAKYTVADGADYYCGFTNADATPQ-AIPDGNAMRSTGYTHDGPCEV  126
            ++ GY+  +R  +DG   T   GAD  CG+++ +A+P+    DG A  S G  H GPCE+
Sbjct  64   KAEGYENNIRKLLDGD--TKLYGAD--CGYSDPNASPKDPSTDGTATFSRGIAHHGPCEI  119

Query  127  WLDTTRVLTHDNCHEAISGKDYT--------IDYSSCTGT-CTLHWYWM---GVRYLKNA  174
            WLD   +L  D+C E     DY         IDYSSC+   C LH+YW+   G     + 
Sbjct  120  WLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNSK  179

Query  175  YSWQVYKACVPLSASA  190
            Y WQ+YK  V L+  A
Sbjct  180  YVWQIYKCYVALTGPA  195

>SPRG_19916
Length=305

 Score = 82.4 bits (202),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 88/190 (46%), Gaps = 33/190 (17%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYA-------PLAFLENQGFETVGDFN-AWRRSNGYK  74
            P+   H ++  P   +T +   T Y        P  F ++     V +FN A++    +K
Sbjct  16   PLVAGHGIISNPLAEFTPNVMRTTYVTRIQANFPGKF-DDSPQTNVANFNKAFKAQTQFK  74

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            TLR  +D        G D  CG T  +   +AIP    M         G+  +H GPCEV
Sbjct  75   TLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFVPSHTGPCEV  126

Query  127  WLDTTRVLTHDNCHEAISGK---DYTIDYSSCTG-TCTLHWYWMGVRYLKNAYSWQVYKA  182
            W+D  RV  +D+C      K   +  IDYSSC+G  C L +YW+ +    +   WQVYK 
Sbjct  127  WIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLAL----HEPMWQVYKN  182

Query  183  CVPLSASARR  192
            CVPL  + ++
Sbjct  183  CVPLEGNGQK  192

>H257_11264
Length=282

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 70/132 (53%), Gaps = 15/132 (11%)

Query  63   DFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR----STGY  118
            +F    + + + +LRAF+D    T  +     CG T AD TP+++P  + ++    S G+
Sbjct  69   EFTRQLKKSSFASLRAFIDAQGNTGGE-----CGLTRADGTPRSLPSDSKVKWAHGSEGF  123

Query  119  --THDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYS  176
              +H+GPCE+W D TRV  +DNC   I      I+ S C G+  L   W+ +    +   
Sbjct  124  VLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQ  179

Query  177  WQVYKACVPLSA  188
            WQVYK CV L++
Sbjct  180  WQVYKNCVRLTS  191

>PYIR_24743
Length=357

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 89/180 (49%), Gaps = 28/180 (16%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83
            M DAH  V  P   +      TKY       +  F+  G FN   ++N     +AF   +
Sbjct  31   MVDAHGYVSSPLAEFKDGVMPTKYTATM---SPAFQ--GKFNDNPQANVDTFTKAFQGQS  85

Query  84   KY-TVAD-----GADYYCGFTNADATPQAIP-DG-----NAMRSTGY--THDGPCEVWLD  129
            ++ T+ D     GAD  CG +  DA+ +AIP DG     N     G+  +H GPCE+WLD
Sbjct  86   EFKTLRDLLKDHGAD--CGDSKPDASRKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLD  143

Query  130  TTRVLTHDNCHEAISGK---DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
              RV + +NC    + K   +  +D+SSC   C L +YW+ +    +  +WQVYK CVPL
Sbjct  144  DKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HEPTWQVYKNCVPL  199

>PYU1_G005868
Length=267

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 22/127 (17%)

Query  70   SNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THD  121
            S+ YK+LR  +D A   V D     CGFT  D TP  +    +M+        G+  +H 
Sbjct  72   SSSYKSLREMLDSA---VPD-----CGFTLTDGTPVDVSSLKSMKWQNDQEQKGFIDSHH  123

Query  122  GPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQV  179
            GPCE+W+D T+++  D+C    +    +  +DYS C G C L +YW+ +    +  +WQ+
Sbjct  124  GPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLAL----HEPNWQI  179

Query  180  YKACVPL  186
            YK CVP+
Sbjct  180  YKQCVPI  186

>H257_11265
Length=282

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (53%), Gaps = 15/131 (11%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR----STGY-  118
            F    + + + +LRAF+D    T  +     CG T AD TP+++P  + ++    S G+ 
Sbjct  70   FTRQLKKSSFASLRAFIDAQGNTGGE-----CGLTRADGTPRSLPSDSKVKWAHGSEGFV  124

Query  119  -THDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSW  177
             +H+GPCE+W D TRV  +DNC   I      I+ S C G+  L   W+ +    +   W
Sbjct  125  LSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQW  180

Query  178  QVYKACVPLSA  188
            QVYK CV L++
Sbjct  181  QVYKNCVRLTS  191

>PYAP_18713
Length=184

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 13/126 (10%)

Query  58   FETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST  116
            F+T   +    +  G+K LR+F++             CG TN +A P+ +P D   + S 
Sbjct  57   FKTGAQYAVVAKDKGFKDLRSFLEDKGPA--------CGKTNPNAKPRNVPSDSKVVFSR  108

Query  117  GYTHDGPCEVWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLHWYWMGVRYLKNA  174
               H GPCE+W+D T V  +D+C      K   + +D+SSC G C L +YW+G++   + 
Sbjct  109  PMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSG  166

Query  175  YSWQVY  180
              WQ Y
Sbjct  167  KRWQSY  172

>PPTG_03156
Length=445

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 83/178 (47%), Gaps = 23/178 (13%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLE--NQGF---------ETVGDFNAWRRSNGYKT  75
            AH  +  PA T++ ++ D K   +A +E  + GF         + V  F     ++ YK+
Sbjct  20   AHGWLSKPAATFSNEAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFATSTYKS  78

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNA---MRSTGYT--HDGPCEVWLDT  130
            L+AF+D        GA   CG    DAT Q +PD        S G+T  H+GPCE W D+
Sbjct  79   LKAFIDDKAKITVTGATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAWCDS  138

Query  131  TRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
             RV   +NC          + Y  S C+G  TL +YWM +       +WQVY  C PL
Sbjct  139  ERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMH----GPTWQVYVNCAPL  192

>PHYKE_5749
Length=300

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 74/179 (41%), Gaps = 30/179 (17%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            DAH  +  P P++  D  D     +  ++N      G + VG F       G       +
Sbjct  21   DAHGYLKEPKPSWK-DGGDGNVGWITQVDNYWDIGSGGDQVGKFKTMAAEKGMSVKDVVL  79

Query  81   DGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLT  135
            D             CG T  D  PQ IP DG A        G+TH GPCE++LD   VL 
Sbjct  80   DMV-------GSQTCGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLH  132

Query  136  HDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
             D+C +   G         D  +DYSSC G C    YW+     +NA  WQ Y  CVPL
Sbjct  133  SDDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWLA---FQNAQ-WQTYINCVPL  187

>SPRG_22161
Length=300

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 33/192 (17%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYA-------PLAFLENQGFETVGDFN-AWRRSNGYK  74
            P+   H ++  P   +T +   T Y        P  F ++     V +FN A++    +K
Sbjct  16   PLVAGHGIISNPLAEFTPNVMRTTYVTRIQANFPGKF-DDSPQTNVANFNKAFKAQTQFK  74

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            TLR  +D        G D  CG T  +   +AIP    M         G+  +H GPCEV
Sbjct  75   TLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFIPSHTGPCEV  126

Query  127  WLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLHWYWMGVRYLKNAYSWQVYKA  182
            W+D  RV  +D+C      K   +  +DYSSC    C L +YW+ +    +   WQVYK 
Sbjct  127  WIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLAL----HEPMWQVYKN  182

Query  183  CVPLSASARRLT  194
            CVPL  + ++ T
Sbjct  183  CVPLKGNGQQPT  194

>PHYCA_18657
Length=295

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 81/184 (44%), Gaps = 30/184 (16%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAF  79
             DAH  +  P+ T+   +    +  +  ++N      G + VG +    +  G       
Sbjct  105  VDAHGHLNQPSSTFQDGASHVNW--VTQIDNFWDIGSGGDQVGKYKTLAKEKGVSVRDVI  162

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVL  134
            +         G D  CGFT  D  P+ +P +G A+       G+TH GPCE+++D   VL
Sbjct  163  LQMV------GNDKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVL  216

Query  135  THDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
              D+C     G         +  +DYSSC G CT   YW+G    +NA  WQ Y  CVPL
Sbjct  217  HSDDCQADYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLG---FQNA-QWQAYINCVPL  272

Query  187  SASA  190
            S + 
Sbjct  273  SGTG  276

>PPTG_03139
Length=320

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 79/176 (45%), Gaps = 21/176 (12%)

Query  28   HQVVLLPAPTYTTDSKDTKYAPLAFLENQGF---------ETVGDFNAWRRSNGYKTLRA  78
            H  + +P   +T +   T+Y       + GF         +   +FN    ++ Y +L+ 
Sbjct  24   HGYMSVPKVEFTFNGDTTQYMATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYSSLKE  83

Query  79   FMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGY------THDGPCEVWLDTTR  132
            FM      V+      CG+TN D TPQ +P+     S G       +H+GPCEVW D TR
Sbjct  84   FMTDKMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVWCDDTR  143

Query  133  VLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            V   DNC +        +  D+ +C G+  L  YW+ +    ++ SWQVY  C  L
Sbjct  144  VFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HSPSWQVYINCAAL  195

>PHYRA_86751
Length=163

 Score = 77.4 bits (189),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 17/102 (17%)

Query  92   DYYCGFTNADATPQAI-PDGNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG-  145
            +Y CG+T  D  P+AI  DG A+       G+TH GPCE++LD T +L  DNC +  SG 
Sbjct  6    EYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGG  65

Query  146  -------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
                    D  IDYSSC G CTL  YW+G +  +    WQ Y
Sbjct  66   ADDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ----WQAY  103

>PHYRA_73581
Length=293

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 50/91 (55%), Gaps = 9/91 (10%)

Query  110  GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT--------IDYSSCTGT-CT  160
            G A  S G  H GPCE+WLD T VL  D+C +     DY         IDYSSC+ + C 
Sbjct  118  GTATFSRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCM  177

Query  161  LHWYWMGVRYLKNAYSWQVYKACVPLSASAR  191
            L +YW+  +   + Y WQ+YK CVPL+  A 
Sbjct  178  LRFYWLAFQGSNDGYVWQIYKHCVPLTGPAE  208

>SPRG_07796
Length=322

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 81/181 (45%), Gaps = 24/181 (13%)

Query  24   MTDAHQVVLLPAPTYTTDSKD-TKYAPL----------AFLENQGFETVGDFNAWRRSNG  72
              D H  ++ P PT+   + D TKY             ++ ++  + T+  F    +++ 
Sbjct  15   FADGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTL-QFTTQFKASP  73

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD----GNAMRSTGYTHDGPCEVWL  128
            ++TL AF+D             CG TNA    Q +P      N       +H+GPCEVW 
Sbjct  74   FRTLAAFVDSQNVASCG----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWC  129

Query  129  DTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            D+TRV  +DNC         +ID + C G   L   W+ +    +  SWQVY  CVPLS 
Sbjct  130  DSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPLSG  185

Query  189  S  189
            S
Sbjct  186  S  186

>PHYRA_80750
Length=275

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 81/174 (47%), Gaps = 22/174 (13%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYA----PL---AFLENQGFETVGDFNAWRRSNGYKT  75
            P  DAH  +L+P   +  DS ++ +     P+   A  +     +V  F A + +N +  
Sbjct  19   PSADAHGYMLIPESQFK-DSANSAWVVQIDPVWDSADWDGNNAGSVDAFKALKTANNFVD  77

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVL  134
            L+  MD    T   GAD  CGFT+   TPQ IP DG A  S    H GPCE+WLD  +V 
Sbjct  78   LKTLMDD---TATFGAD--CGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWLDDKKVF  132

Query  135  THDNCHEAISGKD------YTIDYSSCTGTC--TLHWYWMGVRYLKNAYSWQVY  180
              D+C      ++      + +DYS C G     + +YW+  + +     WQ Y
Sbjct  133  YEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  186

>PHYKE_8390
Length=130

 Score = 75.9 bits (185),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 54/97 (56%), Gaps = 1/97 (1%)

Query  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYTV  87
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W  S+GY +LRA +D  A Y V
Sbjct  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90

Query  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPC  124
             + A + CG T+     Q IP  +  +++GYT DGPC
Sbjct  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PHYCA_98479
Length=276

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 83/180 (46%), Gaps = 31/180 (17%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAF  79
            T  H  +  P+P++  DS + ++  +  ++N      G +  G F       G       
Sbjct  20   TKGHGYLEEPSPSWE-DSPNPEW--VVNVDNYWDIGSGGDQCGLFKTMAEEKGVSVKDVV  76

Query  80   MDGAKYTVADGADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVL  134
            +D        G+   CG T AD + Q +P DG A        G+TH GPCE+++D T VL
Sbjct  77   LDMV------GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVL  130

Query  135  THDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
              DNC +   G         D  +DYSSC G CTL  YW+G    +NA  WQ Y  CVPL
Sbjct  131  HGDNCEDEYPGGDVGSTVTSDMPVDYSSCKGDCTLTIYWLG---FQNA-QWQAYINCVPL  186

>SDRG_08782
Length=450

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 86/189 (46%), Gaps = 33/189 (17%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYA-------PLAFLENQGFETVGDFN-AWRRSNGYK  74
            P+   H +V  P   + +D   TKY        P  F ++     V +FN A++  + +K
Sbjct  15   PLISGHGIVSNPPAEFRSDVMRTKYVATIQANFPGKF-DDSPQTNVANFNKAFKAQSQFK  73

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEV  126
            TLR  +D        G D  CG+T  +   +AIP    M         G+  +H GPCEV
Sbjct  74   TLRDMLD------PHGPD--CGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEV  125

Query  127  WLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLHWYWMGVRYLKNAYSWQVYKA  182
            W+D  RV  +D+C          +  +DYSSC    C L +YW+ +        WQVYK 
Sbjct  126  WIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALH----EPMWQVYKN  181

Query  183  CVPLSASAR  191
            CVPL  + +
Sbjct  182  CVPLKGNGQ  190

>PYVX_16138
Length=559

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 70/147 (48%), Gaps = 14/147 (10%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTG  117
            ++V  + +     G   +R+ +D      AD     CG+T+ D T Q IP D  A  S G
Sbjct  62   DSVDTYVSLAEEKGVTQIRSLLDDTSIYGAD-----CGYTDPDGTAQDIPTDSTATFSRG  116

Query  118  YTHDGPCEVWLDTTRVLTHDNCHEAISGKD------YTIDYSSC--TGTCTLHWYWMGVR  169
              H GPCE+WLD T VL  D+C+    G D      + +DYSSC  +G   + +YW+  +
Sbjct  117  MVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQ  176

Query  170  YLKNAYSWQVYKACVPLSASARRLTNE  196
             + +   WQVY        + R  T +
Sbjct  177  GVDDETVWQVYSVMSAQLTAMRDFTED  203

>PHYRA_83499
Length=473

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 78/183 (43%), Gaps = 31/183 (17%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLEN-----QGFETVGDFNAWRRSNGYKTLRAFM  80
            DAH  +  P  T+   +   ++  L  ++N      G + VG +               +
Sbjct  21   DAHGNLKEPEATFEDGAPTVEWVTL--IDNYWDIGSGGDQVGKYKTMAAEKKMSVRDVVL  78

Query  81   DGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-----STGYTHDGPCEVWLDTTRVLT  135
            D  K       D  CG+T  D  PQ IP    ++       G+TH GPCE+++D T VL 
Sbjct  79   DMVK-------DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLH  131

Query  136  HDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             D+C E   G         +  +DYSSC G CTL  YW+     +NA  WQ Y  CV L 
Sbjct  132  GDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLA---FQNA-QWQAYVNCVSLK  187

Query  188  ASA  190
             S 
Sbjct  188  GSG  190

 Score = 60.8 bits (146),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 12/67 (18%)

Query  122  GPCEVWLDTTRVLTHDNCHEAISG--------KDYTIDYSSCTGTCTLHWYWMGVRYLKN  173
            GPCE++LD T +L  DNC +  SG         D  IDYSSC G CTL  YW+G +  + 
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ-  409

Query  174  AYSWQVY  180
               WQ Y
Sbjct  410  ---WQAY  413

>PPTG_04617
Length=496

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 61/120 (51%), Gaps = 16/120 (13%)

Query  79   FMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHD  137
            F+D   Y    GAD  C +++  A P+  P DG A  S G  H GPCE+WLD   VL  D
Sbjct  57   FIDSKLY----GAD--CEYSDPKADPKTSPSDGTATFSRGIAHHGPCEIWLDDKMVLHDD  110

Query  138  NCHEAISGKDYT--------IDYSSC-TGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188
            +C +     DY         IDYSSC T  C   +YW+  +   N Y  Q+Y+ CVPL+ 
Sbjct  111  DCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVPLTG  170

>PHYRA_77293
Length=302

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 79/158 (50%), Gaps = 23/158 (15%)

Query  40   TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTN  99
            T+S D  +A L + +N    T     ++ +S  +KTLRA MD A           CG T 
Sbjct  43   TESCDPAFAGLKWNDNPEANTAMFTKSFPKSQ-FKTLRALMDTAAPD--------CGNTA  93

Query  100  ADATPQAIPDGNAMR------STGY--THDGPCEVWLDTTRVLTHDNCHEAISG--KDYT  149
               T   +   ++M+        G+  +H GPCE W+D TRV   D+C    +G   +  
Sbjct  94   LTGTAVDVSSLSSMKWQNDQEQKGFIDSHHGPCEAWIDDTRVFQSDDCRADYTGYPAEIP  153

Query  150  IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
            ID+SSC+G CT  +YWM +    +  +WQVYK C P++
Sbjct  154  IDFSSCSGDCTFTFYWMAM----HEPNWQVYKQCAPIA  187

>PYIW_24289
Length=196

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 77/182 (42%), Gaps = 28/182 (15%)

Query  25   TDAHQVVLLPAPTYTTDSKD-----TKYAPLAFLENQGFETVGD-----------FNAWR  68
             D H  + +P PT+TT   +     T   P      +G    G            F++  
Sbjct  23   VDGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTAFSSQT  82

Query  69   RSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYT--HDGPCEV  126
             S  Y+ LR  +D  K   + G D  CGFTN  +  Q +   +A  + G+T  H GPCE+
Sbjct  83   DSIKYRNLRDLID-TKAVFSAGTDKECGFTNVTSAKQPL---SAHATGGFTPTHQGPCEI  138

Query  127  WLDTTRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
            W D   V  +DNC +        + Y  S C G   L +YW+ V  +K    W+ Y  C 
Sbjct  139  WCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCA  194

Query  185  PL  186
            PL
Sbjct  195  PL  196

>PPTG_07521
Length=281

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 58/110 (53%), Gaps = 17/110 (15%)

Query  90   GADYYCGFTNADATPQAIP-DGNAM----RSTGYTHDGPCEVWLDTTRVLTHDNCHEAIS  144
            GA   CG T AD T Q IP DG A        G+TH GPCE++LD   VL  DNC +   
Sbjct  81   GAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYP  140

Query  145  G--------KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            G         D  +DYSSCT  CTL  YW+     +NA +WQ Y  CVPL
Sbjct  141  GGDVGSTVTSDMPVDYSSCTEDCTLTIYWLA---FQNA-NWQAYINCVPL  186

>PYIR_25999
Length=344

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 84/180 (47%), Gaps = 24/180 (13%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYA----PLAFLENQGFETVGD-------FNAWRRSNGYK  74
            DAH  + +P PT+T     T++A      A     G     D       F A  +++ YK
Sbjct  25   DAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESNTKAFTAAIKTSAYK  84

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIP----DGNAMRSTGYT--HDGPCEVWL  128
            ++R  ++ AK  +  GA   CG T+A  TPQ +P    + +   S G+T  H GPCEVW 
Sbjct  85   SVRDLIN-AKGVMMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSHQGPCEVWC  143

Query  129  DTTRVLTHDNCHE--AISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            D     T+DNC +    +  +  ID+S C G   L   W+ +    ++ +WQ Y  C  L
Sbjct  144  DDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLAL----HSPTWQAYINCAVL  199

>PHYSO_262844
Length=276

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 80/157 (51%), Gaps = 23/157 (15%)

Query  40   TDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTN  99
            T+S D  +A L + +N    T     ++  S  +KTLRA MD A       +D  CG T 
Sbjct  43   TESCDPAFAGLKWNDNPEANTAMFTKSFPNSQ-FKTLRAMMDTA------ASD--CGNTA  93

Query  100  ADATPQAIPDGNAMR------STGY--THDGPCEVWLDTTRVLTHDNCHEAISG--KDYT  149
               +P  +   ++M+        G+  +H GPCE W+D TRV   D+C  A +    +  
Sbjct  94   LTGSPVDVSSLSSMKWQNDQEQMGFIDSHHGPCEAWIDDTRVFHSDDCRAAYTSYPAEIP  153

Query  150  IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            IDYS+C+G CT  +YW+ +    +  +WQVYK C P+
Sbjct  154  IDYSACSGDCTFTFYWLAL----HEPNWQVYKQCAPI  186

>PYU1_G001519
Length=265

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 74/176 (42%), Gaps = 19/176 (11%)

Query  26   DAHQVVLLPAPTY-----------TTDSKDTKYAP--LAFLENQGFETVGDFNAWRRSNG  72
            DAH  + LP PT+           T D   T   P  ++F  +    T     A++    
Sbjct  20   DAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQTK  79

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTR  132
            YK+L+         V  GA   CGF++ + TPQ +PD         +H GPCEVW D   
Sbjct  80   YKSLKDLAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVM  139

Query  133  VLTHDNCHEAISGKDYTIDY--SSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            V   DNC   I      + Y  + C G   L  +W+ +    +  +WQ+Y  C P+
Sbjct  140  VFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIAL----HVPTWQIYTNCAPI  191

>SPRG_19917
Length=241

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 73/150 (49%), Gaps = 25/150 (17%)

Query  63   DFN-AWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR----STG  117
            +FN A++  + YKTLRA +D        G D  CG T  +   + IP    M      TG
Sbjct  62   NFNKAFKAQSKYKTLRALLD------QHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTG  113

Query  118  ----YTHDGPCEVWLDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLHWYWMGVR  169
                 +H GPCEVWLD  RV  +D+C      K   +  +DYSSC    C L +YW+ + 
Sbjct  114  EGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIAL-  172

Query  170  YLKNAYSWQVYKACVPLSASARRLTNESAV  199
               ++  WQVYK CVPL    ++   +  V
Sbjct  173  ---HSPRWQVYKNCVPLLGYGQKPAKKPTV  199

>PYAP_24691
Length=145

 Score = 75.1 bits (183),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 3/75 (4%)

Query  120  HDGPCEVWLDTTRVLTHDNCHEAI-SGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQ  178
            H GPCE+W D TRV    +C +   S   + IDYS C G C L +YW+G++       WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQ  60

Query  179  VYKACVPLSASARRL  193
             YK CVP+    R L
Sbjct  61   SYKNCVPIGNGKRML  75

>PHYSO_318683
Length=352

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 85/187 (45%), Gaps = 24/187 (13%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGF-----------ETVGDFNAWRRSNGYK  74
            +AH  + LPA T+  D   T++  +A +E+              E    F     S+ Y 
Sbjct  17   NAHGYLGLPAVTFPNDVDKTQF--IATIESSASGFSGSFSGSPAENTAAFWTAFNSSQYS  74

Query  75   TLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDG---NAMRSTGYT--HDGPCEVWLD  129
            +++ F+      VA+GA+  CG T+ D TPQ +PD        + G+T  H+GPCE W D
Sbjct  75   SIKEFVTDLGQIVANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCEAWCD  134

Query  130  TTRVLTHDNC--HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187
             TRV    +C  H   +      D + C+G   L +YW+ +     + +WQVY  C  L 
Sbjct  135  NTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDCAALE  190

Query  188  ASARRLT  194
              +   T
Sbjct  191  GGSGSYT  197

>PYIW_21964
Length=265

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 35/189 (19%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYA-----PLAFLENQGFETVGD-------FNAWRRS  70
            P+  AH  + +P  T+      T++A     P       G    GD       F A  ++
Sbjct  20   PLVSAHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKA  79

Query  71   NGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDG----NAMRSTGYT--HDGPC  124
            + YK++RA +D  K      A+  CG T+     Q +PD     +   S G+T  H GPC
Sbjct  80   STYKSMRALVDD-KAVFIKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPC  138

Query  125  EVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGTCTLHWYWMGVRYLKNAYSW  177
            EVW D     T +NC       DYT       ID++ C G   L   W+ +    ++ +W
Sbjct  139  EVWCDDKLAFTDENC-----AADYTSAPAELPIDHAKCVGASLLKIVWLAL----HSSTW  189

Query  178  QVYKACVPL  186
            Q+Y  C PL
Sbjct  190  QIYINCAPL  198

>SDRG_17318
Length=241

 Score = 77.0 bits (188),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 82/196 (42%), Gaps = 41/196 (21%)

Query  28   HQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNG------------YKT  75
            H +V  P   +  D   T Y      E Q F   G FN   R N             YKT
Sbjct  21   HGIVSNPFAEFKADVMHTTYV----AEIQAF-LPGKFNGSPRDNAVNFNKAFKAQSKYKT  75

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEVW  127
            LRA +D        G D  CG T  +   + IP    M         G+  +H GPCEVW
Sbjct  76   LRAMLD------PHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTGEGFIPSHTGPCEVW  127

Query  128  LDTTRVLTHDNCHEAISGK---DYTIDYSSCTGT-CTLHWYWMGVRYLKNAYSWQVYKAC  183
            LD  RV  +D+C      K   +  +DYSSC    C L +YW+ +    ++  WQVYK C
Sbjct  128  LDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIAL----HSPRWQVYKNC  183

Query  184  VPLSASARRLTNESAV  199
            VPL    ++   +  V
Sbjct  184  VPLLGYGQKPAKKPTV  199

>PYIR_15187
Length=207

 Score = 76.3 bits (186),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 88/195 (45%), Gaps = 34/195 (17%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKY-APLAFLENQGFE----------TVGDFNAWRRSNG  72
              +AH  + +P  +YT     T Y A L+   N  F+              F A  R+ G
Sbjct  25   QVEAHGYISVPQASYTNSYTKTSYSATLSQSVNPAFQGRKWNGSPEDNTQQFTAGFRAAG  84

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAM--RSTGY------THDGPC  124
            Y +L+  +D A    A G    CG +  D     +   +AM  R+  Y      +H GPC
Sbjct  85   YPSLKTLLDPA----APG----CGNSRLDVPAVDVSRLSAMEFRNDEYHEGFVSSHHGPC  136

Query  125  EVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKA  182
            EVW+D TR   +D+C     G      +++S C   CTL +YW+ +    +  +WQVYK 
Sbjct  137  EVWIDNTRAFHNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLAL----HEPTWQVYKQ  192

Query  183  CVPL-SASARRLTNE  196
            CVP+ +   +RL  +
Sbjct  193  CVPIQNGDGKRLLRQ  207

>SPRG_07825
Length=337

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 83/181 (46%), Gaps = 25/181 (14%)

Query  27   AHQVVLLPAPTYTTDSKD-----------TKYAPLAFLENQGFETVGDFNAWRRSNGYKT  75
            AH  +  P PT+   + D           T     A+ ++ G+     F A  +++ YKT
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYN-AAQFAANFKTSKYKT  77

Query  76   LRAFMDGAKYTVADGADYYCGFTNADA-TPQAIPDGNAMR---STGYT--HDGPCEVWLD  129
            L+AF+D    +   G    CG T  DA  PQ +P     R   + G+T  H+GPCE+W D
Sbjct  78   LKAFLDAWDTSAQCGQ---CGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  134

Query  130  TTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
             TRV  +D+C + I      ID S C G   L   WM +   +    WQ YK CV + ++
Sbjct  135  ETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCVAIGSA  190

Query  190  A  190
             
Sbjct  191  G  191

>SPRG_07826
Length=371

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 80/175 (46%), Gaps = 25/175 (14%)

Query  27   AHQVVLLPAPTYTTDSKD-----------TKYAPLAFLENQGFETVGDFNAWRRSNGYKT  75
            AH  +  P PT+   + D           T     A+ ++ G+     F A  +++ YKT
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYN-AAQFAANFKTSKYKT  77

Query  76   LRAFMDGAKYTVADGADYYCGFTNADA-TPQAIPDGNAMR---STGYT--HDGPCEVWLD  129
            L+AF+D    +   G    CG T  DA  PQ +P     R   + G+T  H+GPCE+W D
Sbjct  78   LKAFLDAWDTSAQCG---QCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  134

Query  130  TTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACV  184
             TRV  +D+C + I      ID S C G   L   WM +   +    WQ YK CV
Sbjct  135  ETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCV  185

>SDRG_00972
Length=333

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 84/181 (46%), Gaps = 25/181 (14%)

Query  27   AHQVVLLPAPTYTTDSKD-----------TKYAPLAFLENQGFETVGDFNAWRRSNGYKT  75
            AH  +  P PT+   + D           T     A+ ++ G+     F A  +++ YKT
Sbjct  18   AHGGLFDPKPTFIEPNSDPTRFCGTIDGPTSLPGSAYNQDPGY-NAAQFAANFKASKYKT  76

Query  76   LRAFMDGAKYTVADGADYYCGFTNADA-TPQAIPDGNAMR---STGYT--HDGPCEVWLD  129
            L+AF+D    +   G    CG T  DA  PQ +P     R   + G+T  H+GPCE+W D
Sbjct  77   LKAFLDAWDTSAQCGQ---CGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWCD  133

Query  130  TTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
             TR+  +D+C + I      ID S C+G   L   WM +   +    WQ YK CV + ++
Sbjct  134  ETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTMLWMALHTPQ----WQAYKNCVAIGSA  189

Query  190  A  190
             
Sbjct  190  G  190

>SDRG_08129
Length=218

 Score = 76.3 bits (186),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 86/190 (45%), Gaps = 33/190 (17%)

Query  24   MTDAHQVVLLPAPTYTTDSKDTKYA-------PLAFLENQGFETVGDF-NAWRRSNGYKT  75
            +   H +V  PA  ++ +   T Y        P  F +    E V  F +A++  + +KT
Sbjct  15   LVAGHGIVSNPAAEFSPNVMRTTYVATIQANLPGKF-DGSPQENVAAFTSAFKVQSQFKT  73

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPCEVW  127
            LR  ++             CG +  +A+ + IP   AM         G+  +H GPCEVW
Sbjct  74   LRDMLEPQGPA--------CGNSLPNASKKTIPSDGAMTWRNPDTGEGFISSHTGPCEVW  125

Query  128  LDTTRVLTHDNCHEAISGKD---YTIDYSSCTG-TCTLHWYWMGVRYLKNAYSWQVYKAC  183
            LD  RV  +D+C      K      +DYSSC G  C L +YW+ +   +    WQVYK C
Sbjct  126  LDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNC  181

Query  184  VPLSASARRL  193
            VPL  + + +
Sbjct  182  VPLQGNGQAV  191

>PHYKE_10295
Length=292

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 22/125 (18%)

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGPC  124
            +KTLRA MD    TVA      CG T    +P  +   ++M+        G+  +H GPC
Sbjct  75   FKTLRALMD----TVAPD----CGNTALTGSPVDVSALSSMKWQNDQEQKGFIDSHHGPC  126

Query  125  EVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKA  182
            E W+D TRV+  D+C         +  IDYSSC+G CT  +YWM +    +  +WQVYK 
Sbjct  127  EAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMAL----HEPNWQVYKQ  182

Query  183  CVPLS  187
            C P++
Sbjct  183  CAPIT  187

>PHYRA_86241
Length=195

 Score = 75.5 bits (184),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (56%), Gaps = 13/104 (13%)

Query  90   GADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDY  148
            GAD  CGF++ +A  +  P DG A    G  H GPCE+WLD T VL +D+C +A S +DY
Sbjct  93   GAD--CGFSDPNAKAKDPPSDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVEDY  150

Query  149  T--------IDYSSCTGT-CTLHWYWMGVR-YLKNAYSWQVYKA  182
                     IDYSSC+ + C   +YW+  +      Y WQ+Y A
Sbjct  151  MSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYSA  194

>PHALS_02044
Length=237

 Score = 76.3 bits (186),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 21/130 (16%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGP  123
            FNA    + YKTL+ F   A   +  GA   CGF+  D  PQ +P+     +  Y+H GP
Sbjct  76   FNA----SKYKTLKEFA-WATQKLEKGASNECGFSLVDGQPQELPEMVEWDAFSYSHMGP  130

Query  124  CEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGTCTLHWYWMGVRYLKNAYS  176
            CEVW D  RV  + NC     G DYT        D +SC G   L  YW+ V  +     
Sbjct  131  CEVWCDDKRVFQNWNC-----GVDYTETPAKLPYDKASCEGAAVLSCYWIAVHTVP----  181

Query  177  WQVYKACVPL  186
            WQ+Y  C P+
Sbjct  182  WQIYTNCAPI  191

>PHYSO_488921
Length=296

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 83/202 (41%), Gaps = 53/202 (26%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLE-NQGFE----------TVGDFNAWRRSNGYKT  75
            AH  +  P  TY + ++ TKY  L     N+GF               FN    + GYK+
Sbjct  19   AHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATGYKS  78

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYT----------------  119
            LR  +D          DY  G +   ATP  +        TGYT                
Sbjct  79   LREMLDPI------APDY--GHSLKTATPVDV--------TGYTEMWWQNDEYKEGFINS  122

Query  120  HDGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLHWYWMGVRYLKNAY  175
            H GPCE W+D  ++  HDNC  A   K Y      DYSSC G C L +YW+ +       
Sbjct  123  HSGPCEAWIDDVKIFHHDNC--AAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP----  176

Query  176  SWQVYKACVPLSASARRLTNES  197
            +WQ+YK CVP++      T  S
Sbjct  177  NWQIYKQCVPITNGGSSTTQSS  198

>PHYKE_2379
Length=285

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 83/179 (46%), Gaps = 21/179 (12%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQ---GFETVGDF----NAWRRSNGYKT  75
            P    H  +++P PT  +D       P   ++     G  + GD+    + W   NG  +
Sbjct  19   PTVFGHGNIIVPPPTGDSDHVYYFGGPAGTIDMPKIIGDASYGDYYEAVDEWFTKNGISS  78

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRST-GYTHDGPCEVWLDTTRV  133
            L+ ++      +++     CG T  D T +AIP DG A   T G +H GPCE+W D TRV
Sbjct  79   LKEYITTYGTNISE-----CGNTLKDGTAEAIPSDGYAEHDTLGNSHPGPCEIWCDDTRV  133

Query  134  LTHDNCHEAISGKD---YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSAS  189
              + NC    SG+      ID S+C  +    +YW+ +    +A  WQVY  CV L  +
Sbjct  134  FNNTNCVTEFSGQSPAKIPIDVSTCKASSEFVFYWLAL----HAQPWQVYINCVALDGT  188

>PHYSO_329293
Length=310

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 83/202 (41%), Gaps = 53/202 (26%)

Query  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLE-NQGFE----------TVGDFNAWRRSNGYKT  75
            AH  +  P  TY + ++ TKY  L     N+GF               FN    + GYK+
Sbjct  19   AHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATGYKS  78

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYT----------------  119
            LR  +D          DY  G +   ATP  +        TGYT                
Sbjct  79   LREMLDPI------APDY--GHSLKTATPVDV--------TGYTEMWWQNDEYKEGFINS  122

Query  120  HDGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSCTGTCTLHWYWMGVRYLKNAY  175
            H GPCE W+D  ++  HDNC  A   K Y      DYSSC G C L +YW+ +       
Sbjct  123  HSGPCEAWIDDVKIFHHDNC--AAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP----  176

Query  176  SWQVYKACVPLSASARRLTNES  197
            +WQ+YK CVP++      T  S
Sbjct  177  NWQIYKQCVPITNGGSSTTQSS  198

>PITG_08202
Length=191

 Score = 75.1 bits (183),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 80/168 (48%), Gaps = 26/168 (15%)

Query  23   PMTDAHQVVLLPAPTYTTDSK-------DTKYAPLAFLENQGFETVGDFNAWRRSNGYKT  75
            P  DAH  +L+P   +   +        D  +A   +  N   ++V  F + + +N +K 
Sbjct  20   PNVDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNA-KSVDTFKSLKAANNFKD  78

Query  76   LRAFMDGAKYTVADGADYYCGFTNADATPQAIP-DGNAMRSTGYTHDGPCEVWLDTTRVL  134
            LR  MD    T   GAD  CGFTN + TPQ IP DG A  S    H GPC +WLD    +
Sbjct  79   LRTLMDD---TSVYGAD--CGFTNPNDTPQPIPSDGKATFSRALVHHGPCGIWLDDKMDI  133

Query  135  THDNCHEAISGKDYTIDYSSCT-GTCT-LHWYWMGVRYLKNAYSWQVY  180
                  ++I    + +DYSSC+ G C  + +YW+  + L     WQ Y
Sbjct  134  ------KSI----FPVDYSSCSNGGCKQMRFYWLAFQGLNKKTVWQSY  171

>PYAP_22257
Length=247

 Score = 75.9 bits (185),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 21/131 (16%)

Query  66   AWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPD------GNAMRSTGY-  118
            A++    +KTL+         V       CG ++    PQ++         N    TG+ 
Sbjct  64   AFKSQKTFKTLKDM-------VEKQLKGSCGKSSGKGKPQSVEGLSDVHWENTEEKTGFV  116

Query  119  -THDGPCEVWLDTTRVLTHDNCHEAISG--KDYTIDYSSCTGTCTLHWYWMGVRYLKNAY  175
             +H GPCE+W+D TRV+  DNC     G      ++YS C G C L +YW+ +    +  
Sbjct  117  SSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLAL----HEP  172

Query  176  SWQVYKACVPL  186
             WQVYK CVP+
Sbjct  173  EWQVYKNCVPI  183

>PYIR_20481
Length=277

 Score = 76.3 bits (186),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 66/130 (51%), Gaps = 32/130 (25%)

Query  72   GYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--THDGP  123
            GYK+L+  +D    +V       CGFT  D  P  +    +M+        G+  +H GP
Sbjct  74   GYKSLKEMLD---LSVPG-----CGFTLTDGAPVDVSGLKSMKWQNDQEQKGFIDSHHGP  125

Query  124  CEVWLDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGTCTLHWYWMGVRYLKNAYS  176
            CEVW+D T+++  D+C       DYT       +DYS C G C L +YW+ +    +  +
Sbjct  126  CEVWIDNTKIMHSDDCRA-----DYTAYPAEIPVDYSKCKGKCQLTFYWLAL----HEPN  176

Query  177  WQVYKACVPL  186
            WQ+YK CVP+
Sbjct  177  WQIYKQCVPI  186

>PYVX_22511
Length=303

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 13/139 (9%)

Query  70   SNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDG------NAMRSTGYTHDGP  123
            ++GY TL+ +++  K T+  GA   CG    DATPQ +P        +       +H GP
Sbjct  31   TSGYSTLKNYVN-VKMTLIPGATEECGLAIPDATPQPLPAKYVEWYHSPTEGLTESHHGP  89

Query  124  CEVWLDTTRVLTHDNC--HEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYK  181
            CE++   TRV  +D+C  H       +  D +SC G   L +YW+ +    + Y WQVY 
Sbjct  90   CEIYCGNTRVFKNDDCSTHYKTIPAQFPYDRASCLGASHLTFYWLTL----HEYQWQVYI  145

Query  182  ACVPLSASARRLTNESAVI  200
             CVPL A++      S  +
Sbjct  146  NCVPLVATSAPANTSSTTV  164

>H310_05432
Length=301

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 80/180 (44%), Gaps = 25/180 (14%)

Query  23   PMTDAHQVVLLPAPTYTTDSKDT----------KYAPLAFLENQGFETVGDFNAWRRSNG  72
            P T +H +++ P PT      D           K  P    ++        F    + + 
Sbjct  16   PWTRSHGILVDPKPTIRDGVPDKTNYCGTIDGYKALPGEKYDDSPEYNTNAFVRQFKKSS  75

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR----STGY--THDGPCEV  126
            + +L+A +     T  +     CG T  D TPQ +P    ++    + GY  +H+GPCEV
Sbjct  76   FTSLKALVHSQPTTCGE-----CGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEV  130

Query  127  WLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
            W D TRV ++DNC   I      I+ ++C G   L + W+ +    +  SWQVY  CVPL
Sbjct  131  WCDATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAM----HTSSWQVYINCVPL  186

>PYAP_18226
Length=226

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 68/137 (50%), Gaps = 27/137 (20%)

Query  69   RSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR------STGY--TH  120
            + +G K+LR  MD  KY         CG TN + TP+ +     M         G+  +H
Sbjct  78   KQSGLKSLRQLMD--KYVPG------CGNTNPNTTPRDVTKLKTMNWQNNEYKEGFLASH  129

Query  121  DGPCEVWLDTTRVLTHDNCHEAISGKDY----TIDYSSC-TGTCTLHWYWMGVRYLKNAY  175
             GPCEVW+D TRV  +++C  A + K Y     +DYS C +  C L +YW+ +   K   
Sbjct  130  RGPCEVWIDNTRVFQNNDC--AGNYKSYPASLPVDYSKCKSSKCMLRFYWLALHSEK---  184

Query  176  SWQVYKACVPLSASARR  192
             WQ YK CVP+   A R
Sbjct  185  -WQAYKQCVPIKYGASR  200

>SDRG_16534
Length=320

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 81/178 (46%), Gaps = 24/178 (13%)

Query  27   AHQVVLLPAPTYTTDSKD-TKYAPL----AFLENQGFETVGDFNAWR-----RSNGYKTL  76
             H  ++ P P +T    D +K+A        L    +E   D+N  +     +++ +KTL
Sbjct  20   GHGHLVDPVPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSFKTL  79

Query  77   RAFMDGAKYTVADGADYYCGFTNADATPQAIPD----GNAMRSTGYTHDGPCEVWLDTTR  132
            +AF+D        G D  CG T+++   Q +P      N       +H GPCE+W D TR
Sbjct  80   KAFLD----AYPTGGD--CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELWCDETR  133

Query  133  VLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
            V   DNC   +     +ID S C+G   L   W+ +   +    WQVYK CV LS  A
Sbjct  134  VFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLSGVA  187

>SPRG_07799
Length=345

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 16/134 (12%)

Query  59   ETVGDFNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADAT-PQAIPDGNAMR---  114
            +   DF    +++ +KTL+  ++    +   G +  CG T  D + PQA+P     R   
Sbjct  64   DNTADFTKHFKASRFKTLKDLIE----SQPSGGE--CGITKLDPSKPQALPSVVRWRHGD  117

Query  115  STGYT--HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLHWYWMGVRYLK  172
            + G+T  H+GPCE+W D TRV  ++NC + I+     ID + C G  TL ++W+ +    
Sbjct  118  NEGFTPSHEGPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----  173

Query  173  NAYSWQVYKACVPL  186
            ++ SWQVYK CV L
Sbjct  174  HSSSWQVYKNCVAL  187

>PYU1_G001525
Length=312

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 76/176 (43%), Gaps = 20/176 (11%)

Query  26   DAHQVVLLPAPTY-----------TTDSKDTKYAP--LAFLENQGFETVGDFNAWRRSNG  72
            DAH  + LP PT+           T D       P  ++F  +    T     A++    
Sbjct  18   DAHSKMALPKPTWNPVWGTNSPSGTIDGPKALTVPGGMSFGTDPTSNTKAFTAAFKAQTK  77

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTR  132
            YK+L+  +  A  TV  G    CGF+    TPQ +PD         +H+GPCE+W D   
Sbjct  78   YKSLKDLV-FATQTVESGTTKECGFSLVSGTPQPLPDVVEWDELTPSHEGPCEIWCDNKL  136

Query  133  VLTHDNCHEAISGKDYTI--DYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186
              +++NC +   G    +  D S CTG   L   W+ +    +  +WQVY  C PL
Sbjct  137  AFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLAL----HTPTWQVYTNCAPL  188

>PYIW_24288
Length=201

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 74/184 (40%), Gaps = 27/184 (15%)

Query  25   TDAHQVVLLPAPTYTTDSKDTKY--------------APLAFLENQGFETVGDFNAWRRS  70
             D H  + +P PT+   +    Y              A + +  N          A+   
Sbjct  23   VDGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPAGMTYSSNGANNARVYERAFGNQ  82

Query  71   NGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP------DGNAMRSTGYTHDGPC  124
            N Y+ LR  +D      A GAD  CGFT+A    Q +P      +    +    TH+GPC
Sbjct  83   NRYRNLRELVDFTAVFSA-GADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPC  141

Query  125  EVWLDTTRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLHWYWMGVRYLKNAYSWQVYKA  182
            EVW D        NC +   G    + Y  S CTG   L +YW+ +    ++  W+VY  
Sbjct  142  EVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYIN  197

Query  183  CVPL  186
            CVPL
Sbjct  198  CVPL  201

>PYIR_24421
Length=213

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 69/134 (51%), Gaps = 13/134 (10%)

Query  64   FNAWRRSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP----DGNAMRSTGYT  119
            F A  +S+ YK++R  ++ AK +   GA   CG +++    Q +P    +     S G+T
Sbjct  42   FTAALKSSSYKSVRDLVN-AKASFISGASKECGISSSSGAKQPLPAQYVEWAHSSSEGFT  100

Query  120  --HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDY--SSCTGTCTLHWYWMGVRYLKNAY  175
              H+GPCEVW D     ++DNC +        + Y  S C+G   L +YW+ +    ++ 
Sbjct  101  PSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----HSS  156

Query  176  SWQVYKACVPLSAS  189
            +WQVY  C PLS +
Sbjct  157  TWQVYINCAPLSGA  170

>PHYKE_6078
Length=317

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 85/186 (46%), Gaps = 37/186 (20%)

Query  26   DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWR-----------RSNGYK  74
            + H  +  PA T+ T +  T++  +A +E       G FN               S+ Y 
Sbjct  22   NGHGYMSDPAVTFLTSNDPTQF--IATIEASDSGLSGTFNGAPADNTAAFTTAFESSSYS  79

Query  75   TLRAFM-DGAKYTVADGADYYCGFTNADATPQAIPDGNA----MRSTGYT--HDGPCEVW  127
            +L+ F+ D A  TV D A   CG  + D   QA+PD         S G+T  H+GPCEVW
Sbjct  80   SLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVW  138

Query  128  LDTTRVLTHDNCHEAISGKDYT-------IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVY  180
             D TRV   D+C       DYT        D+ +C G+ T+  YW+ +     + +WQVY
Sbjct  139  CDDTRVFQDDDC-----AADYTTAPAQLPFDHDACLGSSTVTLYWLALH----SSTWQVY  189

Query  181  KACVPL  186
              C PL
Sbjct  190  VNCAPL  195

>PYAP_18138
Length=268

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 65/116 (56%), Gaps = 15/116 (13%)

Query  69   RSNGYKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIPDGNAMR-STGYTHDGPCEVW  127
            + +G K LR+++D AK T        CG +  D +P+ IP  N +      TH GPCE W
Sbjct  80   KQHGVKDLRSYID-AKIT-------ECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFW  131

Query  128  LDTTRVLTHDNCHEAISGKDYT-IDYSSCTG-TCTLHWYWMGVRYLKNAYSWQVYK  181
            +D TRV  +++C      K    +DYS CTG TC L +YW+G   L+N+  WQVY+
Sbjct  132  IDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLG---LQNS-DWQVYR  183

>PYU1_G001514
Length=469

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 60/127 (47%), Gaps = 23/127 (18%)

Query  73   YKTLRAFMDGAKYTVADGADYYCGFTNADATPQAIP----DGNAMRSTGYT--HDGPCEV  126
            YK++RA +D AK     G D  CG T+A    Q +P    +     S G+T  H GPCEV
Sbjct  83   YKSMRALVD-AKGVFQPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCEV  141

Query  127  WLDTTRVLTHDNCHEAISGKDYTI-------DYSSCTGTCTLHWYWMGVRYLKNAYSWQV  179
            W D TRV   DNC      KDYT        D S C G   L  YW+ +     + +WQ 
Sbjct  142  WCDNTRVFQDDNC-----AKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQA  192

Query  180  YKACVPL  186
            Y  C PL
Sbjct  193  YINCAPL  199

>PHYKE_3912
Length=252

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 13/107 (12%)

Query  95   CGFTNADATPQAIPD-GNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT----  149
            CGFT+ +ATP+  P  G+A  S G  H G CE+WLD T VL+ D+C  A   +D T    
Sbjct  75   CGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDTMVLSSDDCQAAY--RDDTQEKA  132

Query  150  -----IDYSSCTGTC-TLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190
                 ID S C+ +   L +YW+  + + +   WQVYK CVPL+  A
Sbjct  133  SVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCVPLTGPA  179

Lambda      K        H        a         alpha
   0.322    0.134    0.445    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9339317703

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40