Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PHYRA_81105534612012019881e-137
PPTG_17123147532011798614e-118
PHYCA_537323449662001798597e-118
PITG_18452147538561798756e-112
PHYSO_353401534611461467081e-95
HYAP_07096534612511806884e-91
PYVX_18173449665001746871e-87
PYU1_G001739932032661645351e-67
PHYKE_8390534611301095222e-67
PYU1_G001738534612261574902e-61
PYIW_18788932032441654634e-57
PYU1_G001740147522061624389e-54
PYIR_25089854042621664421e-53
PPTG_10635528561991594282e-52
PHYCA_14369109792481594296e-52
PHYRA_84190720132061594241e-51
PYU1_G001741854041991604213e-51
PHYSO_536424606911971694204e-51
PHYSO_507031586531971694204e-51
PHYRA_85631109792281594224e-51
PYU1_G001742932042131604206e-51
PHYSO_341599109791851594169e-51
PYU1_G001744568762131604171e-50
PPTG_10636109792461594202e-50
PHYCA_102624720131951624118e-50
PPTG_10634720132081594083e-49
PPTG_10048213141901654073e-49
PHYCA_102852242061951594048e-49
PPTG_10643457052501594089e-49
PHALS_00498109791991714041e-48
PPTG_15264231281941614021e-48
PPTG_17366239131941614021e-48
PHYCA_102550457052681594082e-48
PHYCA_129425147522041634022e-48
PHYKE_3446231281991594013e-48
PHYKE_7718109792201593999e-48
PHYRA_82864231281931623924e-47
PHYKE_8389147522041633928e-47
PYIW_18791854041941713892e-46
PYIR_26626147522121683902e-46
PHYKE_8388568762051633883e-46
PPTG_17122147522041633859e-46
PHYRA_81107568762021633849e-46
PHYSO_477820568762021663813e-45
PHYRA_81106147522021633796e-45
PHYCA_511409568762041633788e-45
PHALS_03284309411881613708e-44
PHYSO_284086147522041633682e-43
PPTG_17121568762021633665e-43
PYAP_22273932032681403621e-41
PITG_18450147522031633562e-41
PYAR_24096932032271613573e-41
PYVX_18176568762011633459e-40
PYVX_18174854042041643441e-39
PYIR_26546866052391703462e-39
PYAP_22279854042231683409e-39
PYAP_22278932042891713361e-37
PHYCA_510817445761881403255e-37
PPTG_14254445761881403203e-36
PPTG_14255469372681383254e-36
PHYSO_499978231281741383176e-36
PHYSO_501575820771741383176e-36
PHYKE_9185445762811383203e-35
PPTG_0882086622501643175e-35
PHALS_0648053461159733088e-35
PHYSO_417649445761851383031e-33
PHYSO_343376532371721172951e-32
PITG_13520109791711282932e-32
PHYCA_53693413059831383134e-32
PITG_1049986623231603015e-32
PHYSO_262732469371881382864e-31
PHYSO_340369526762001402822e-30
PHYSO_254168462841701502723e-29
PHYSO_527908600641741252593e-27
PHYSO_34159652856231962545e-26
PHYCA_14368528562191672413e-24
PYAP_18131991722261192415e-24
PHYSO_342364529831941262395e-24
PHYRA_73607194343431282343e-22
PHYSO_533903604652081272187e-21
PYIR_1643542333041222221e-20
PHYRA_74651699693441302221e-20
PHYRA_7358442332871302192e-20
PHYCA_13036542352661262182e-20
PHYCA_534473423310501302243e-20
PHYKE_2937571983661352204e-20
PYAP_246891014392521352155e-20
PHYRA_73606571983661332188e-20
PITG_0494842342321262129e-20
PPTG_04647194343271352161e-19
PPTG_04622696962731342131e-19
PHYSO_48395542353201262151e-19
PHYSO_484051571982851332131e-19
PHYKE_2809752822911222122e-19
PPTG_0461842353261272133e-19
PPTG_0461942342761262095e-19
PYVX_14662510865401272146e-19
PYAP_18711943562101222056e-19
PHYCA_531163194343141342098e-19
PITG_0494942353371272108e-19
PYU1_G005323943552511182042e-18
PYU1_G01469042342951242044e-18
PYAP_18709943552351212014e-18
PHALS_0539242353671302055e-18
PYU1_G007476539131951271976e-18
PHYSO_459106194342231301988e-18
PYIR_16443823992751202009e-18
PHYSO_48552442342781262001e-17
PHYCA_534296526713091262011e-17
PYIW_19151831912481741972e-17
PYU1_G005324845341911201932e-17
PYU1_G005326463491911201932e-17
PYU1_G00532842331911201932e-17
PHYKE_600144782891281982e-17
PYU1_G005325943562071201942e-17
PHYKE_391342343211221992e-17
PYIW_27477823991801161922e-17
SPRG_199171339462411411953e-17
PITG_0527144782781261973e-17
SDRG_173181339462411351944e-17
PHYSO_533747604512061261924e-17
PHYSO_340333526712841261965e-17
PHYRA_7358242353261261966e-17
PHYSO_34033244782951261956e-17
PHYRA_7358342346301261952e-16
PHYRA_7868968382961261913e-16
PITG_0494742332981301903e-16
PYAR_14256943551991211863e-16
PYIR_1644442341821221853e-16
PYVX_16138786195591231924e-16
PYIR_16375823732621181875e-16
PPTG_0462042333421291905e-16
PYIR_24743851643571541896e-16
PYU1_G007364851643161271886e-16
PYAR_14260845342121201848e-16
H310_0636217301971271829e-16
PHYKE_10578778802391051841e-15
SDRG_075651244122781411861e-15
PHYSO_438103557212381261841e-15
PHYCA_12727044782791261851e-15
SDRG_081291363312181411822e-15
SDRG_0878217304501771882e-15
SDRG_081371363342821411842e-15
SPRG_19916161733051421852e-15
SPRG_2216117303001351842e-15
PHYSO_533682604462781261833e-15
PYAP_24691101441145681763e-15
PHYCA_69583463492241331794e-15
PHYSO_255056463492691241798e-15
PYAP_1871342341841231758e-15
PYIW_2196497752651281798e-15
PHYSO_246676457051871591751e-14
PYAP_19707995792411061762e-14
PHYCA_1961197755311301802e-14
PHYCA_12942213313531001792e-14
SPRG_076271258855361351802e-14
PPTG_0313997753201511764e-14
PHYRA_78175764333191251764e-14
PYU1_G00152797792781271736e-14
PYU1_G00152397762781271736e-14
PHYCA_19598375713901251756e-14
PHYRA_86016727462361051716e-14
PPTG_1422144782751261729e-14
H257_1355017302661301719e-14
PHYRA_83499204334731111741e-13
PHYRA_86752732363001051721e-13
PHYRA_7862657895473631741e-13
PHYRA_7862554146434631741e-13
SDRG_1731716173122691631e-13
PHYKE_771752856568441741e-13
SDRG_154261258855231431731e-13
PYVX_20789539132901811711e-13
PITG_0889273983091231711e-13
PHYKE_6077188563221301712e-13
PHYCA_112615308831961141672e-13
PYU1_G00152697803341261712e-13
PHYRA_78176597733121281712e-13
PYAR_206171040482541211692e-13
PHYKE_6002526711971201662e-13
PYIW_242881643022011461662e-13
PYAP_18138991732681181692e-13
PHALS_04411944962621271692e-13
PHALS_0317644782071261662e-13
PHYRA_86241728921951261652e-13
PYVX_18179534611471631623e-13
PYVX_1817514752147411623e-13
PHYCA_1047197823091701693e-13
PYIR_23585845342401201664e-13
PYAP_222571003612471531664e-13
PHYRA_77971705552301051664e-13
PHYRA_85794726192301051664e-13
PITG_1193697753331701684e-13
PPTG_0625673983181231685e-13
PHYRA_78161375713731231685e-13
PYAR_16493841752561181665e-13
PHALS_03179308833721271686e-13
CCA1717917291851261626e-13
SPRG_046791244122261501638e-13
PYIR_19612831912601181658e-13
PHYRA_73581696932931311668e-13
PYVX_21297798802631061649e-13
PYAR_18165995792611001649e-13
PYU1_G006404841752721091649e-13
PYIR_24421899032131471621e-12
PHYKE_2454751493741271661e-12
CCI4738117292111281611e-12
PHYKE_902473982991351641e-12
H257_112641259792821811641e-12
PPTG_07509718142991191641e-12
PHYKE_2379539132851271631e-12
PPTG_0750738072991191641e-12
PHYCA_15125371743341201642e-12
PYU1_G00586917302591531622e-12
PHYRA_78174188562791401622e-12
PPTG_0752038142941191632e-12
PPTG_0314497843101341632e-12
PITG_1194497823021581632e-12
PHYCA_98479819502761061622e-12
PHYCA_19612188566101281642e-12
PHYCA_12943369712871251622e-12
PPTG_07516464352941191622e-12
PYVX_2250897752981281622e-12
PHYCA_97965401872881251622e-12
PHALS_03177526712591271612e-12
PHYRA_8063173983201351622e-12
H257_112651431862821811623e-12
SPRG_077951259793351011623e-12
PYVX_211747985295811523e-12
PYAP_18221944962261531593e-12
PHALS_10635341192961271613e-12
PYIR_14463819503691351623e-12
PHYKE_391242332521671603e-12
PYU1_G006403823732521241603e-12
PHYRA_7816297874781221633e-12
PPTG_06253371743031351614e-12
SDRG_17448138489262921604e-12
PHYSO_524101597733081281614e-12
PYIW_1552617302561281594e-12
PHYKE_607897753171281614e-12
PYIR_2048317302871571605e-12
PYU1_G006405371743051171605e-12
PYVX_20783375052761271595e-12
PHYSO_374518539131161061515e-12
PYAP_18226840622261571576e-12
PYU1_G00586817292671311586e-12
PHYRA_8075044782751211586e-12
PHYCA_18729375053911271607e-12
PYAP_1971299581276961587e-12
PYU1_G001524930993001671597e-12
PHYCA_12331697763161221597e-12
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PHYRA_81105

Length=202
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHYRA_81105                                                           385        1e-137
PPTG_17123                                                            336        4e-118
PHYCA_537323                                                          335        7e-118
PITG_18452                                                            341        6e-112
PHYSO_353401                                                          277        1e-95 
HYAP_07096                                                            269        4e-91 
PYVX_18173                                                            269        1e-87 
PYU1_G001739                                                          210        1e-67 
PHYKE_8390                                                            205        2e-67 
PYU1_G001738                                                          193        2e-61 
PYIW_18788                                                            182        4e-57 
PYU1_G001740                                                          173        9e-54 
PYIR_25089                                                            174        1e-53 
PPTG_10635                                                            169        2e-52 
PHYCA_14369                                                           169        6e-52 
PHYRA_84190                                                           167        1e-51 
PYU1_G001741                                                          166        3e-51 
PHYSO_536424                                                          166        4e-51 
PHYSO_507031                                                          166        4e-51 
PHYRA_85631                                                           167        4e-51 
PYU1_G001742                                                          166        6e-51 
PHYSO_341599                                                          164        9e-51 
PYU1_G001744                                                          165        1e-50 
PPTG_10636                                                            166        2e-50 
PHYCA_102624                                                          162        8e-50 
PPTG_10634                                                            161        3e-49 
PPTG_10048                                                            161        3e-49 
PHYCA_102852                                                          160        8e-49 
PPTG_10643                                                            161        9e-49 
PHALS_00498                                                           160        1e-48 
PPTG_15264                                                            159        1e-48 
PPTG_17366                                                            159        1e-48 
PHYCA_102550                                                          161        2e-48 
PHYCA_129425                                                          159        2e-48 
PHYKE_3446                                                            159        3e-48 
PHYKE_7718                                                            158        9e-48 
PHYRA_82864                                                           155        4e-47 
PHYKE_8389                                                            155        8e-47 
PYIW_18791                                                            154        2e-46 
PYIR_26626                                                            154        2e-46 
PHYKE_8388                                                            154        3e-46 
PPTG_17122                                                            152        9e-46 
PHYRA_81107                                                           152        9e-46 
PHYSO_477820                                                          151        3e-45 
PHYRA_81106                                                           150        6e-45 
PHYCA_511409                                                          150        8e-45 
PHALS_03284                                                           147        8e-44 
PHYSO_284086                                                          146        2e-43 
PPTG_17121                                                            145        5e-43 
PYAP_22273                                                            144        1e-41 
PITG_18450                                                            141        2e-41 
PYAR_24096                                                            142        3e-41 
PYVX_18176                                                            137        9e-40 
PYVX_18174                                                            137        1e-39 
PYIR_26546                                                            137        2e-39 
PYAP_22279                                                            135        9e-39 
PYAP_22278                                                            134        1e-37 
PHYCA_510817                                                          129        5e-37 
PPTG_14254                                                            127        3e-36 
PPTG_14255                                                            129        4e-36 
PHYSO_499978                                                          126        6e-36 
PHYSO_501575                                                          126        6e-36 
PHYKE_9185                                                            127        3e-35 
PPTG_08820                                                            126        5e-35 
PHALS_06480                                                           123        8e-35 
PHYSO_417649                                                          121        1e-33 
PHYSO_343376                                                          118        1e-32 
PITG_13520                                                            117        2e-32 
PHYCA_536934                                                          125        4e-32 
PITG_10499                                                            120        5e-32 
PHYSO_262732                                                          114        4e-31 
PHYSO_340369                                                          113        2e-30 
PHYSO_254168                                                          109        3e-29 
PHYSO_527908                                                          104        3e-27 
PHYSO_341596                                                          102        5e-26 
PHYCA_14368                                                           97.4       3e-24 
PYAP_18131                                                            97.4       5e-24 
PHYSO_342364                                                          96.7       5e-24 
PHYRA_73607                                                           94.7       3e-22 
PHYSO_533903                                                          88.6       7e-21 
PYIR_16435                                                            90.1       1e-20 
PHYRA_74651                                                           90.1       1e-20 
PHYRA_73584                                                           89.0       2e-20 
PHYCA_130365                                                          88.6       2e-20 
PHYCA_534473                                                          90.9       3e-20 
PHYKE_2937                                                            89.4       4e-20 
PYAP_24689                                                            87.4       5e-20 
PHYRA_73606                                                           88.6       8e-20 
PITG_04948                                                            86.3       9e-20 
PPTG_04647                                                            87.8       1e-19 
PPTG_04622                                                            86.7       1e-19 
PHYSO_483955                                                          87.4       1e-19 
PHYSO_484051                                                          86.7       1e-19 
PHYKE_2809                                                            86.3       2e-19 
PPTG_04618                                                            86.7       3e-19 
PPTG_04619                                                            85.1       5e-19 
PYVX_14662                                                            87.0       6e-19 
PYAP_18711                                                            83.6       6e-19 
PHYCA_531163                                                          85.1       8e-19 
PITG_04949                                                            85.5       8e-19 
PYU1_G005323                                                          83.2       2e-18 
PYU1_G014690                                                          83.2       4e-18 
PYAP_18709                                                            82.0       4e-18 
PHALS_05392                                                           83.6       5e-18 
PYU1_G007476                                                          80.5       6e-18 
PHYSO_459106                                                          80.9       8e-18 
PYIR_16443                                                            81.6       9e-18 
PHYSO_485524                                                          81.6       1e-17 
PHYCA_534296                                                          82.0       1e-17 
PYIW_19151                                                            80.5       2e-17 
PYU1_G005324                                                          79.0       2e-17 
PYU1_G005326                                                          79.0       2e-17 
PYU1_G005328                                                          79.0       2e-17 
PHYKE_6001                                                            80.9       2e-17 
PYU1_G005325                                                          79.3       2e-17 
PHYKE_3913                                                            81.3       2e-17 
PYIW_27477                                                            78.6       2e-17 
SPRG_19917                                                            79.7       3e-17 
PITG_05271                                                            80.5       3e-17 
SDRG_17318                                                            79.3       4e-17 
PHYSO_533747                                                          78.6       4e-17 
PHYSO_340333                                                          80.1       5e-17 
PHYRA_73582                                                           80.1       6e-17 
PHYSO_340332                                                          79.7       6e-17 
PHYRA_73583                                                           79.7       2e-16 
PHYRA_78689                                                           78.2       3e-16 
PITG_04947                                                            77.8       3e-16 
PYAR_14256                                                            76.3       3e-16 
PYIR_16444                                                            75.9       3e-16 
PYVX_16138                                                            78.6       4e-16 
PYIR_16375                                                            76.6       5e-16 
PPTG_04620                                                            77.8       5e-16 
PYIR_24743                                                            77.4       6e-16 
PYU1_G007364                                                          77.0       6e-16 
PYAR_14260                                                            75.5       8e-16 
H310_06362                                                            74.7       9e-16 
PHYKE_10578                                                           75.5       1e-15 
SDRG_07565                                                            76.3       1e-15 
PHYSO_438103                                                          75.5       1e-15 
PHYCA_127270                                                          75.9       1e-15 
SDRG_08129                                                            74.7       2e-15 
SDRG_08782                                                            77.0       2e-15 
SDRG_08137                                                            75.5       2e-15 
SPRG_19916                                                            75.9       2e-15 
SPRG_22161                                                            75.5       2e-15 
PHYSO_533682                                                          75.1       3e-15 
PYAP_24691                                                            72.4       3e-15 
PHYCA_69583                                                           73.6       4e-15 
PHYSO_255056                                                          73.6       8e-15 
PYAP_18713                                                            72.0       8e-15 
PYIW_21964                                                            73.6       8e-15 
PHYSO_246676                                                          72.0       1e-14 
PYAP_19707                                                            72.4       2e-14 
PHYCA_19611                                                           73.9       2e-14 
PHYCA_12942                                                           73.6       2e-14 
SPRG_07627                                                            73.9       2e-14 
PPTG_03139                                                            72.4       4e-14 
PHYRA_78175                                                           72.4       4e-14 
PYU1_G001527                                                          71.2       6e-14 
PYU1_G001523                                                          71.2       6e-14 
PHYCA_19598                                                           72.0       6e-14 
PHYRA_86016                                                           70.5       6e-14 
PPTG_14221                                                            70.9       9e-14 
H257_13550                                                            70.5       9e-14 
PHYRA_83499                                                           71.6       1e-13 
PHYRA_86752                                                           70.9       1e-13 
PHYRA_78626                                                           71.6       1e-13 
PHYRA_78625                                                           71.6       1e-13 
SDRG_17317                                                            67.4       1e-13 
PHYKE_7717                                                            71.6       1e-13 
SDRG_15426                                                            71.2       1e-13 
PYVX_20789                                                            70.5       1e-13 
PITG_08892                                                            70.5       1e-13 
PHYKE_6077                                                            70.5       2e-13 
PHYCA_112615                                                          68.9       2e-13 
PYU1_G001526                                                          70.5       2e-13 
PHYRA_78176                                                           70.5       2e-13 
PYAR_20617                                                            69.7       2e-13 
PHYKE_6002                                                            68.6       2e-13 
PYIW_24288                                                            68.6       2e-13 
PYAP_18138                                                            69.7       2e-13 
PHALS_04411                                                           69.7       2e-13 
PHALS_03176                                                           68.6       2e-13 
PHYRA_86241                                                           68.2       2e-13 
PYVX_18179                                                            67.0       3e-13 
PYVX_18175                                                            67.0       3e-13 
PHYCA_10471                                                           69.7       3e-13 
PYIR_23585                                                            68.6       4e-13 
PYAP_22257                                                            68.6       4e-13 
PHYRA_77971                                                           68.6       4e-13 
PHYRA_85794                                                           68.6       4e-13 
PITG_11936                                                            69.3       4e-13 
PPTG_06256                                                            69.3       5e-13 
PHYRA_78161                                                           69.3       5e-13 
PYAR_16493                                                            68.6       5e-13 
PHALS_03179                                                           69.3       6e-13 
CCA17179                                                              67.0       6e-13 
SPRG_04679                                                            67.4       8e-13 
PYIR_19612                                                            68.2       8e-13 
PHYRA_73581                                                           68.6       8e-13 
PYVX_21297                                                            67.8       9e-13 
PYAR_18165                                                            67.8       9e-13 
PYU1_G006404                                                          67.8       9e-13 
PYIR_24421                                                            67.0       1e-12 
PHYKE_2454                                                            68.6       1e-12 
CCI47381                                                              66.6       1e-12 
PHYKE_9024                                                            67.8       1e-12 
H257_11264                                                            67.8       1e-12 
PPTG_07509                                                            67.8       1e-12 
PHYKE_2379                                                            67.4       1e-12 
PPTG_07507                                                            67.8       1e-12 
PHYCA_15125                                                           67.8       2e-12 
PYU1_G005869                                                          67.0       2e-12 
PHYRA_78174                                                           67.0       2e-12 
PPTG_07520                                                            67.4       2e-12 
PPTG_03144                                                            67.4       2e-12 
PITG_11944                                                            67.4       2e-12 
PHYCA_98479                                                           67.0       2e-12 
PHYCA_19612                                                           67.8       2e-12 
PHYCA_12943                                                           67.0       2e-12 
PPTG_07516                                                            67.0       2e-12 
PYVX_22508                                                            67.0       2e-12 
PHYCA_97965                                                           67.0       2e-12 
PHALS_03177                                                           66.6       2e-12 
PHYRA_80631                                                           67.0       2e-12 
H257_11265                                                            67.0       3e-12 
SPRG_07795                                                            67.0       3e-12 
PYVX_21174                                                            63.2       3e-12 
PYAP_18221                                                            65.9       3e-12 
PHALS_10635                                                           66.6       3e-12 
PYIR_14463                                                            67.0       3e-12 
PHYKE_3912                                                            66.2       3e-12 
PYU1_G006403                                                          66.2       3e-12 
PHYRA_78162                                                           67.4       3e-12 
PPTG_06253                                                            66.6       4e-12 
SDRG_17448                                                            66.2       4e-12 
PHYSO_524101                                                          66.6       4e-12 
PYIW_15526                                                            65.9       4e-12 
PHYKE_6078                                                            66.6       4e-12 
PYIR_20483                                                            66.2       5e-12 
PYU1_G006405                                                          66.2       5e-12 
PYVX_20783                                                            65.9       5e-12 
PHYSO_374518                                                          62.8       5e-12 
PYAP_18226                                                            65.1       6e-12 
PYU1_G005868                                                          65.5       6e-12 
PHYRA_80750                                                           65.5       6e-12 
PHYCA_18729                                                           66.2       7e-12 
PYAP_19712                                                            65.5       7e-12 
PYU1_G001524                                                          65.9       7e-12 
PHYCA_123316                                                          65.9       7e-12 
PHYRA_78167                                                           65.5       8e-12 
PYIR_24867                                                            65.5       9e-12 
PHYRA_83494                                                           64.3       1e-11 
PHYKE_5749                                                            65.5       1e-11 
PPTG_03153                                                            65.5       1e-11 
PYIR_26867                                                            63.2       1e-11 
PHYCA_6388                                                            65.1       1e-11 
PPTG_04803                                                            64.7       1e-11 
PHYKE_6079                                                            64.7       2e-11 
PYIW_24289                                                            63.2       2e-11 
PYIR_22134                                                            64.7       2e-11 
PITG_11937                                                            64.7       2e-11 
PHYRA_93650                                                           63.5       2e-11 
PYVX_22510                                                            65.1       2e-11 
PHYCA_18657                                                           64.3       3e-11 
PPTG_03160                                                            64.7       3e-11 
PPTG_04617                                                            64.7       3e-11 
PHYRA_84947                                                           63.5       3e-11 
HYAP_11923                                                            64.7       3e-11 
PHYRA_79140                                                           64.3       3e-11 
PPTG_03145                                                            63.9       3e-11 
PYIR_22634                                                            63.5       3e-11 
SPRG_07799                                                            63.9       4e-11 
PYVX_24563                                                            63.2       4e-11 
SDRG_00948                                                            63.9       4e-11 
PPTG_03138                                                            63.5       4e-11 
PYAR_21271                                                            62.8       5e-11 
HYAP_01683                                                            63.5       5e-11 
PHYRA_84732                                                           62.8       6e-11 
PHYSO_374025                                                          63.2       6e-11 
PYIW_18792                                                            60.1       6e-11 
PHALS_05394                                                           62.8       7e-11 
PYIW_19601                                                            62.4       7e-11 
PYU1_G001514                                                          63.2       8e-11 
PPTG_06249                                                            62.8       8e-11 
SPRG_07797                                                            62.8       8e-11 
PYAP_16347                                                            61.2       9e-11 
PYIW_17867                                                            62.8       9e-11 
PHYCA_15124                                                           62.4       1e-10 
PPTG_07521                                                            62.4       1e-10 
PYAR_24818                                                            61.2       1e-10 
PHYSO_246481                                                          62.4       1e-10 
PHYRA_83500                                                           62.8       1e-10 
PPTG_03156                                                            62.8       1e-10 
PYVX_19277                                                            62.0       2e-10 
PHYSO_324715                                                          61.6       2e-10 
SDRG_16534                                                            62.0       2e-10 
PYU1_G005871                                                          61.6       2e-10 
PYAP_16994                                                            61.6       2e-10 
PHYSO_476077                                                          61.2       2e-10 
PHYSO_472009                                                          61.2       2e-10 
PHYKE_1913                                                            61.6       2e-10 
PYU1_G005872                                                          61.6       2e-10 
PHYCA_132255                                                          58.9       2e-10 
SPRG_07825                                                            61.6       2e-10 
PHYRA_78172                                                           61.6       3e-10 
PHYCA_122958                                                          60.8       3e-10 
PHYRA_86751                                                           59.3       3e-10 
H257_11258                                                            61.6       3e-10 
H310_05438                                                            61.2       3e-10 
PYIW_18794                                                            60.5       3e-10 
PITG_20312                                                            60.8       3e-10 
PHYSO_488139                                                          60.8       3e-10 
PITG_08202                                                            59.7       3e-10 
PHYSO_337515                                                          61.2       3e-10 
H310_05432                                                            60.8       3e-10 
PITG_08895                                                            59.7       4e-10 
SPRG_07826                                                            61.2       4e-10 
PITG_20631                                                            60.5       4e-10 
PHYKE_10295                                                           60.8       4e-10 
PPTG_07511                                                            59.3       4e-10 
SDRG_00972                                                            60.8       5e-10 
PPTG_10186                                                            60.5       5e-10 
PHYSO_525076                                                          60.5       6e-10 
PYU1_G001516                                                          60.5       6e-10 
PPTG_10073                                                            58.9       7e-10 
PHYCA_120062                                                          58.9       8e-10 
PYAP_22462                                                            58.9       8e-10 
PPTG_18176                                                            59.7       8e-10 
PYAR_15391                                                            58.2       9e-10 
PYIR_20481                                                            59.7       9e-10 
PHYKE_2539                                                            59.3       9e-10 
PPTG_03140                                                            60.1       9e-10 
PHALS_01293                                                           59.7       1e-09 
PHYKE_6076                                                            59.3       1e-09 
PYIR_17978                                                            58.9       1e-09 
PPTG_18166                                                            59.7       1e-09 
PYIR_16437                                                            59.3       1e-09 
PHYCA_19608                                                           58.9       1e-09 
PYIR_22133                                                            59.3       2e-09 
HYAP_14170                                                            58.9       2e-09 
PYAR_14261                                                            57.0       2e-09 
PHYSO_426658                                                          58.2       2e-09 
PYU1_G005866                                                          57.8       2e-09 
PYU1_G005873                                                          58.2       2e-09 
PYIR_15187                                                            57.8       2e-09 
PYIR_25999                                                            58.9       2e-09 
PHYSO_329293                                                          58.5       2e-09 
PHYSO_488921                                                          58.5       3e-09 
PITG_21641                                                            58.5       3e-09 
PHYSO_318683                                                          58.5       3e-09 
PHYRA_78165                                                           58.2       3e-09 
PHYKE_7446                                                            58.5       3e-09 
PHYRA_78168                                                           58.2       3e-09 
PHYKE_7445                                                            58.2       4e-09 
PPTG_03143                                                            58.2       4e-09 
PYIW_24287                                                            57.8       5e-09 
SDRG_16535                                                            57.8       5e-09 
PYAR_21940                                                            57.4       5e-09 
PHYRA_78177                                                           57.4       6e-09 
PHYRA_78169                                                           57.8       6e-09 
PHYSO_454780                                                          56.2       6e-09 
PYU1_G001518                                                          57.4       6e-09 
PHYSO_262844                                                          57.0       7e-09 
H257_11306                                                            57.4       7e-09 
PYAP_23672                                                            56.6       8e-09 
PHYCA_552912                                                          57.4       8e-09 
PITG_11957                                                            57.0       8e-09 
PHYKE_9023                                                            57.0       8e-09 
PYIW_25463                                                            56.2       8e-09 
PHYCA_103479                                                          57.0       9e-09 
PHYRA_95184                                                           57.4       1e-08 
PHYSO_525121                                                          55.8       1e-08 
PHYKE_6069                                                            56.6       1e-08 
PPTG_03161                                                            57.0       1e-08 
PHYCA_15126                                                           56.6       1e-08 
PPTG_13879                                                            56.6       1e-08 
PPTG_03147                                                            56.2       1e-08 
PHYRA_77291                                                           55.8       1e-08 
PHYCA_14560                                                           56.2       2e-08 
PYU1_G001528                                                          55.8       2e-08 
PHYSO_489485                                                          54.3       2e-08 
H257_11271                                                            56.2       2e-08 
PHYCA_123476                                                          55.8       2e-08 
PPTG_01152                                                            55.5       2e-08 
PYU1_G005878                                                          52.0       2e-08 
PHYSO_255975                                                          54.3       2e-08 
PYIR_20850                                                            54.7       3e-08 
PYIW_18065                                                            55.5       3e-08 
PYVX_22509                                                            55.5       3e-08 
PYIR_23689                                                            54.7       3e-08 
PHALS_05110                                                           54.3       3e-08 
PYAP_20077                                                            54.7       3e-08 
PYU1_G001475                                                          55.1       3e-08 
PHYSO_318693                                                          55.5       3e-08 
PHYKE_10296                                                           55.5       4e-08 
HYAP_01682                                                            55.1       4e-08 
PHYRA_75781                                                           54.3       4e-08 
PYU1_G005985                                                          53.9       4e-08 
PITG_11942                                                            54.7       5e-08 
H310_05433                                                            54.7       5e-08 
PHYSO_375794                                                          52.4       5e-08 
PYIR_22135                                                            54.7       6e-08 
PPTG_01147                                                            54.3       6e-08 
PHYCA_14559                                                           53.9       7e-08 
PPTG_04801                                                            53.9       7e-08 
PHYCA_562062                                                          53.9       8e-08 
PHALS_02044                                                           53.5       8e-08 
PYAR_17163                                                            51.6       8e-08 
PHALS_02295                                                           53.9       8e-08 
PYIR_25334                                                            53.9       8e-08 
PYAP_14265                                                            53.9       9e-08 
PYU1_G001525                                                          53.9       1e-07 
PYAP_16338                                                            53.9       1e-07 
PITG_01966                                                            53.9       1e-07 
PYU1_G005867                                                          52.8       1e-07 
SPRG_07796                                                            53.5       1e-07 
PHYCA_19606                                                           53.5       1e-07 
PHALS_02041                                                           53.1       1e-07 
PYVX_23997                                                            52.4       1e-07 
PHALS_02037                                                           53.5       2e-07 
PHYRA_86201                                                           53.1       2e-07 
PYIW_18790                                                            50.1       2e-07 
PHYRA_78164                                                           53.1       2e-07 
PHYRA_77293                                                           53.1       2e-07 
PHALS_08575                                                           53.1       2e-07 
PYAR_25093                                                            52.4       2e-07 
PHYRA_79881                                                           52.8       2e-07 
PYIW_23030                                                            52.8       2e-07 
PPTG_00483                                                            52.8       2e-07 
PHYCA_12944                                                           51.6       2e-07 
PYIW_25573                                                            52.8       2e-07 
PHYRA_80632                                                           53.1       2e-07 
PYU1_G006672                                                          48.9       2e-07 
PPTG_20376                                                            51.6       3e-07 
PYAP_24338                                                            52.4       3e-07 
PYAR_17166                                                            50.1       3e-07 
PPTG_01153                                                            52.4       3e-07 
PPTG_01148                                                            52.4       3e-07 
PHYCA_10470                                                           52.0       4e-07 
PHYRA_77290                                                           52.4       4e-07 
PITG_01969                                                            52.0       4e-07 
PYU1_G001519                                                          51.6       5e-07 
PYIW_16208                                                            51.2       6e-07 
PHYRA_87941                                                           50.1       6e-07 
PYVX_22511                                                            51.6       6e-07 
PYIW_26655                                                            51.2       7e-07 
PITG_11943                                                            50.1       7e-07 
PHYRA_86151                                                           49.7       1e-06 
PHYSO_324755                                                          50.8       1e-06 
PHYSO_257305                                                          50.1       1e-06 
PYU1_G001520                                                          50.8       1e-06 
PPTG_03148                                                            50.4       1e-06 
PYU1_G007254                                                          49.7       1e-06 
PYAP_23673                                                            50.4       2e-06 
PHYSO_525490                                                          50.4       2e-06 
PHYSO_339832                                                          49.7       2e-06 
PYVX_16673                                                            50.4       2e-06 
PHALS_02296                                                           49.7       2e-06 
PYAP_16337                                                            49.7       2e-06 
PYU1_G005862                                                          48.9       2e-06 
PHALS_01460                                                           49.7       3e-06 
PYIW_16810                                                            48.9       3e-06 
PYAR_17307                                                            48.9       3e-06 
PYAP_18584                                                            48.9       3e-06 
PHYKE_6066                                                            49.3       3e-06 
PYU1_G001517                                                          49.3       3e-06 
PHYSO_256017                                                          47.8       4e-06 
PYAP_23455                                                            49.3       4e-06 
PPTG_06106                                                            48.5       5e-06 
PYU1_G003057                                                          48.1       6e-06 
PYIR_24935                                                            48.5       6e-06 
PYAR_24113                                                            47.8       7e-06 
PPTG_09880                                                            47.8       7e-06 
PYVX_21643                                                            48.1       8e-06 
PHYSO_342361                                                          47.0       9e-06 
PYAP_20456                                                            48.1       1e-05 
PYU1_G001533                                                          47.8       1e-05 
PYU1_G007242                                                          47.8       1e-05 
PYU1_G007250                                                          46.6       1e-05 
PYVX_21644                                                            46.6       2e-05 
PYVX_24274                                                            46.6       2e-05 
PYIW_14247                                                            47.0       2e-05 
PHYCA_19599                                                           47.0       2e-05 
PHYKE_7443                                                            47.0       2e-05 
PITG_11946                                                            46.2       3e-05 
PYAP_20161                                                            46.2       3e-05 
PYIW_14252                                                            46.2       4e-05 
PITG_19818                                                            45.1       4e-05 
PYIR_22549                                                            45.8       4e-05 
PYAR_15390                                                            45.4       4e-05 
PPTG_22744                                                            44.7       6e-05 
PHYCA_559281                                                          44.3       6e-05 
PYAR_22058                                                            45.1       6e-05 
PYIW_20715                                                            45.4       7e-05 
PHYCA_122138                                                          45.1       7e-05 
PHYKE_6067                                                            45.4       7e-05 
PYAR_22574                                                            43.1       8e-05 
PYIR_20482                                                            43.9       1e-04 
PYU1_G003056                                                          44.7       1e-04 

>PHYRA_81105
Length=201

 Score = 385 bits (988),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/201 (100%), Positives = 201/201 (100%), Gaps = 0/201 (0%)

Query  1    MSPSRCTasslllllavllpasIAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAY  60
            MSPSRCTASSLLLLLAVLLPASIAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAY
Sbjct  1    MSPSRCTASSLLLLLAVLLPASIAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAY  60

Query  61   LQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNS  120
            LQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNS
Sbjct  61   LQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNS  120

Query  121  SFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYV  180
            SFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYV
Sbjct  121  SFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYV  180

Query  181  EGAYSWQVYKNCIALGKEATA  201
            EGAYSWQVYKNCIALGKEATA
Sbjct  181  EGAYSWQVYKNCIALGKEATA  201

>PPTG_17123
Length=201

 Score = 336 bits (861),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)

Query  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82
            IAGQRRLDAGLGEGQ+VLHPPPFF+VDGLDFQGMALAYLQEQGVNTSIEAQ WMQQHGY 
Sbjct  23   IAGQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYT  82

Query  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKA  142
            SLR+MLDDESLY+VTEEAIF+CGLTSP+TETQ IPTN+SFQ+SGYTLDGPCEVWLDDTK 
Sbjct  83   SLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV  142

Query  143  AAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            ++GRNCHTEFPHGQH++DYS+CG AC L WYWLGIKY+EG YSWQVYKNC+ L    TA
Sbjct  143  SSGRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTAPTA  201

>PHYCA_537323
Length=200

 Score = 335 bits (859),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)

Query  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82
            + GQRRLDAGLGEGQ+V HPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQ WM+QHGY 
Sbjct  22   VTGQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYT  81

Query  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKA  142
            SLR+MLDDESLYQVTEEAIF+CGLTSPKTETQ IPTN+SFQ+SGYTLDGPCEVWLDDTK 
Sbjct  82   SLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKV  141

Query  143  AAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            +AGRNCHTEFP GQHQ+DYS+CG +C L WYWLGIKYVEG YSWQVYKNC+ LG  ATA
Sbjct  142  SAGRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAATA  200

>PITG_18452
Length=856

 Score = 341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)

Query  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82
            +AGQRRLDAGLGEGQIVLHPPPFF+VDGLDFQGMALAYLQEQG+NTSIEAQ WMQQ GY+
Sbjct  678  VAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYS  737

Query  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKA  142
            SLR+MLDDESLY+VTEEAIF+CGLTSP+TETQ IPTN+SFQ+SGYTLDGPCE+WLDDTK 
Sbjct  738  SLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKV  797

Query  143  AAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            A+GRNCHTEFPHGQHQ+DYS+CG +C L WYWLGIKYVEG YSWQVYKNC+ L K  TA
Sbjct  798  ASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKNPTA  856

>PHYSO_353401
Length=146

 Score = 277 bits (708),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)

Query  56   MALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQL  115
            MALAYLQEQGVNTSIEAQ WMQ+HGYASLR+MLDDESLY+VTEEA+FDCGLTSPKTETQ 
Sbjct  1    MALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQP  60

Query  116  IPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWL  175
            IP+NSSFQ+SGYTLDGPCEVWLDDTK AAGRNCHT+FPHGQH+IDYSACG +C L WYWL
Sbjct  61   IPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWL  120

Query  176  GIKYVEGAYSWQVYKNCIALGKEATA  201
            GIKYVEGAYSWQVYKNC+AL K ATA
Sbjct  121  GIKYVEGAYSWQVYKNCVALSKTATA  146

>HYAP_07096
Length=251

 Score = 269 bits (688),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 2/180 (1%)

Query  23   IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82
            + GQR L + L EGQ+VL+P P FIVD    QG ALAYLQEQG++TSIEAQ W Q+HGY 
Sbjct  73   VTGQR-LTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYV  131

Query  83   SLRSMLDDESLYQVTEEAIFDCGLTSPKTET-QLIPTNSSFQSSGYTLDGPCEVWLDDTK  141
            SLR+MLDD+SLY V+++AIFDCG TS  +ET Q IPTN + +SSGYTLDGPCEVW DDT+
Sbjct  132  SLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQ  191

Query  142  AAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
              +GRNC TEFPHGQHQ+DYS+CG +C LRWYWLGI+Y++G YSWQVYKNCI LG+  TA
Sbjct  192  VTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRNVTA  251

>PYVX_18173
Length=500

 Score = 269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 144/174 (83%), Gaps = 0/174 (0%)

Query  26   QRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLR  85
            QRRLD+GLGEGQ+VL+PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ W+ + GYA+LR
Sbjct  27   QRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLR  86

Query  86   SMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAG  145
            +++DD+ LY VTEE +FDCGLT P TETQ IPTN SF +SGYTLDGPCE+W+D+T A AG
Sbjct  87   ALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAG  146

Query  146  RNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            RNCHTEFP G H IDYS CG +C + W+WLGIKY    YSWQV+KNCI L   A
Sbjct  147  RNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

 Score = 157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G++  +G+ SLR+ +DD+SLY V
Sbjct  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
               A F CG T P    Q IP +   +S+GYT DGPCEVWLDDT+     NCH       
Sbjct  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYSAC  +C L WYWLG++Y++  YSWQVYK C+ +
Sbjct  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393

>PYU1_G001739
Length=266

 Score = 210 bits (535),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 0/164 (0%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +  G+M+Q GYA+LR+++DDE LY+V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
              +A+F+CG T P  E+Q IPT  + +S+GYT DGPCEVWLDD K  +G NCH +FP   
Sbjct  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEAT  200
              +DYS+C  +C LRWYWLG++Y++  YSWQ+YK C++L   A+
Sbjct  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNAS  188

>PHYKE_8390
Length=130

 Score = 205 bits (522),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)

Query  25   GQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASL  84
            GQRRL A LGEGQIVL PPPFFIVDGLDFQGMALAYLQEQGVNTSIE QGWM  HGY SL
Sbjct  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78

Query  85   RSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPC  133
            R+MLDDE+LY+VTEEA+FDCGLTSPKTETQLIPTNS+FQ+SGYT+DGPC
Sbjct  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PYU1_G001738
Length=226

 Score = 193 bits (490),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 114/157 (73%), Gaps = 0/157 (0%)

Query  39   VLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTE  98
            VL+P PF++VDG + Q   +A+L+EQG+ TS +   +M+Q GYA+LR+MLDD+ LY V  
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  99   EAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158
            +A+ +CG T P  E+Q IP  ++F S+GY L+GPCEVWLDD K  +  NCHT++P     
Sbjct  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144

Query  159  IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            +DYS+C  +CMLRWYWLGI+ V   YSWQVYK C++L
Sbjct  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PYIW_18788
Length=244

 Score = 182 bits (463),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 114/165 (69%), Gaps = 3/165 (2%)

Query  39   VLHPPPFFIVDGLDFQGMA-LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVT  97
            V +P PFF++DG D++  A +A L++Q V TS +  G+++Q GYASLR+MLDDE+LY V 
Sbjct  30   VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88

Query  98   EEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQH  157
             ++IF+CG T P  E+Q IPTN   + +GY  DGPCE+W+DD K  +  NC  +FP    
Sbjct  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148

Query  158  QIDYSACGAACMLRWYWLGI-KYVEGAYSWQVYKNCIALGKEATA  201
            ++DYS+C   C LRWY L + K   G+YSW+VYKNC+AL  E TA
Sbjct  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTA  193

>PYU1_G001740
Length=206

 Score = 173 bits (438),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 2/162 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+V+ P P F V   D +   LA+L+ QG  T+ +   + +  GY SLR+ +DD+  Y+V
Sbjct  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
               A F+CG T+     Q IP N  F+++GYT DGPCEVWLD+TK  +G NCH +FP   
Sbjct  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKE  198
            H + Y+AC  +C LRWYW+GI++++G +SWQVYK C+ LG++
Sbjct  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRK  188

>PYIR_25089
Length=262

 Score = 174 bits (442),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 108/166 (65%), Gaps = 0/166 (0%)

Query  30   DAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLD  89
            D  +   Q V+ P P F V     Q   LA+L+ QG  T+ +   + +  GY +LR+ +D
Sbjct  22   DTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMD  81

Query  90   DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCH  149
            D+S Y+V + A F+CG T      Q IP+ S+ +S+GYT DGPCEVWLD T+   G NCH
Sbjct  82   DKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCH  141

Query  150  TEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            +EFP    +IDYS+C  +C+LRWYW+GI++++G YSWQVYKNC+ +
Sbjct  142  SEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPV  187

>PPTG_10635
Length=199

 Score = 169 bits (428),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 103/159 (65%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  D +   LA+L+ QG  T  + + W  ++GY SLR  +D  + Y+V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  70

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP  ++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C  +C LRWYWLG+++++ +YSWQVYK CI L
Sbjct  131  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPL  169

>PHYCA_14369
Length=248

 Score = 169 bits (429),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 100/159 (63%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  D +   LA+L+ QG  T  +   W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP  ++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C   C LRWYWLG+++++ AYSWQVYK CI L
Sbjct  148  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  186

>PHYRA_84190
Length=206

 Score = 167 bits (424),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  D  D +   LA+L+ +G  T  +   W  ++GY SLR  +D+ + Y V
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP +++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  130

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C   C LRWYW+G+++++  YSWQVYK CI L
Sbjct  131  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPL  169

>PYU1_G001741
Length=199

 Score = 166 bits (421),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 100/160 (63%), Gaps = 1/160 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V+ P P F V     Q   LA+L+ QG  T+ +   + +  GY +LR+ +DD+  Y V
Sbjct  28   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
               A F+CG T      Q IP  +  +S+GYT DGPCEVWLD T+   G NCHTEF    
Sbjct  88   ASGADFECGWTKLDGTRQSIPAGT-IRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
            H IDYS+C  +C LRWYW+GI++++G YSWQVYKNC+ +G
Sbjct  147  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIG  186

>PHYSO_536424
Length=197

 Score = 166 bits (420),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 102/169 (60%), Gaps = 1/169 (1%)

Query  27   RRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRS  86
            RR    +   QIVL P P +  +  + +   LA+L+ +G  T  +   W +++GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  87   MLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGR  146
             +D  + Y VT  A F CG T PK   Q IP  +  +S+GYT DGPCEVWLDDT    G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  147  NCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            NCH +FP   + +DYS+C   C LRWYWLG+++++  YSWQVYK CI L
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

>PHYSO_507031
Length=197

 Score = 166 bits (420),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 102/169 (60%), Gaps = 1/169 (1%)

Query  27   RRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRS  86
            RR    +   QIVL P P +  +  + +   LA+L+ +G  T  +   W +++GY SLR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  87   MLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGR  146
             +D  + Y VT  A F CG T PK   Q IP  +  +S+GYT DGPCEVWLDDT    G 
Sbjct  74   FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  147  NCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            NCH +FP   + +DYS+C   C LRWYWLG+++++  YSWQVYK CI L
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

>PHYRA_85631
Length=228

 Score = 167 bits (422),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 100/159 (63%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   LA+L+ +G  T  +   W  ++GY SLR  +D+ + Y V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
             + A F CG T PK   Q IP  ++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C   C LRWYWLGI++++  YSWQVYK CI L
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  186

>PYU1_G001742
Length=213

 Score = 166 bits (420),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 1/160 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V+ P P F V     Q   LA+L+ QG  T+++   + +  GY +LR+ +DD   Y+V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
               A F CG T    + Q IP   + +S+GYT DGPCEVWLD T+   G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
             +IDYS+C  +C LRWYW+GI++++G YSWQVYKNC+ +G
Sbjct  148  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PHYSO_341599
Length=185

 Score = 164 bits (416),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 99/159 (62%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  + +   LA+L+ QG  T  +   W +++GY SLR  +D  + Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  70

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP  +  +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C   C LRWYWLG+++++  YSWQVYK CI L
Sbjct  131  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  169

>PYU1_G001744
Length=213

 Score = 165 bits (417),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 102/160 (64%), Gaps = 1/160 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V+ P P F V     Q   LA+L+ QG  T+ +   + +  GY SLR+ +DD+  Y+V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
               A F CG T    + Q IP   + +S+GYT DGPCEVWLD+T    G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
            H+I Y++C  +C LRWYW+GI++++G YSWQVYKNC+ +G
Sbjct  148  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PPTG_10636
Length=246

 Score = 166 bits (420),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 100/159 (63%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  D +   LA+L+ QG  T  +   W  ++ Y SLR  +D+ + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP  ++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C   C LRWYWLGI++++  YSWQVYK CI L
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  186

>PHYCA_102624
Length=195

 Score = 162 bits (411),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 97/162 (60%), Gaps = 1/162 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D Q   L +L+  G  T  +   W +++GY SLR  +D+   Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            +E A F CG T P    Q IP  ++ +S+GYT DGPCEVW+DDT    G NCH +FP   
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKE  198
            + IDYS C   C L WYWLG+++++  YSWQVYK CI L  E
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSE  189

>PPTG_10634
Length=208

 Score = 161 bits (408),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 100/159 (63%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  + +   LA+L+ +G  T  +   W +++GY SLR  LD+   Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A F CG T PK   Q IP  ++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + +DYS+C   C L WYWLG+++++  YSWQVYK CI L
Sbjct  148  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_10048
Length=190

 Score = 161 bits (407),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 102/165 (62%), Gaps = 1/165 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VLHP P +I D  D Q   LA+L+ QG  T  + + W  Q+GY +LR  ++  + Y V
Sbjct  26   QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A F CG T+PK   Q IP     +S+GYT +GPCE+W+ DT+     NCH   P  +
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  144

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            + IDYS C   C+L WYWLG+++++ +YSWQVYK CI L   +T 
Sbjct  145  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNSTT  189

>PHYCA_102852
Length=195

 Score = 160 bits (404),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 98/159 (62%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  D +   LA+L+ +G  T  +   W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A F CG T P    Q IP  ++ +S+GYT DGPCEVWLDDT    G NCH +FP   
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + IDYS+C   C L W+WLG+++++  YSWQVYK CI L
Sbjct  148  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_10643
Length=250

 Score = 161 bits (408),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 99/159 (62%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  D +   LA+L+ QG     +   W +++GY SLR  +D  + Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T+PK   Q IP     +S+GYT DGPCEV+LDDT    G NCH +FP   
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
              IDYS+C   C LRWYWLGI++++ AYSWQVYK CI L
Sbjct  148  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PHALS_00498
Length=199

 Score = 160 bits (404),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 106/171 (62%), Gaps = 1/171 (1%)

Query  29   LDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSML  88
            L   +   QIVL P P +  +  D +   LA+L+ Q   T+ +AQ + +Q+ + +LR  +
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  89   DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNC  148
            D+   Y V + A   CG T P    Q IP N++ +S+GYT DGPCEVWL++T+  +  NC
Sbjct  81   DNAK-YTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  139

Query  149  HTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            H +FP   + IDYS+C   C+LRWYWLG+++++  YSWQVYK CI L + A
Sbjct  140  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSA  190

>PPTG_15264
Length=194

 Score = 159 bits (402),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 99/161 (61%), Gaps = 3/161 (2%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A + CG T PK   Q IP   + +S+GYT DGPCEVWLDD +   G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  157  HQIDYSAC--GAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + IDYS+C     C+LRWYWLG+++++ +YSWQVYK CI L
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PPTG_17366
Length=194

 Score = 159 bits (402),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 99/161 (61%), Gaps = 3/161 (2%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR  +D  + Y V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A + CG T PK   Q IP   + +S+GYT DGPCEVWLDD +   G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  157  HQIDYSAC--GAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + IDYS+C     C+LRWYWLG+++++ +YSWQVYK CI L
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PHYCA_102550
Length=268

 Score = 161 bits (408),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 96/159 (60%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D Q   LA+L+ QG  T  +   W  ++GY SLR  +D  + Y V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
               A F CG T P    Q IP  ++ +S+GYT DGPCEVW+DDT    G NCH +FP   
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + IDYS C   C L WYWLG+++++ +YSWQVYK CI L
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPL  186

>PHYCA_129425
Length=204

 Score = 159 bits (402),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 2/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW + +GY +LR+ +D    Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A + CG T+ K   Q IP + + +S+GYT DGPCEVWLD T+     NCH  FP   
Sbjct  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + +DYS+C  +CMLRWYWLG ++++  +SWQVYK CI L   A
Sbjct  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189

>PHYKE_3446
Length=199

 Score = 159 bits (401),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 100/159 (63%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  D  + +   LA+L+ QG  T  +A  W + +GY +LR+ +D  + YQV
Sbjct  29   QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A + CG T P    Q IP   + +S+GYT DGPCEVW+D+T+     NCH       
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + IDYSAC   CMLRWYWLG+++++ +YSWQVYK CI L
Sbjct  148  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPL  186

>PHYKE_7718
Length=220

 Score = 158 bits (399),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 97/159 (61%), Gaps = 1/159 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  D  D +   LA+L+ +G     +   W  ++GY SLR  +D+ + Y V
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  91

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A   CG T P    Q IP  ++ +S+GYT DGPCEVW+DDT A    NCH  FP   
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  151

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            + IDYSAC   C LRWYWLG+++++ +YSWQVYK CI L
Sbjct  152  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  190

>PHYRA_82864
Length=193

 Score = 155 bits (392),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 101/162 (62%), Gaps = 2/162 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR  +D  + Y V
Sbjct  29   QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A + CG T P    Q IP   + +S+GYT DGPCEVWLD+T+   G NCH +FP   
Sbjct  88   TEGADYFCGWTDPNGTPQPIPA-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKD  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKE  198
            + IDYS+C   C L WYW+G+++++ +YSWQVYK CI+L  +
Sbjct  147  YPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQ  188

>PHYKE_8389
Length=204

 Score = 155 bits (392),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 97/163 (60%), Gaps = 1/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR+ +D    Y V
Sbjct  28   QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTV  86

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A + CG T+     Q IP+ ++ +S+GYT DGPCEVWLD T+     NCH       
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + IDYS+C   C LRWYWLG+++++  YSWQVYK C+ L   A
Sbjct  147  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189

>PYIW_18791
Length=194

 Score = 154 bits (389),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 105/171 (61%), Gaps = 2/171 (1%)

Query  32   GLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDE  91
            G    Q V  P P + V         L++L++ GV TS    G+M+  GY++LR+++DD 
Sbjct  18   GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  77

Query  92   SLYQVTEEA-IFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHT  150
             LY+    A  F CG T P   +Q+IP +S+ +++GYT  GPCEVW+DD +  AG NCH 
Sbjct  78   KLYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHE  137

Query  151  EFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            +  +   ++DYS C   C +RWYWLG++Y++  +SWQVYKNCIAL  +  A
Sbjct  138  QVSN-TTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGAA  187

>PYIR_26626
Length=212

 Score = 154 bits (390),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 106/168 (63%), Gaps = 2/168 (1%)

Query  30   DAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLD  89
            D+ +   Q V+ P P F     +     LA+L+ QG  T+ +  G+++  GY +LR+ +D
Sbjct  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81

Query  90   DESLYQVTEE-AIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNC  148
            D+  Y+V    A F+CG T+   + Q IP   + +S+GYT DGPCEVWLD+TK  +G NC
Sbjct  82   DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140

Query  149  HTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
            + +FP   H I Y++C  +C LRWYW+G+++++  +SWQVYK C+ +G
Sbjct  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188

>PHYKE_8388
Length=205

 Score = 154 bits (388),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 98/163 (60%), Gaps = 1/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D    +   LA+L++QG +T  +   W   +GYASLR+  DD S Y V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            ++ A F CG T      Q IP +++ +S+GYT DGPCEVWLDDT      NCH       
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + IDYS+C + C L W+W+G++Y++  YSWQVYK C+ L   A
Sbjct  148  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASA  190

>PPTG_17122
Length=204

 Score = 152 bits (385),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 97/163 (60%), Gaps = 2/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +  GW + +GY +LR  +D  + Y V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A + CG T+     Q IP + + +S+GYT DGPCEVWLD  +     NCH       
Sbjct  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + +DYS+C   C LRWYWLG++Y++ AYSWQ+YK CI L   A
Sbjct  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASA  189

>PHYRA_81107
Length=202

 Score = 152 bits (384),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 99/163 (61%), Gaps = 1/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D    +   LA+L++QG +T  +   W +++GY SLR+  DD + Y V
Sbjct  26   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            ++ A F CG T    + Q IP  ++ +S+GYT DGPCEVWLDDT      NCH       
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  144

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + IDYS+C + C L W+W+G++Y+  AYSWQVYK C+ L   A
Sbjct  145  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASA  187

>PHYSO_477820
Length=202

 Score = 151 bits (381),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 97/166 (58%), Gaps = 1/166 (1%)

Query  34   GEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESL  93
            G  Q+VL P P +  D    +   LA+L++QG  T  +   W   +GY SLR+  D  S 
Sbjct  23   GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGAS-  81

Query  94   YQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFP  153
            Y V + A F CG T+   E Q IP +++ +S+GYT DGPCEVWLDDT      NCH    
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  154  HGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
               + IDYS+C + C L W+WLG++Y++  YSWQ+YK C+ L   A
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  187

>PHYRA_81106
Length=202

 Score = 150 bits (379),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 1/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LR+ +D    Y V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
             + A + CG T+     Q IP  ++ +S+GYT DGPCEVWLD T+     NCH       
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + IDYS+C   C L WYW+G++Y++ AYSWQVYK C+ L   A
Sbjct  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190

>PHYCA_511409
Length=204

 Score = 150 bits (378),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D    +   LA+L++QG  T  +   W Q +GY SLR+  +D + Y V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  86

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            ++ A F CG T+   + Q IP  ++ +S+GYT DGPCEVWLDDT      NCH       
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + IDYS+C + C L W+WLG++Y++  YSWQ+YK C+ L   A
Sbjct  147  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASA  189

>PHALS_03284
Length=188

 Score = 147 bits (370),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 98/161 (61%), Gaps = 1/161 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QI+L P P +  +  D +   LA+L+ Q   TS +  G+++++ Y SLR  L   + Y V
Sbjct  15   QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANYTV  73

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            TE A  DCG T P    Q IP  ++ + +GYT DG CE+WLDDTK  +G NCH +FP   
Sbjct  74   TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  133

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGK  197
              +DYS+C   C++ WYWL ++ ++  YSWQVYK CI L +
Sbjct  134  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTR  174

>PHYSO_284086
Length=204

 Score = 146 bits (368),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 96/163 (59%), Gaps = 2/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D    +   LA+L+ QG  T  +   W +  GY +LR+ +D  S Y V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
             + A + CG T  K   Q IP + + +S+GYT DGPCEVWLD T+     NCH  F    
Sbjct  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + +DYS+C  +C LRWYWLG+++++  YSWQVYK C+ L   A
Sbjct  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSA  189

>PPTG_17121
Length=202

 Score = 145 bits (366),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 96/163 (59%), Gaps = 1/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL   P +  D  D +   LA+L++QG  T  +   W + +GY SLR+  D  S Y V
Sbjct  26   QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGAS-YTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            ++ A   CG T+   + Q IP  ++ +S+GYT DGPCEVWLDDT      NCH       
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  144

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + IDYS+C + C L W+WLG++Y++  YSWQ+YK C+ L   A
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  187

>PYAP_22273
Length=268

 Score = 144 bits (362),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 2/140 (1%)

Query  59   AYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPT  118
            A L+ QG  T+ +   ++  +GY +LR  +D    Y+  + A  +CG T P    Q IPT
Sbjct  49   AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  108

Query  119  NSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG--QHQIDYSACGAACMLRWYWLG  176
            N  F++SGYT +GPCE+W+DD    +G+NCH +        +IDYSAC   CML+WYWLG
Sbjct  109  NGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLG  168

Query  177  IKYVEGAYSWQVYKNCIALG  196
            I+ +   YSWQ+YK CI L 
Sbjct  169  IRPMGKKYSWQIYKACIPLA  188

>PITG_18450
Length=203

 Score = 141 bits (356),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 94/163 (58%), Gaps = 5/163 (3%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q+VL P P +  D  D +   L +L+ QG  T  +  GW + +GY +LR  ++    Y V
Sbjct  29   QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
             + A + CG T+     Q  P + + +S+GYT DGPCEVWLD T+     NCH       
Sbjct  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + +DYS+C   C LRWYWLG+++++ AYSWQ+YK CI L   A
Sbjct  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186

>PYAR_24096
Length=227

 Score = 142 bits (357),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 92/161 (57%), Gaps = 2/161 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V  P   + V   +      A L++QG  T+ +   +++ + Y +LR  +D    Y+ 
Sbjct  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG-  155
               A F+CG T PK   Q IP + +F++SGYT +GPCE+W+DD +   G NCH +     
Sbjct  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147

Query  156  -QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
               +IDYSAC   CML+WYWLGI+    +YSWQ+YK CI L
Sbjct  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188

>PYVX_18176
Length=201

 Score = 137 bits (345),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 93/163 (57%), Gaps = 2/163 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V+ P P +  D  D     LA+L++QG +T  +   W   +GY SLR+ +D  S Y V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTV  84

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A   CG T+     Q +P +   +S+GYT  GPCEVWLDDT      NCH       
Sbjct  85   TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKT  143

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            + +DYS+C + C L W+W+G++Y+   YSWQVYKNC+ L   A
Sbjct  144  YDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASA  186

>PYVX_18174
Length=204

 Score = 137 bits (344),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 91/164 (55%), Gaps = 4/164 (2%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V+ P P +     D     LA+L++QG  T  +   W + +GY +LR+ +D  S Y V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A   CG T      Q IP N  F+S+GYT DGPCE+WLD T+  A  NCH       
Sbjct  88   TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKD  145

Query  157  HQIDYS-ACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
              IDYS      C L WYW+G++Y+  AYSWQVYKNC+ L   A
Sbjct  146  TAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSA  189

>PYIR_26546
Length=239

 Score = 137 bits (346),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 101/170 (59%), Gaps = 3/170 (2%)

Query  29   LDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQ-GVNTSIEAQGWMQQHGYASLRSM  87
            LD+     Q+V+ P P + ++G   Q   +AYL+ Q G + + +  G++   G+ ++R  
Sbjct  21   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  80

Query  88   LDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRN  147
            +D++ LY+   +A F CG T    E Q IP N   +++GYT +GPCE+WLDD K   G+N
Sbjct  81   MDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  140

Query  148  CHTEFPHGQH--QIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            CH +   G +  ++D+S+C   C + WYW+GI+    + SWQ+YK CI L
Sbjct  141  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PYAP_22279
Length=223

 Score = 135 bits (340),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 97/168 (58%), Gaps = 6/168 (4%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q +  P P    D  +     LA+L+ QGV  + +  G+++Q G  +LR  +D+++ Y+V
Sbjct  23   QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  97   TEE-AIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKA--AAGRNCHTEFP  153
                A F+CG T P    Q IP+N   +S+GYT DGPCEVWLD+T+   +   +CH +  
Sbjct  82   EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIG  141

Query  154  HG--QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
             G   ++ID+S C   CMLRWYWL  + +   +SWQVYK C+ L   A
Sbjct  142  QGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSA  189

>PYAP_22278
Length=289

 Score = 134 bits (336),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 6/171 (4%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V  P P F  +  +     LA+L+ QGV    +  G+++  G  +LR  +D+++ Y++
Sbjct  26   QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  85

Query  97   TEE-AIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGR--NCHTEFP  153
                A F+CG T+P    Q IP N   +S+GYT DGPCEVWLD+T+       NCH +  
Sbjct  86   EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDVG  145

Query  154  HG--QHQIDYSACGAACMLRWYWLGIKYVEG-AYSWQVYKNCIALGKEATA  201
            +    ++ID+S C   CMLRWYWLG + + G  +SWQ+YK C+ L    TA
Sbjct  146  NKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTA  196

>PHYCA_510817
Length=188

 Score = 129 bits (325),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 90/140 (64%), Gaps = 1/140 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            L++L+++G  T      +   +GY SLR  ++ ++ Y+V++ A   CG + PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
            ++ + ++SGYT DGPCE+W+ D  A +  NCH   P    ++DYS CG +C+L WYWLG+
Sbjct  109  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  178  KYVEGAYSWQVYKNCIALGK  197
            + ++G YSWQVYK CI L K
Sbjct  169  RKLKGKYSWQVYKECIPLYK  188

>PPTG_14254
Length=188

 Score = 127 bits (320),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 88/140 (63%), Gaps = 1/140 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            L++L+++G  T      +   +GY SLR  +D  + Y+VTE A   CG T PK   Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
             + + +++GYT DGPCE+++ +  A +  NCH   P    ++DYS CG +C+L WYWLG+
Sbjct  109  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  178  KYVEGAYSWQVYKNCIALGK  197
            + ++G YSWQVYK CI + K
Sbjct  169  RKLKGKYSWQVYKECIPIYK  188

>PPTG_14255
Length=268

 Score = 129 bits (325),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            L++L+++G  T      +   +GY SLR  +D+ + Y VT+ A   CG T PK   Q IP
Sbjct  49   LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  107

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
             + + ++SGYT DGPCE+++ DT A +  NCH        ++DYSACG +C+L WYWLG+
Sbjct  108  EDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV  167

Query  178  KYVEGAYSWQVYKNCIAL  195
            +Y++  YSWQVYK CI L
Sbjct  168  RYLKKKYSWQVYKECIPL  185

>PHYSO_499978
Length=174

 Score = 126 bits (317),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 1/138 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  + +   LA+L+ QG  T  + + W  ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A F CG T PK   Q IP   + +S+GYT DGPCEVW+D+T+   G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  157  HQIDYSACGAACMLRWYW  174
            + IDYSAC   C LRWYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 126 bits (317),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 1/138 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +  + +   LA+L+ QG  T  + + W  ++GY +LR  +D    Y V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T+ A F CG T PK   Q IP   + +S+GYT DGPCEVW+D+T+   G NCH +     
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  157  HQIDYSACGAACMLRWYW  174
            + IDYSAC   C LRWYW
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYKE_9185
Length=281

 Score = 127 bits (320),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 90/138 (65%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            L++L+++G+ T      +   + YASLR  +D ++ Y+V++ A   CG T PK   Q IP
Sbjct  52   LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  110

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
             + + ++SGYT DGPCE+++ D  A +  NCH        ++DYSACG +C+L WYWLG+
Sbjct  111  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGV  170

Query  178  KYVEGAYSWQVYKNCIAL  195
            + ++G+YSWQ+YK CI L
Sbjct  171  RKLKGSYSWQIYKECIPL  188

>PPTG_08820
Length=250

 Score = 126 bits (317),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 92/164 (56%), Gaps = 5/164 (3%)

Query  37   QIVLHPPPFFI--VDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDD-ESL  93
            Q++L P P +   ++  D +   LA+L+ QG     +  GW  Q GY +LR  +D  +  
Sbjct  29   QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYT  88

Query  94   YQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFP  153
              VT  A   CGLT  K   + IP +   +S+GYT DGPC V+LDD       NCH + P
Sbjct  89   TSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLP  148

Query  154  HGQHQIDYSAC--GAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
               ++IDYS+C     C L W+WLGI++V+  +SWQVYK C+ L
Sbjct  149  GKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  192

>PHALS_06480
Length=159

 Score = 123 bits (308),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 64/73 (88%), Gaps = 0/73 (0%)

Query  23  IAGQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYA  82
           I G RRL+AGLGEGQ+VL+P PF++VDGLDFQGMALAYL+EQG+NTSIE Q WM+ H Y 
Sbjct  21  IYGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYN  80

Query  83  SLRSMLDDESLYQ  95
           SLR+MLDD+ LY+
Sbjct  81  SLRAMLDDDMLYK  93

>PHYSO_417649
Length=185

 Score = 121 bits (303),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 86/138 (62%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            L++L+++G  T      +   +GY SLR  ++  + Y++T+ A   CG T PK   Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
             + + ++SGYT DGPCE+++ D  A +  NCH        ++DYS CG +C+L WYWLG+
Sbjct  107  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  166

Query  178  KYVEGAYSWQVYKNCIAL  195
            + ++G +SWQVYK CI L
Sbjct  167  RKLKGKFSWQVYKECIPL  184

>PHYSO_343376
Length=172

 Score = 118 bits (295),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 71/117 (61%), Gaps = 1/117 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            LA+L+ QG  T  + + W  ++GY +LR  +D    Y VT+ A F CG T PK   Q IP
Sbjct  48   LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  106

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYW  174
               + +S+GYT DGPCEVW+D+T+   G NCH +     + IDYSAC   C LRWYW
Sbjct  107  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PITG_13520
Length=171

 Score = 117 bits (293),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 74/128 (58%), Gaps = 1/128 (1%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +     D +   LA+L+ QG  T  + + W  ++GY SLR  +D  + Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  87

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP   + +S+GYT DGPCEVWLDD     G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKD  147

Query  157  HQIDYSAC  164
            + +DYS+C
Sbjct  148  YTVDYSSC  155

>PHYCA_536934
Length=983

 Score = 125 bits (313),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 84/138 (61%), Gaps = 1/138 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            L++L+++G  T      +   +GY +LR  +D+   Y VT+ A   CG + P    Q IP
Sbjct  66   LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIP  124

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
             + + ++SGYT DGPCE+W+ D  A +  NCH        ++DYS CG +C+L WYWLG+
Sbjct  125  EDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  184

Query  178  KYVEGAYSWQVYKNCIAL  195
            +Y++  YSWQVYK CI L
Sbjct  185  RYLKKKYSWQVYKECIPL  202

>PITG_10499
Length=323

 Score = 120 bits (301),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 90/160 (56%), Gaps = 5/160 (3%)

Query  41   HPPPFFI--VDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDD-ESLYQVT  97
             P P +   ++  D +   LA+L+ QG     +  GW  ++GY  LR  +D  + +  VT
Sbjct  3    QPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVT  62

Query  98   EEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQH  157
              A   CGLT  K   + IP + + +S+GYT DGPC ++LDD       NCH   P   +
Sbjct  63   PGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTY  122

Query  158  QIDYSAC--GAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            +ID+S+C     C L W+WLGI++V+  +SWQVYK CI+L
Sbjct  123  KIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYSO_262732
Length=188

 Score = 114 bits (286),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (57%), Gaps = 15/138 (11%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            LA+L+ QG  T               LR  +D+   Y VTE A   CG T PK   Q IP
Sbjct  49   LAFLENQGFQTH--------------LRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIP  93

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
            ++ + ++SGYT DGPCE+++ D  A +  NCH        ++DYS CG +C L WYWLG+
Sbjct  94   SDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGV  153

Query  178  KYVEGAYSWQVYKNCIAL  195
            +++   YSWQVYK CI +
Sbjct  154  RFLNNKYSWQVYKECIPI  171

>PHYSO_340369
Length=200

 Score = 113 bits (282),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 81/140 (58%), Gaps = 15/140 (11%)

Query  56   MALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQL  115
            M LAY ++QG NTS     W   +G+ +LR  +D+ +             +TSP    Q 
Sbjct  50   MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNY-----------SVTSP----QQ  94

Query  116  IPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWL  175
            IP ++  ++ GYT DGPCE+WLD+T A +  +C    P+  + +DYS CGA+C++ WY L
Sbjct  95   IPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTL  154

Query  176  GIKYVEGAYSWQVYKNCIAL  195
            G+   +  YSW+VYK CI L
Sbjct  155  GVAKPDRVYSWEVYKECIPL  174

>PHYSO_254168
Length=170

 Score = 109 bits (272),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 82/150 (55%), Gaps = 18/150 (12%)

Query  48   VDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLT  107
            V+  D +   LA+L+ QG  T        + +GY +LR  +D    Y VT+ A + CG T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWT  86

Query  108  SPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSAC--G  165
            +PK   Q IP     +S+GYT DGPCE+WLDD +                 IDYS+C   
Sbjct  87   NPKGTPQPIP-----RSTGYTHDGPCEIWLDDVRVL----------ERSPTIDYSSCEKK  131

Query  166  AACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
              C + WYWLG+++++ +YSWQVYK CI L
Sbjct  132  GGCTMHWYWLGVRFLKNSYSWQVYKECIPL  161

>PHYSO_527908
Length=174

 Score = 104 bits (259),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 76/125 (61%), Gaps = 1/125 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            LA+L+ QG  T      +M  +GY SLR  +D+ + Y VT+ A   CG T P    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  107

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGI  177
             + + ++SG+T D PCE+++ D  + +  NCH        ++DYSACG +C+L WYWLG+
Sbjct  108  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  167

Query  178  KYVEG  182
            ++++G
Sbjct  168  RFIKG  172

>PHYSO_341596
Length=231

 Score = 102 bits (254),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 60/96 (63%), Gaps = 1/96 (1%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            LA+L+ QG  T  +   W  ++GY SLR  +D ++ Y VT  A F CG T PK   Q IP
Sbjct  42   LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGFTDPKGTPQPIP  100

Query  118  TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFP  153
               + +S+GYT DGPCEVWLDDTK   G NCH +FP
Sbjct  101  AGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFP  136

>PHYCA_14368
Length=219

 Score = 97.4 bits (241),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 74/167 (44%), Gaps = 46/167 (28%)

Query  29   LDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSML  88
            LD+     QIVL P P +  +  D +   LA+L+ QG  T  +   W  ++ Y SLR  +
Sbjct  21   LDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM  80

Query  89   DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNC  148
            D+ + Y VT+ A F CG T PK                                      
Sbjct  81   DN-AKYTVTDGADFSCGFTDPK--------------------------------------  101

Query  149  HTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                    + +DYS+C   C LRWYWLGI++++  YSWQVYK CI L
Sbjct  102  -------DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  141

>PYAP_18131
Length=226

 Score = 97.4 bits (241),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 70/119 (59%), Gaps = 7/119 (6%)

Query  88   LDDESLYQVTEE-AIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGR  146
            +DD++ Y+V    A F+CG T P    Q IP N   +S+G+T DG   VW+D+T+    +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  147  --NCHTEFPHG--QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
              NCH     G   ++ID+S C   CM+RWYWLG++ +   +SWQVYK CI +    TA
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PHYSO_342364
Length=194

 Score = 96.7 bits (239),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 70/126 (56%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN-SSFQSSGYTLDGPCEVWL  137
            H Y  LR++LD+ ++Y        +CG T+P    Q IPTN  +  S G    GPCE+WL
Sbjct  73   HNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHG------QHQIDYSACGA--ACMLRWYWLGIKYVEGAYSWQVY  189
            DD K  A  +C++++ H       +  +DYS C A   CM+R+YWLG + +     WQ Y
Sbjct  127  DDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTY  186

Query  190  KNCIAL  195
            KNCI L
Sbjct  187  KNCIPL  192

>PHYRA_73607
Length=343

 Score = 94.7 bits (234),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 73/128 (57%), Gaps = 18/128 (14%)

Query  79   HGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPCEV  135
            +GY+ +R++LD D SLY        DCG T+P    +  PT  +++F S G    GPCE+
Sbjct  76   NGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATF-SRGMVHVGPCEI  128

Query  136  WLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQ  187
            WLDDTK  +  NC   +  G          +DYS+C  + CMLR+YWL  + V+ +  WQ
Sbjct  129  WLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMVWQ  188

Query  188  VYKNCIAL  195
            VYKNC+ L
Sbjct  189  VYKNCVPL  196

>PHYSO_533903
Length=208

 Score = 88.6 bits (218),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 16/127 (13%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN-SSFQSSGYTLDGPCEVWL  137
            + +  L++MLDD SLY        DCG T P    Q IPT+  +  S G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  138  DDTKAAAGRNCHTEFPHG------QHQIDYSAC--GAACMLRWYWLGIKYVEGAYS-WQV  188
            DD K     +C++E+ H       +  IDYS+C  G   M+R+YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  189  YKNCIAL  195
            YK+CI L
Sbjct  188  YKDCIPL  194

>PYIR_16435
Length=304

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (57%), Gaps = 14/122 (11%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            ++ GY++LRS ++D+            CG T+P    + IP++++ + S      GPCE+
Sbjct  72   KEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPCEL  122

Query  136  WLDDTKAAAGRNCHTEFPHG--QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCI  193
            WLDD +     NC   F       +ID+S+C  +CMLRW+WLG++  +    WQVYKNC+
Sbjct  123  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCV  180

Query  194  AL  195
             L
Sbjct  181  PL  182

>PHYRA_74651
Length=344

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 18/130 (14%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
            + +GY+ +R++LD D SLY        DCG T P    +  P+  +++F S G    GPC
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATF-SRGMVHAGPC  126

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSAC-GAACMLRWYWLGIKYVEGAYS  185
            E+WLDDTK  +  NC   +  G  +       +DYS+C    C LR+YWL  + ++ +  
Sbjct  127  EIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSSTV  186

Query  186  WQVYKNCIAL  195
            WQVYKNC+ L
Sbjct  187  WQVYKNCVPL  196

>PHYRA_73584
Length=287

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 75/130 (58%), Gaps = 18/130 (14%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
            + +GY+ +R++LD D +LY        +CG T+P    +  PT  +++F S G    GPC
Sbjct  71   KSNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATF-SRGMVHAGPC  123

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDDT   +  +C T +  G  +       +DYS+C ++ CMLR+YWL  + V+    
Sbjct  124  EIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTV  183

Query  186  WQVYKNCIAL  195
            WQVYK+C+ L
Sbjct  184  WQVYKDCVPL  193

>PHYCA_130365
Length=266

 Score = 88.6 bits (218),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + Y  +RSM+D  S+Y        DCG T P       PT+ +   S G    GPCE+WL
Sbjct  73   NNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVY  189
            DD       +C + +  G          +DYS+C +  CMLR+YWLG++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQAY  186

Query  190  KNCIAL  195
            KNCI L
Sbjct  187  KNCIPL  192

>PHYCA_534473
Length=1050

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 73/130 (56%), Gaps = 18/130 (14%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
            + +GY+ +R++LD D  LY        +CG T P    +  PT  +++F S G    GPC
Sbjct  846  ESNGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATF-SRGMVHAGPC  898

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDDTK  +  +C T +  G  +       +DYS+C  + CMLR+YWL  + V+    
Sbjct  899  EIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIV  958

Query  186  WQVYKNCIAL  195
            WQVYK+C+ L
Sbjct  959  WQVYKDCVPL  968

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 64/129 (50%), Gaps = 16/129 (12%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIP-TNSSFQSSGYTLDGPCE  134
            + +    +R+M+D D  LY        DCG T PK + +  P T  +  S G    GPCE
Sbjct  541  KSNNVKDIRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCE  594

Query  135  VWLDDTKAAAGRNCHTEFPHGQH-------QIDYSACGAA-CMLRWYWLGIKYVEGAYSW  186
            +WLDD       +C + +  G          +DYS+C A  CM R+YWL ++  +    W
Sbjct  595  IWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLW  654

Query  187  QVYKNCIAL  195
            QVYKNCI L
Sbjct  655  QVYKNCIPL  663

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 57/114 (50%), Gaps = 15/114 (13%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            ++ Y  +R+++D   +Y        DCG T PK      PT+ +   S G    GPCE+W
Sbjct  73   KNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  126

Query  137  LDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGA-ACMLRWYWLGIKYVEG  182
            LDD       +C   +  G  +       +DYS+C +  CMLR+YWL ++ ++G
Sbjct  127  LDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG  180

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 16/109 (15%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTK  141
            +R++LD D  LY        DCG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  285  IRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  338

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGA-ACMLRWYWLGIKYVEG  182
              +  +C + +  G  +       +DYS+C +  CM R+YWL ++ ++G
Sbjct  339  VLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDG  387

>PHYKE_2937
Length=366

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 76/135 (56%), Gaps = 18/135 (13%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
              +GY+ +R++LD D SLY        DCG T+P    +  PT  +++F S G    GPC
Sbjct  78   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATF-SRGMVHVGPC  130

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDDT   +  +C T +  G          +DYS+C ++ CMLR+YWL  + V+ +  
Sbjct  131  EIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMV  190

Query  186  WQVYKNCIALGKEAT  200
            WQVYK+C+ L   A+
Sbjct  191  WQVYKDCVPLTGPAS  205

>PYAP_24689
Length=252

 Score = 87.4 bits (215),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 70/135 (52%), Gaps = 13/135 (10%)

Query  66   VNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-S  124
            + T  +     ++HG  +LR+ L+ +            CG T+P  + + IP +   +  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  125  SGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGA  183
            S     GPCE+W D+T+     +C+  F    Q +IDYS C   C+LR+YWLG++  +G 
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGG  166

Query  184  YSWQVYKNCIALGKE  198
              WQ YKNC+ LG +
Sbjct  167  KRWQSYKNCVPLGND  181

>PHYRA_73606
Length=366

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (55%), Gaps = 18/133 (14%)

Query  74   GWMQQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLD  130
            G    +GY+ +R++LD D SLY        DCG T+P    +  PT  +++F S G    
Sbjct  71   GLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATF-SRGMVHV  123

Query  131  GPCEVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEG  182
            GPCE+WLDDT   +  +C T +  G          +DYS+C  + CMLR+YWL  + V+ 
Sbjct  124  GPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  183  AYSWQVYKNCIAL  195
               WQVYK+C+ L
Sbjct  184  EIVWQVYKDCVPL  196

>PITG_04948
Length=232

 Score = 86.3 bits (212),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 16/126 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTK  141
            +R++LD D SLY        DCG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G  +       +DYS+C +  CMLR+YWL ++ ++G   WQVYKNCI
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCI  192

Query  194  ALGKEA  199
             L   A
Sbjct  193  PLSGPA  198

>PPTG_04647
Length=327

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 73/135 (54%), Gaps = 18/135 (13%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
              +GY+ +R++LD D  LY        DCG T+P    +  PT  +++F S G    GPC
Sbjct  73   SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATF-SRGMVHVGPC  125

Query  134  EVWLDDTKAAAGRNCHTEFPHGQ-------HQIDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDDT   +  NC T +  G          +DYS+C  + CMLR+YWL  + V+    
Sbjct  126  EIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMV  185

Query  186  WQVYKNCIALGKEAT  200
            WQVYK+C+ L   A+
Sbjct  186  WQVYKDCVPLTGPAS  200

>PPTG_04622
Length=273

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 71/134 (53%), Gaps = 18/134 (13%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
            + +GY+ +R++LD D  LY        +CG T P    +  PT  +++F S G    GPC
Sbjct  74   ESNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATF-SRGMVHAGPC  126

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDDT   +  +C T +  G          +DYS+C    CMLR+YWL  + V+    
Sbjct  127  EIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSKMV  186

Query  186  WQVYKNCIALGKEA  199
            WQVYK+C+ L   A
Sbjct  187  WQVYKDCVPLTGPA  200

>PHYSO_483955
Length=320

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + Y  +RS++D   +Y        DCG T PK +    PT+ +   S G    GPCE+WL
Sbjct  74   NNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWL  127

Query  138  DDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVY  189
            DD       +C + +  G  +       +DYS+C +  CMLR+YWL ++ ++G   WQ Y
Sbjct  128  DDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAY  187

Query  190  KNCIAL  195
            KNCI L
Sbjct  188  KNCIPL  193

>PHYSO_484051
Length=285

 Score = 86.7 bits (213),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 70/133 (53%), Gaps = 16/133 (12%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDG-PCE  134
            + +GY+ +R++LD D SLY        DCG T+P    +  PT      S   +   PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSW  186
            +WLDDT   +  +C T +  G  +       +DYS+C  + CMLR+YWL  + V+    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  187  QVYKNCIALGKEA  199
            QVYK+C+ L   A
Sbjct  188  QVYKDCVPLTGPA  200

>PHYKE_2809
Length=291

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 65/122 (53%), Gaps = 16/122 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTK  141
            +R+MLD D  LY        DCG T PK   +  PT+ +   S G    GPCE+WLDD  
Sbjct  66   IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G  +       +DYS+C A  CM R+YWL ++ ++G   WQVYKNC+
Sbjct  120  VLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCV  179

Query  194  AL  195
             L
Sbjct  180  PL  181

>PPTG_04618
Length=326

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 15/127 (12%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            ++ Y  +RS++D   +Y        DCG T PK      P++ +   S G    GPCE+W
Sbjct  73   KNNYKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  137  LDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQV  188
            LDD       +C + +  G  +       +DYS+C +  CMLR+YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQA  186

Query  189  YKNCIAL  195
            YKNCI L
Sbjct  187  YKNCIPL  193

>PPTG_04619
Length=276

 Score = 85.1 bits (209),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 16/126 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTK  141
            +R++LD D SLY        DCG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G  +       +DYS+C +  CM R+YWL ++ ++G   WQVYKNCI
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  194  ALGKEA  199
             L   A
Sbjct  193  PLSGPA  198

>PYVX_14662
Length=540

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 65/127 (51%), Gaps = 15/127 (12%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            + G   +RS+LDD S+Y        DCG T P    Q IPT+     S G    GPCE+W
Sbjct  73   EKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATFSRGMVHVGPCEIW  126

Query  137  LDDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQV  188
            LDDT      +C++ +      +      DYS+C  G    +R+YWL  + V+G   WQV
Sbjct  127  LDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGDTVWQV  186

Query  189  YKNCIAL  195
            YKNCI L
Sbjct  187  YKNCIPL  193

>PYAP_18711
Length=210

 Score = 83.6 bits (205),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 13/122 (11%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            ++ G  +LR+ L+ +           +CG T+P  + + IP++   +  S     GPCEV
Sbjct  66   KKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEV  116

Query  136  WLDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIA  194
            W D+T   +  +C   F    Q +IDYS C   CMLR+YWLG++  +G   WQ YKNC+ 
Sbjct  117  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  195  LG  196
            +G
Sbjct  175  IG  176

>PHYCA_531163
Length=314

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 71/134 (53%), Gaps = 16/134 (12%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIP-TNSSFQSSGYTLDGPCE  134
              +GY+ +R++LD D SLY        DCG T+     +  P T  +  S G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVGPCE  127

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSW  186
            +WLDDT   +  +C T +  G          +DYS+C  + CMLR+YWL  + V+ A  W
Sbjct  128  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  187

Query  187  QVYKNCIALGKEAT  200
            QVYK+C+ L   A+
Sbjct  188  QVYKDCVPLTGPAS  201

>PITG_04949
Length=337

 Score = 85.5 bits (210),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 15/127 (12%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            ++ +  +RS++D   ++        +CG T PK +    P++ +   S G    GPCE+W
Sbjct  73   KNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIW  126

Query  137  LDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQV  188
            LDD       +C + +  G  Q       +DYS+C A  CMLR+YWL ++ ++G   WQ 
Sbjct  127  LDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQA  186

Query  189  YKNCIAL  195
            YKNCI L
Sbjct  187  YKNCIPL  193

>PYU1_G005323
Length=251

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 64/118 (54%), Gaps = 13/118 (11%)

Query  80   GYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLD  138
            GY  L+S L+D+            CG + P  + + IP++   + +S     GPCEVW D
Sbjct  68   GYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWFD  118

Query  139  DTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            D +A    +C   F      ++D+SAC  +CMLR+YWLG++  +G   WQ YKNCI L
Sbjct  119  DVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

>PYU1_G014690
Length=295

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 18/124 (15%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            ++ G+ +LRS ++D+            CG T P    + IP+++    S      GPCE+
Sbjct  68   KEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEI  118

Query  136  WLDDTKAAAGRNCHTEFPHGQH----QIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKN  191
            WLDD +     +C   F  G       ID+S+C + CMLR++WLG++  +    WQVYKN
Sbjct  119  WLDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKN  174

Query  192  CIAL  195
            C+ L
Sbjct  175  CVPL  178

>PYAP_18709
Length=235

 Score = 82.0 bits (201),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 13/121 (11%)

Query  80   GYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLD  138
            G+  LRS L+D+            CG + P    + IP++ + + +S     GPCEVWLD
Sbjct  68   GFKDLRSFLEDKGPT---------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLD  118

Query  139  DTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGK  197
            +T+A    +C   F      ++D+ AC  +CMLR+YWLG++  +G   WQ YKNCI L  
Sbjct  119  NTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLND  176

Query  198  E  198
            +
Sbjct  177  K  177

>PHALS_05392
Length=367

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 63/130 (48%), Gaps = 15/130 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  +RS++D   +Y        DCG T P       P+N     S G    GPCE+WL
Sbjct  157  NNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWL  210

Query  138  DDTKAAAGRNCHTEFPHGQHQ-------IDYSACGA-ACMLRWYWLGIKYVEGAYSWQVY  189
            DD       +C   +  G  +       +DYS+C A  CMLR+YWL ++ ++G   WQ Y
Sbjct  211  DDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAY  270

Query  190  KNCIALGKEA  199
            KNCI L   A
Sbjct  271  KNCIPLNGPA  280

>PYU1_G007476
Length=195

 Score = 80.5 bits (197),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 17/127 (13%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNS----SFQSSGYTLDGP  132
            +Q GY +LRS L+++            CG T P T  + IP +     +  + G+   GP
Sbjct  71   KQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGP  121

Query  133  CEVWLDDTKAAAGRNCHTEFP--HGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYK  190
            CE+WLD+       NC   FP       +D+S+C   CMLR YWLG +  +    WQ YK
Sbjct  122  CELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQRWQTYK  179

Query  191  NCIALGK  197
             C+ + K
Sbjct  180  YCVPVKK  186

>PHYSO_459106
Length=223

 Score = 80.9 bits (198),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 67/130 (52%), Gaps = 18/130 (14%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
            + +    +R+M+D D  LY        DCG T PK + Q  PT  +++F S G    GPC
Sbjct  72   KANNVKDIRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATF-SRGIVHAGPC  124

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDD       +C + +  G          +DYS+C +  CM R+YWL ++  +    
Sbjct  125  EIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTY  184

Query  186  WQVYKNCIAL  195
            WQVYKNCI L
Sbjct  185  WQVYKNCIPL  194

>PYIR_16443
Length=275

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 15/120 (13%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            +Q G+ +LRS ++D+            CG T+P    + IP++S  + S      GPCE+
Sbjct  69   KQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEI  119

Query  136  WLDDTKAAAGRNCHTEFPHG--QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVY-KNC  192
            WLDD +     NC   F       +ID+S+C  +CMLRW+WLG++  +    WQVY K+C
Sbjct  120  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PHYSO_485524
Length=278

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 16/126 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTK  141
            +R++LD D  LY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTKLYGA------NCGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G  +       +DYS+C +  CM R+YWL ++ ++G   WQVYKNCI
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  194  ALGKEA  199
             L   A
Sbjct  193  PLSGPA  198

>PHYCA_534296
Length=309

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T+P    Q IPT+     S      GPCE+WL
Sbjct  47   NNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEIWL  100

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DDTK     +C++++ +    I      DYS+C  G    +R+YWL  + V+G   WQ Y
Sbjct  101  DDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  160

Query  190  KNCIAL  195
            K+CI L
Sbjct  161  KDCIPL  166

>PYIW_19151
Length=248

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 81/174 (47%), Gaps = 31/174 (18%)

Query  32   GLGE-GQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDD  90
            G+G  G  V+  PP +  D  D +  A A                 ++ G+++LRS L+D
Sbjct  36   GVGHPGTFVIEYPPPWTGDWKDPKNFAAA----------------AKEKGFSTLRSYLED  79

Query  91   ESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTKAAAGRNCH  149
            +            CG T PK   + IP + + + S      GPCE+++DDT+     +C 
Sbjct  80   KGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCELYIDDTRVYQNDDCE  130

Query  150  TEFPH--GQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            + F        +D+S C   CM+R+YWLG++       WQVYK+C+ +   A A
Sbjct  131  SAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQVYKSCVPVSSSAVA  182

>PYU1_G005324
Length=191

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 13/120 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            + GY  L+S LD +            CG T    + + IP +   + +S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            L +T+A    +C   F      +ID+SAC   CMLR+YWLG++  +G   WQ YKNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005326
Length=191

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 13/120 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            + GY  L+S LD +            CG T    + + IP +   + +S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            L +T+A    +C   F      +ID+SAC   CMLR+YWLG++  +G   WQ YKNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005328
Length=191

 Score = 79.0 bits (193),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 13/120 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            + GY  L+S LD +            CG T    + + IP +   + +S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            L +T+A    +C   F      +ID+SAC   CMLR+YWLG++  +G   WQ YKNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PHYKE_6001
Length=289

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 15/128 (12%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN-SSFQSSGYTLDGPCEV  135
            + + Y  L++++DD S+Y        DCG T P    Q IP++  +  S      GPCE+
Sbjct  71   KANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEI  124

Query  136  WLDDTKAAAGRNCHTEFPHGQ------HQIDYSAC-GAACM-LRWYWLGIKYVEGAYSWQ  187
            WLDD    +  +C+ ++ +          +DYS+C G  C  +R+YWL  + V+G   WQ
Sbjct  125  WLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQ  184

Query  188  VYKNCIAL  195
             YKNCI L
Sbjct  185  SYKNCIPL  192

>PYU1_G005325
Length=207

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 62/120 (52%), Gaps = 13/120 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            + GY  L+S LD +            CG T    + + IP +   + +S     GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  137  LDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            L +T+A    +C   F      +ID+SAC   CMLR+YWLG++  +G   WQ YKNCI L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIPL  175

>PHYKE_3913
Length=321

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 16/122 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWLDDTK  141
            +R++ D D SLY        +CG T+P    +  PT+ +   S G    GPCE+WLDD  
Sbjct  106  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G  +       +DYS+C A  CM R+YW+ ++ ++G   WQVYKNC+
Sbjct  160  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  219

Query  194  AL  195
             L
Sbjct  220  PL  221

>PYIW_27477
Length=180

 Score = 78.6 bits (192),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 14/116 (12%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            ++ G+ +LRS ++D+            CG T P  + + IP+++  + S      GPCE+
Sbjct  46   KEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCEL  96

Query  136  WLDDTKAAAGRNCHTEFPHG--QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVY  189
            W+DDT+     NC   F       +ID+SAC   CMLRW+WLG++  +    WQVY
Sbjct  97   WIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

>SPRG_19917
Length=241

 Score = 79.7 bits (195),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 71/141 (50%), Gaps = 25/141 (18%)

Query  67   NTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNS--SFQS  124
            N +   + +  Q  Y +LR++LD             DCG T      + IP+N   +FQ+
Sbjct  59   NAANFNKAFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQN  109

Query  125  ----SGYTLD--GPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSACGA-ACMLRWYW  174
                 G+ L   GPCEVWLD+ +     +C T F   P     +DYS+CGA  CMLR+YW
Sbjct  110  PDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYW  169

Query  175  LGIKYVEGAYSWQVYKNCIAL  195
            + +     +  WQVYKNC+ L
Sbjct  170  IALH----SPRWQVYKNCVPL  186

>PITG_05271
Length=278

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T P  + Q IP +     S      GPCE+WL
Sbjct  73   NKFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DDTK     +C +++ +    I      DYS+C  G    +R+YWL  + V+G   WQ Y
Sbjct  127  DDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  190  KNCIAL  195
            K+CI L
Sbjct  187  KDCIPL  192

>SDRG_17318
Length=241

 Score = 79.3 bits (194),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 25/135 (19%)

Query  73   QGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNS--SFQS----SG  126
            + +  Q  Y +LR+MLD             DCG T      + IP+N   +FQ+     G
Sbjct  65   KAFKAQSKYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEG  115

Query  127  Y--TLDGPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSACGA-ACMLRWYWLGIKYV  180
            +  +  GPCEVWLD+ +     +C T FP        +DYS+CGA  CMLR+YW+ +   
Sbjct  116  FIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALH--  173

Query  181  EGAYSWQVYKNCIAL  195
              +  WQVYKNC+ L
Sbjct  174  --SPRWQVYKNCVPL  186

>PHYSO_533747
Length=206

 Score = 78.6 bits (192),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 16/126 (13%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN-SSFQSSGYTLDGPCEVWL  137
            + +  L++MLDD SLY        DCG T P    Q IPT+  +  S G    GPCE WL
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  138  DDTKAAAGRNCHTEFPHG------QHQIDYSAC--GAACMLRWYWLGIKYVEGAYS-WQV  188
            DD K     +C++E+ H       +  IDYS+C  G   M+R+YWLG + ++   + WQ 
Sbjct  128  DDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQT  187

Query  189  YKNCIA  194
            Y   + 
Sbjct  188  YSTLLG  193

>PHYSO_340333
Length=284

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLD-GPCEVWL  137
            + +  L++++DD S+Y        DCG T P    Q IPT+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DD K     +C +++ +    I      DYS+C  G    +R+YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  190  KNCIAL  195
            K+CI L
Sbjct  187  KDCIPL  192

>PHYRA_73582
Length=326

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 16/126 (13%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + Y  L++++D     +       DCG T P       PT+ +   S G    GPCE+WL
Sbjct  74   NNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVY  189
            DD       +C + +  G  +       +DYS C A  C+LR+YWL ++ ++G   WQ Y
Sbjct  127  DDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSY  186

Query  190  KNCIAL  195
            KNCI L
Sbjct  187  KNCIPL  192

>PHYSO_340332
Length=295

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLD-GPCEVWL  137
            + +  L++++DD S+Y        DCG T P    Q IPT+     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DD K     +C +++ +    I      DYS+C  G    +R+YWL  + V+G   WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  190  KNCIAL  195
            K+CI L
Sbjct  187  KDCIPL  192

>PHYRA_73583
Length=630

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 16/126 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIP-TNSSFQSSGYTLDGPCEVWLDDTK  141
            +R++LD D +LY        +CG T+P    +  P T  +  S G    GPCE+WLDD  
Sbjct  79   IRTLLDSDTTLYGA------NCGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWLDDKM  132

Query  142  AAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G  +       +DYS+C +  CM R+YWL ++ ++G   WQVYKNCI
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNCI  192

Query  194  ALGKEA  199
             L   A
Sbjct  193  PLSGPA  198

 Score = 78.2 bits (191),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 62/126 (49%), Gaps = 16/126 (13%)

Query  84   LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIP-TNSSFQSSGYTLDGPCEVWLDDTK  141
            +R+M+D D  LY        DCG T PK   +  P T  +  S G    GPCEVWLDD  
Sbjct  380  IRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWLDDEM  433

Query  142  AAAGRNCHTEFPHGQH-------QIDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCI  193
                 +C + +  G          IDYS+C A  CM R++WL ++  +    WQVYKNC+
Sbjct  434  VLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNCV  493

Query  194  ALGKEA  199
             L   A
Sbjct  494  PLSGPA  499

>PHYRA_78689
Length=296

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T P    Q IPT+     S      GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DDTK     +C +++ +    I      DYS+C  G    +R+YWL  + ++    WQ Y
Sbjct  127  DDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSY  186

Query  190  KNCIAL  195
            K+CI L
Sbjct  187  KDCIPL  192

>PITG_04947
Length=298

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (52%), Gaps = 18/130 (14%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPT--NSSFQSSGYTLDGPC  133
            + +    +R+M+D D  LY        DCG T PK   +  PT  +++F S G    GPC
Sbjct  47   KSNNIKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATF-SRGIVHAGPC  99

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYS  185
            E+WLDD       +C + +  G  +       +DYS+C +  CM R+YWL ++  +    
Sbjct  100  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTL  159

Query  186  WQVYKNCIAL  195
            WQVYKNCI L
Sbjct  160  WQVYKNCIPL  169

>PYAR_14256
Length=199

 Score = 76.3 bits (186),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 16/121 (13%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLD--GPCEVW  136
             G+ +LR+ L+D+            CG T P  + +  P          T++  GPCE+W
Sbjct  64   KGFKNLRAFLEDKGP---------TCGNTLPNAKPK--PXXXXLIKLASTIEHPGPCEIW  112

Query  137  LDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            LDD+ A    +C  +F      ++D+SAC  +CMLR+YWLG++       WQ YKNCI L
Sbjct  113  LDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPL  170

Query  196  G  196
            G
Sbjct  171  G  171

>PYIR_16444
Length=182

 Score = 75.9 bits (185),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 14/122 (11%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            +Q G+ +LRS ++++            CG T+ K   + IP++     S      GPCE+
Sbjct  69   KQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCEL  119

Query  136  WLDDTKAAAGRNCHTEFPHGQH--QIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCI  193
            WLD+ +     NC   F       +ID+S+C   CMLR++WLG++  +    WQVYKNC+
Sbjct  120  WLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCV  177

Query  194  AL  195
             +
Sbjct  178  PV  179

>PYVX_16138
Length=559

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 15/123 (12%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            ++ G   +RS+LDD S+Y        DCG T P    Q IPT+S+   S G    GPCE+
Sbjct  72   EEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGPCEI  125

Query  136  WLDDTKAAAGRNCHTEFPHGQHQ------IDYSACGAA--CMLRWYWLGIKYVEGAYSWQ  187
            WLDDT      +C++ +            +DYS+C  +   M+R+YWL  + V+    WQ
Sbjct  126  WLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETVWQ  185

Query  188  VYK  190
            VY 
Sbjct  186  VYS  188

>PYIR_16375
Length=262

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 8/118 (7%)

Query  80   GYASLRSM-LDDESLYQVTEEAIFDCGLTS-PKTETQLIPTNSSFQSSGYTLDGPCEVWL  137
            GY SLR + L ++ +Y   E    +CGLT+  + +   +P + +   SG+T  GPCE+W 
Sbjct  77   GYTSLRDLILANQDMYD--ESTDKECGLTTLDEAKRTTMPASGNITFSGFTHPGPCELWC  134

Query  138  DDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            DD K     NC   +P G+   D + C  A   R +W+G+        WQVY NC+ L
Sbjct  135  DDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVH----GSPWQVYTNCVYL  188

>PPTG_04620
Length=342

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 64/129 (50%), Gaps = 16/129 (12%)

Query  77   QQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIP-TNSSFQSSGYTLDGPCE  134
            + +    +R+M+D D  LY        DCG T PK   +  P T  +  S G    GPCE
Sbjct  74   KSNNVKDIRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATFSRGIVHAGPCE  127

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGAA-CMLRWYWLGIKYVEGAYSW  186
            +WLDD       +C + +  G  +       +DYS+C +  CM R+YWL ++  +    W
Sbjct  128  IWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLW  187

Query  187  QVYKNCIAL  195
            QVYKNCI L
Sbjct  188  QVYKNCIPL  196

>PYIR_24743
Length=357

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 68/154 (44%), Gaps = 27/154 (18%)

Query  53   FQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTE  112
            FQG    +      N     + +  Q  + +LR +L D            DCG + P   
Sbjct  62   FQG---KFNDNPQANVDTFTKAFQGQSEFKTLRDLLKDHGA---------DCGDSKPDAS  109

Query  113  TQLIPTNSSF------QSSGY--TLDGPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDY  161
             + IP +            G+  +  GPCE+WLDD +  +  NC   F   P  +  +D+
Sbjct  110  RKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDF  169

Query  162  SACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            S+C   CMLR+YWL +       +WQVYKNC+ L
Sbjct  170  SSCKENCMLRFYWLALH----EPTWQVYKNCVPL  199

>PYU1_G007364
Length=316

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 63/127 (50%), Gaps = 25/127 (20%)

Query  81   YASLRSMLDD------ESLYQVTEEAIFDCGLTS---PKTETQLIPTNSSFQSSGYTLDG  131
            YASLR +L         +    T + I   G+ S   P T    +P+++          G
Sbjct  89   YASLRDLLQGHGEDCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHT----------G  138

Query  132  PCEVWLDDTKAAAGRNCHTEFP--HGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVY  189
            PCE+WLDDT      NC   FP    Q ++D+S+C   C++R+YWL ++      +WQ+Y
Sbjct  139  PCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIY  194

Query  190  KNCIALG  196
            KNCI L 
Sbjct  195  KNCIPLA  201

>PYAR_14260
Length=212

 Score = 75.5 bits (184),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 13/120 (11%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
             G+ +LRS L+ +            CG +    + + IP++   + +S     GPCE+WL
Sbjct  44   KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFASTLEHPGPCEIWL  94

Query  138  DDTKAAAGRNCHTEFPHGQH-QIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
            D+T A    +C  +F      ++++SAC  +CMLR+YWLG++  +    WQ YKNC+ LG
Sbjct  95   DETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPLG  152

>H310_06362
Length=197

 Score = 74.7 bits (182),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 59/127 (46%), Gaps = 24/127 (19%)

Query  80   GYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF------QSSGYTLD--G  131
            G+ +LR+MLD             DCG T      + IPT+            G+     G
Sbjct  51   GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  132  PCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQV  188
            PCE+WLD+T+     NC   FP     Q  +D+S+C  +C +R+YWL +        WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH----EDLWQV  157

Query  189  YKNCIAL  195
            YKNC  L
Sbjct  158  YKNCAPL  164

>PHYKE_10578
Length=239

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 54/105 (51%), Gaps = 17/105 (16%)

Query  104  CGLTSPKTETQLIPTNSSF-----QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158
            CG T    + Q +P++         ++G+T  GPCEV++DD     G NC  E+P G  +
Sbjct  86   CGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPDE  145

Query  159  --------IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                    IDYS+C   CML +YWLG +  +    WQ Y NC+ L
Sbjct  146  SGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPL  186

>SDRG_07565
Length=278

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 67/141 (48%), Gaps = 25/141 (18%)

Query  67   NTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ---  123
            N +     +  Q  + +LR ML+ +            CG + P    + IP++ +     
Sbjct  119  NVAAFTTAFKAQSQFKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGTMTWLN  169

Query  124  ---SSGY--TLDGPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSAC-GAACMLRWYW  174
                 G+  +  GPCEVWLDD +     +C T FP        +DYS+C G+ CMLR+YW
Sbjct  170  PDTGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYW  229

Query  175  LGIKYVEGAYSWQVYKNCIAL  195
            L +   +    WQVYKNC+ L
Sbjct  230  LALHQPQ----WQVYKNCVPL  246

>PHYSO_438103
Length=238

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T P    Q IPT+     S      GPCE+WL
Sbjct  72   NNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWL  125

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            D+TK     +C +++ +    I      DYS+C  G    +R+YWL  + ++    WQ Y
Sbjct  126  DNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSY  185

Query  190  KNCIAL  195
            K+CI L
Sbjct  186  KDCIPL  191

>PHYCA_127270
Length=279

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T P    Q IPT+     S      GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DD K     +C +++ +    I      DYS+C  G    +R+YWL  + +     WQ Y
Sbjct  127  DDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSY  186

Query  190  KNCIAL  195
            K+CI L
Sbjct  187  KDCIPL  192

>SDRG_08129
Length=218

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 66/141 (47%), Gaps = 25/141 (18%)

Query  67   NTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ---  123
            N +     +  Q  + +LR ML+ +            CG + P    + IP++ +     
Sbjct  57   NVAAFTSAFKVQSQFKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGAMTWRN  107

Query  124  ---SSGY--TLDGPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSAC-GAACMLRWYW  174
                 G+  +  GPCEVWLDD +     +C T FP        +DYS+C G  CMLR+YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  167

Query  175  LGIKYVEGAYSWQVYKNCIAL  195
            L +   +    WQVYKNC+ L
Sbjct  168  LALHQPQ----WQVYKNCVPL  184

>SDRG_08782
Length=450

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 77/177 (44%), Gaps = 32/177 (18%)

Query  38   IVLHPPPFFIVDGLDFQGMALAYLQEQG-------VNTSIEAQGWMQQHGYASLRSMLDD  90
            IV +PP  F  D +  + +A       G        N +   + +  Q  + +LR MLD 
Sbjct  22   IVSNPPAEFRSDVMRTKYVATIQANFPGKFDDSPQTNVANFNKAFKAQSQFKTLRDMLDP  81

Query  91   ESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ------SSGY--TLDGPCEVWLDDTKA  142
                        DCG T    + + IP N            G+  +  GPCEVW+D+ + 
Sbjct  82   HGP---------DCGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEVWIDNERV  132

Query  143  AAGRNCHTEFPHGQH---QIDYSACGA-ACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                +C T FP        +DYS+CGA  CMLR+YWL +        WQVYKNC+ L
Sbjct  133  FQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALH----EPMWQVYKNCVPL  185

>SDRG_08137
Length=282

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 66/141 (47%), Gaps = 25/141 (18%)

Query  67   NTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ---  123
            N +     +  Q  + +LR ML+ +            CG + P    + IP++ +     
Sbjct  121  NVAAFTSAFKAQSQFKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGTMTWRN  171

Query  124  ---SSGY--TLDGPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSAC-GAACMLRWYW  174
                 G+  +  GPCEVWLDD +     +C T FP        +DYS+C G  CMLR+YW
Sbjct  172  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  231

Query  175  LGIKYVEGAYSWQVYKNCIAL  195
            L +   +    WQVYKNC+ L
Sbjct  232  LALHQPQ----WQVYKNCVPL  248

>SPRG_19916
Length=305

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 64/142 (45%), Gaps = 25/142 (18%)

Query  66   VNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ--  123
             N +   + +  Q  + +LR MLD +           DCG T      + IPTN      
Sbjct  58   TNVANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQ  108

Query  124  ----SSGYTLD--GPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSAC-GAACMLRWY  173
                  G+     GPCEVW+DD +     +C T F   P     IDYS+C G  CMLR+Y
Sbjct  109  NPDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFY  168

Query  174  WLGIKYVEGAYSWQVYKNCIAL  195
            WL +        WQVYKNC+ L
Sbjct  169  WLALHEP----MWQVYKNCVPL  186

>SPRG_22161
Length=300

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 64/135 (47%), Gaps = 25/135 (19%)

Query  73   QGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ------SSG  126
            + +  Q  + +LR MLD +           DCG T      + IPTN            G
Sbjct  65   KAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPDTGEG  115

Query  127  Y--TLDGPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSACGA-ACMLRWYWLGIKYV  180
            +  +  GPCEVW+D+ +     +C T F   P     +DYS+CGA  CMLR+YWL +   
Sbjct  116  FIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLALH--  173

Query  181  EGAYSWQVYKNCIAL  195
                 WQVYKNC+ L
Sbjct  174  --EPMWQVYKNCVPL  186

>PHYSO_533682
Length=278

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T P    Q IPT+     S G    GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQ------IDYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DD K  +  +C++++ +          +DYS+C  G    +R Y LG + +     WQ Y
Sbjct  127  DDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTVWQSY  186

Query  190  KNCIAL  195
            KNCI L
Sbjct  187  KNCIPL  192

>PYAP_24691
Length=145

 Score = 72.4 bits (176),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 3/68 (4%)

Query  131  GPCEVWLDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVY  189
            GPCE+W D+T+     +C   F    Q +IDYS C   C+LR+YWLG++  +G   WQ Y
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSY  62

Query  190  KNCIALGK  197
            KNC+ +G 
Sbjct  63   KNCVPIGN  70

>PHYCA_69583
Length=224

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 71/133 (53%), Gaps = 21/133 (16%)

Query  77   QQHGYAS-LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGP  132
            ++ GYA+ +R +LD D +LY        +CG ++P  + +  P++  ++F+  G    GP
Sbjct  73   KEAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFER-GLAHHGP  125

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQHQ--------IDYSACGAA-CMLRWYWLGIK-YVEG  182
            CE+WLDD       +C   F    +         IDYS+C ++ CM R+YWL  +    G
Sbjct  126  CEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSG  185

Query  183  AYSWQVYKNCIAL  195
             Y WQ+YK+CI L
Sbjct  186  KYVWQIYKDCIPL  198

>PHYSO_255056
Length=269

 Score = 73.6 bits (179),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 17/124 (14%)

Query  77   QQHGYAS-LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGP  132
            ++ GYA+ +R +LD D +LY        DCG ++P  + +  PT+  ++F+  G    GP
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFER-GLAHHGP  126

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIK-YVEGAYSWQVYKN  191
            CE+WLDDT      +C   F       DY +    CM R+YWL  +    G Y WQ+YKN
Sbjct  127  CEIWLDDTMVLHNDDCAKAF----SVEDYMSIN-GCMFRFYWLAFQGSTSGKYVWQIYKN  181

Query  192  CIAL  195
            CI L
Sbjct  182  CIPL  185

>PYAP_18713
Length=184

 Score = 72.0 bits (175),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 18/123 (15%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            +  G+  LRS L+D+            CG T+P  + + +P++S    S      GPCE+
Sbjct  68   KDKGFKDLRSFLEDKGPA---------CGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCEL  118

Query  136  WLDDTKAAAGRNCHTEFPHGQH----QIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKN  191
            W+DDT      +C  EF  G+      +D+S+C   CMLR+YWLG++  +    WQ Y  
Sbjct  119  WIDDTMVYHNDDCELEF--GKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSGKRWQSYST  174

Query  192  CIA  194
             IA
Sbjct  175  YIA  177

>PYIW_21964
Length=265

 Score = 73.6 bits (179),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 68/128 (53%), Gaps = 14/128 (11%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTLD-  130
            ++   Y S+R+++DD++++   +EA  +CG+TSP    Q +P      S   S G+T   
Sbjct  77   LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  134

Query  131  -GPCEVWLDDTKAAAGRNCHTEFPHGQHQ--IDYSACGAACMLRWYWLGIKYVEGAYSWQ  187
             GPCEVW DD  A    NC  ++     +  ID++ C  A +L+  WL +     + +WQ
Sbjct  135  QGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SSTWQ  190

Query  188  VYKNCIAL  195
            +Y NC  L
Sbjct  191  IYINCAPL  198

>PHYSO_246676
Length=187

 Score = 72.0 bits (175),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 69/159 (43%), Gaps = 39/159 (25%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            QIVL P P +  +    +   LA+L+ QG  T  +   W +++GY +LR  +D ++ Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDV  70

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
            T  A F CG T PK   Q IP  +  +S+GYT DG                         
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG-------------------------  105

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                         L    L +  ++ +YSW+VYK CI L
Sbjct  106  -------------LVHASLVLDGMKNSYSWKVYKACIPL  131

>PYAP_19707
Length=241

 Score = 72.4 bits (176),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 8/106 (8%)

Query  93   LYQVTEEAIFDCGLTSPKTETQLIPTNS--SFQSSGYTLDGPCEVWLDDTKAAAGRNCHT  150
            +  + E A   CG T      Q IPT+   +F  S   + GPCEVWLD+TK A+ + C  
Sbjct  58   IKALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHI-GPCEVWLDNTKVASAKECWK  116

Query  151  EFPHGQHQIDYSACGA-ACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            EFP+ + ++D++ C + +C LRW W+          W+ + NC+ +
Sbjct  117  EFPNKRIKVDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCVRV  158

>PHYCA_19611
Length=531

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 63/130 (48%), Gaps = 13/130 (10%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--  129
            M    Y SL+  ++D+ +  V +E   +CG T+PK   Q +P      S     G+T   
Sbjct  280  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  338

Query  130  DGPCEVWLDDTKAAAGRNCHTEFP--HGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCEVW DDT+     NC   FP    +   D  AC  +  L  YW+ +     + SWQ
Sbjct  339  EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH----SPSWQ  394

Query  188  VYKNCIALGK  197
            VY NC AL K
Sbjct  395  VYINCAALEK  404

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 44/110 (40%), Gaps = 17/110 (15%)

Query  90   DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCH  149
            + S Y+  +E I D G T  +   Q             T +GP  V           NC 
Sbjct  48   EASKYKSLKEVINDLGKTKLRNRFQR-----------RTSNGPTVVAKALPPLTKDDNCA  96

Query  150  TEFPHGQHQIDYS--ACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGK  197
              +P    ++ Y   AC  A  L +YWL +     + +WQVY NC AL K
Sbjct  97   ANYPTAPAKVPYDRDACLGASRLTFYWLALH----SSTWQVYTNCAALEK  142

>PHYCA_12942
Length=353

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query  104  CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG---  155
            CG T      Q IP++   +       G+T  GPCE+++DD     G NC  EF  G   
Sbjct  84   CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDTS  143

Query  156  QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
              +IDYS+C   CML  YWLG +  +    WQ Y NC+ L
Sbjct  144  DMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>SPRG_07627
Length=536

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 64/135 (47%), Gaps = 25/135 (19%)

Query  73   QGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ------SSG  126
            + +  Q  Y +LR +LD             DCG T P    + IP++            G
Sbjct  62   KAFAAQTQYKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEG  112

Query  127  Y--TLDGPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSACGA-ACMLRWYWLGIKYV  180
            +  +  GPCE+WLD T+     +C T F   P  +  +DY+ CG   C+LR+YWL +   
Sbjct  113  FIPSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQP  172

Query  181  EGAYSWQVYKNCIAL  195
            +    WQVYKNC+ L
Sbjct  173  Q----WQVYKNCVPL  183

>PPTG_03139
Length=320

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 74/151 (49%), Gaps = 14/151 (9%)

Query  55   GMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQ  114
            G +  + Q    NT+   +G+     Y+SL+  + D+ +  V+++   +CG T+P    Q
Sbjct  53   GFSGNFGQSPTDNTANFNKGFAASK-YSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQ  110

Query  115  LIPTN----SSFQSSGYTL--DGPCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGA  166
             +P      S     G+T   +GPCEVW DDT+     NC   FP    ++  D+ AC  
Sbjct  111  PVPETYVEWSHGSGEGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLG  170

Query  167  ACMLRWYWLGIKYVEGAYSWQVYKNCIALGK  197
            +  L  YW+ +     + SWQVY NC AL K
Sbjct  171  SSRLSIYWIALH----SPSWQVYINCAALEK  197

>PHYRA_78175
Length=319

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 13/125 (10%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--DGPCE  134
            Y+SL+  + D+ L  V +E   +CG T+P    Q +P      S     G+T   +GPCE
Sbjct  78   YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  136

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            VW DDT+     NC   FP    ++ Y   AC  +  L  YW+ +     + SWQVY NC
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH----SASWQVYINC  192

Query  193  IALGK  197
             AL K
Sbjct  193  AALEK  197

>PYU1_G001527
Length=278

 Score = 71.2 bits (173),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTLD--G  131
            Q  Y S+R+++D + ++Q       +CG+TSP  E Q +P      +   S G+T    G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  132  PCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQVY  189
            PCEVW D+  A +  NC T +P    ++  D S C    ML++YWL +     + +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  190  KNCIALG  196
              C  L 
Sbjct  194  IACAPLA  200

>PYU1_G001523
Length=278

 Score = 71.2 bits (173),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTLD--G  131
            Q  Y S+R+++D + ++Q       +CG+TSP  E Q +P      +   S G+T    G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  132  PCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQVY  189
            PCEVW D+  A +  NC T +P    ++  D S C    ML++YWL +     + +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  190  KNCIALG  196
              C  L 
Sbjct  194  IACAPLA  200

>PHYCA_19598
Length=390

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 61/125 (49%), Gaps = 13/125 (10%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--DGPCE  134
            Y SL+ +  D++   V+  A   CG   PK E Q +P +    S   S G+T   +GPCE
Sbjct  76   YKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCE  134

Query  135  VWLDDTKAAAGRNCHTEFP--HGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            VW DD +     NC T FP    +   D  AC  A  L +YW+ +     + +WQVY NC
Sbjct  135  VWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH----SDTWQVYVNC  190

Query  193  IALGK  197
              L K
Sbjct  191  APLEK  195

>PHYRA_86016
Length=236

 Score = 70.5 bits (171),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 17/105 (16%)

Query  104  CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG---  155
            CG T    + Q IPT+   +       G+T  GPCE+++DDT    G +C  E+P G   
Sbjct  22   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  81

Query  156  -----QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                 +  +DYS+C   C L  YWL  +  +    WQ Y NC+ L
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PPTG_14221
Length=275

 Score = 70.9 bits (172),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 15/126 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            + +  L++++DD S+Y        DCG T+P    Q IPT+     S      GPC +WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHGPCGIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DD       +C  ++ +    I      DYS+C  G    +R+YWL  + +     WQ Y
Sbjct  127  DDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSY  186

Query  190  KNCIAL  195
            K+CI L
Sbjct  187  KDCIPL  192

>H257_13550
Length=266

 Score = 70.5 bits (171),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 62/130 (48%), Gaps = 24/130 (18%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF------QSSGYTLD  130
            Q  G+ +LR+MLD +           DCG +      + IP++ +          G+   
Sbjct  103  QATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPS  153

Query  131  --GPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSACGAACMLRWYWLGIKYVEGAYS  185
              GPCE+WLD+T+     +C T FP        +D+++C  +C +R+YW+ +        
Sbjct  154  HTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALH----QDL  209

Query  186  WQVYKNCIAL  195
            WQVYKNC  L
Sbjct  210  WQVYKNCAPL  219

>PHYRA_83499
Length=473

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (49%), Gaps = 17/111 (15%)

Query  104  CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG---  155
            CG T    + Q IPT+   +       G+T  GPCE+++DDT    G +C  E+P G   
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  156  -----QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
                 +  +DYS+C   C L  YWL  +  +    WQ Y NC++L    +A
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSA  192

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 36/72 (50%), Gaps = 12/72 (17%)

Query  126  GYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ--------IDYSACGAACMLRWYWLGI  177
            G  + GPCE++LDDT    G NC  E+  G           IDYS+C  AC L  YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  178  KYVEGAYSWQVY  189
            +  +    WQ Y
Sbjct  406  QNEQ----WQAY  413

>PHYRA_86752
Length=300

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 17/105 (16%)

Query  104  CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG---  155
            CG T    + Q IPT+   +       G+T  GPCE+++DDT    G +C  E+P G   
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  156  -----QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                 +  +DYS+C   C L  YWL  +  +    WQ Y NC+ L
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  186

>PHYRA_78626
Length=473

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 3/63 (5%)

Query  136  WLDDTK---AAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            +LD  K   A +  NCH        ++DYS CG +C+L WYWLG +Y++G+YSWQVYK C
Sbjct  336  FLDKAKYKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKEC  395

Query  193  IAL  195
            I L
Sbjct  396  ILL  398

>PHYRA_78625
Length=434

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 3/63 (5%)

Query  136  WLDDTK---AAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            +LD  K   A +  NCH        ++DYS CG +C+L WYWLG +Y++G+YSWQVYK C
Sbjct  297  FLDKAKYKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKEC  356

Query  193  IAL  195
            I L
Sbjct  357  ILL  359

>SDRG_17317
Length=122

 Score = 67.4 bits (163),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 40/69 (58%), Gaps = 8/69 (12%)

Query  131  GPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSAC-GAACMLRWYWLGIKYVEGAYSW  186
            GPCEVWLDD +     +C T F   P     IDYS+C G  CMLR+YWL +        W
Sbjct  44   GPCEVWLDDKRVFQNDDCATNFPAKPAAHLPIDYSSCSGDGCMLRFYWLALH----EPMW  99

Query  187  QVYKNCIAL  195
            QVYKNC+ L
Sbjct  100  QVYKNCVPL  108

>PHYKE_7717
Length=568

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 0/44 (0%)

Query  152  FPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            FP   + IDYSAC   C LRWYWLG+++++ AYSWQVYK CI L
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  45

>SDRG_15426
Length=523

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 27/143 (19%)

Query  66   VNTSIEAQGWMQQHGYASLRSMLD------DESLYQVTEEAIFDCGLTS---PKTETQLI  116
             N +   + +  Q  Y +LR +LD        +   V  + I   G+ +   P T    I
Sbjct  31   TNVANFNKAFAAQSQYKTLRDLLDLSGPDCGNTRTNVAPKPIPSDGMMTWQNPDTGEGFI  90

Query  117  PTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSACGA-ACMLRW  172
            P+++          GPCE+WLD+ +     NC T FP     +  +DY+ CG   CMLR+
Sbjct  91   PSHT----------GPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRF  140

Query  173  YWLGIKYVEGAYSWQVYKNCIAL  195
            YWL +   +    WQVYKNC+ L
Sbjct  141  YWLALHQPQ----WQVYKNCVPL  159

>PYVX_20789
Length=290

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 78/181 (43%), Gaps = 36/181 (20%)

Query  33   LGEGQIVLHPP------------PFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHG  80
            LG G I+L  P            P   +D  +  G ++     QGV        W  ++G
Sbjct  21   LGHGNIILPKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQGV------ADWFTENG  74

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGPCEVWLD  138
             +SL+        Y      I +CG T      Q +P++  +   + G +  GPCE+W D
Sbjct  75   ISSLKE-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGPCEIWCD  127

Query  139  DTKAAAGRNCHTEFPHGQH----QIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIA  194
            DT+     NC T+F  GQ      ID + C A+    +YWL +     A  WQVY NC+A
Sbjct  128  DTRVFNSTNCVTDF-SGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQVYINCVA  182

Query  195  L  195
            L
Sbjct  183  L  183

>PITG_08892
Length=309

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query  76   MQQHGYASLRSML-DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCE  134
            +   G  SL +++  ++ LY  + E   DCGLT+ K   +     S  + +G+T  GPCE
Sbjct  74   LATKGGGSLGALIAKNQKLY--SSEVDPDCGLTTFKDSARSKLPASQLEYTGFTHPGPCE  131

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            VW DDTK     +C T+FP    +I  D S C  A  L  YWL +        WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVH----GEQWQVYSDC  187

Query  193  IAL  195
            + L
Sbjct  188  VWL  190

>PHYKE_6077
Length=322

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 62/130 (48%), Gaps = 13/130 (10%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--  129
            M    Y SL+  +  ++    + E   +CG T+PK   Q +P      S     G+T   
Sbjct  73   MAASKYTSLKEFMAAKAKV-TSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSSH  131

Query  130  DGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDYS--ACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCEVW DDT+     NC   FP    ++ Y   AC  + +L  YW+ +     + SWQ
Sbjct  132  EGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH----SPSWQ  187

Query  188  VYKNCIALGK  197
            VY NC AL K
Sbjct  188  VYINCAALEK  197

>PHYCA_112615
Length=196

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 60/114 (53%), Gaps = 19/114 (17%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLD-GPCEVWL  137
            + +  L++++DD S+Y        DCG T P  + Q IP++     S   +  GPCE+WL
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQIDYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            DDTK     +  + FP     +DYS+C  G    +R+YWL  + V+G   WQ Y
Sbjct  127  DDTK-----DIKSIFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  170

>PYU1_G001526
Length=334

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 14/126 (11%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTLD--G  131
            Q  Y S+R+++D + ++Q       +CG+TSP  E Q +P      +   S G+T    G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  132  PCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQVY  189
            PCEVW D+  A +  NC T +P    ++  D S C    ML++YWL +     + +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  190  KNCIAL  195
              C  L
Sbjct  194  IACAPL  199

>PHYRA_78176
Length=312

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--  129
             +   Y+SL+  +DD++   VT+ A   CG   P    Q +P      +   S G+T   
Sbjct  74   FESSSYSSLKEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASH  132

Query  130  DGPCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCEVW DD +     +C  +F     Q+  D+ AC  + +L +YWL +     + +WQ
Sbjct  133  EGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH----SSTWQ  188

Query  188  VYKNCIAL  195
            VY NC  L
Sbjct  189  VYVNCAPL  196

>PYAR_20617
Length=254

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 13/121 (11%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            +  G   LR+ L+D+            CG +      + IP +     +S     GPCEV
Sbjct  66   KAEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKISLASTIEHAGPCEV  116

Query  136  WLDDTKAAAGRNCHTEFPHG-QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIA  194
            W DD  A    +C   F       +D+S C  +C+LR+YWLG++  +G   WQ YKNC+ 
Sbjct  117  WFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVP  174

Query  195  L  195
            L
Sbjct  175  L  175

>PHYKE_6002
Length=197

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 18/120 (15%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGPCE  134
            + + +  L++++DD S+Y        DCG T P    Q IP++  ++F  +   + GPCE
Sbjct  71   KANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHV-GPCE  123

Query  135  VWLDDTKAAAGRNC--HTEFPHGQHQIDYSAC--GAACMLRWYWLGIKYVEGAYSWQVYK  190
            +WLD TKA +  NC     FP     +DYS+C  G    +R+YWL  + ++    WQ Y+
Sbjct  124  IWLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PYIW_24288
Length=201

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (45%), Gaps = 14/146 (10%)

Query  58   LAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP  117
            + Y      N  +  + +  Q+ Y +LR ++D  +++    +   +CG TS     Q +P
Sbjct  62   MTYSSNGANNARVYERAFGNQNRYRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPLP  119

Query  118  ------TNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACM  169
                   N   Q    T +GPCEVW D   A    NC   F     ++ Y  S C  A M
Sbjct  120  AQYVEWNNRVNQGLAPTHEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKM  179

Query  170  LRWYWLGIKYVEGAYSWQVYKNCIAL  195
            L++YWL +   E    W+VY NC+ L
Sbjct  180  LKFYWLSLDSRE----WEVYINCVPL  201

>PYAP_18138
Length=268

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 16/118 (14%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP-TNSSFQSSGYTLDGPCEV  135
            +QHG   LRS +D +         I +CG +      + IP TN+       T  GPCE 
Sbjct  80   KQHGVKDLRSYIDAK---------ITECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEF  130

Query  136  WLDDTKAAAGRNCHTEFPHGQH-QIDYSAC-GAACMLRWYWLGIKYVEGAYSWQVYKN  191
            W+DDT+     +C   F       +DYS C G  C+LR+YWLG++  +    WQVY+N
Sbjct  131  WIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQNSD----WQVYRN  184

>PHALS_04411
Length=262

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 62/127 (49%), Gaps = 15/127 (12%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            ++ Y ++R+++D    +        DCG T PK +    P++ +   S G    GPCE+W
Sbjct  73   KNNYKNVRTLMDGNPAFGE------DCGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELW  126

Query  137  LDDTKAAAGRNCHTEFPHGQHQ-------IDYSAC-GAACMLRWYWLGIKYVEGAYSWQV  188
             +D       +C + +  G  Q       + YS C     +LR+YWL ++ ++G   WQ 
Sbjct  127  CNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQA  186

Query  189  YKNCIAL  195
            YKNCI L
Sbjct  187  YKNCIPL  193

>PHALS_03176
Length=207

 Score = 68.6 bits (166),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 11/126 (9%)

Query  81   YASLRSMLDDESLYQVTEEAIF--DCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
            +  L++    + L  + + + F   CG + PK + Q IP +     S      GPCE+WL
Sbjct  66   FQKLKAANKFKDLKTLMDTSAFGAKCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWL  125

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQVY  189
            D+ K     +C++++ +    I      DYS+C  G    +R+YWL  + V G   WQ Y
Sbjct  126  DNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSY  185

Query  190  KNCIAL  195
            KNCI L
Sbjct  186  KNCIPL  191

>PHYRA_86241
Length=195

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 21/126 (17%)

Query  78   QHGYAS-LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGPC  133
            + GYA+ +R +LD D SLY        DCG + P  + +  P++  ++F+  G    GPC
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFER-GLAHHGPC  126

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ--------IDYSACGAA-CMLRWYWLGIK-YVEGA  183
            E+WLDDT      +C   F    +         IDYS+C ++ CM R+YWL  +    G 
Sbjct  127  EIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  184  YSWQVY  189
            Y WQ+Y
Sbjct  187  YVWQIY  192

>PYVX_18179
Length=147

 Score = 67.0 bits (162),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 66/163 (40%), Gaps = 60/163 (37%)

Query  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96
            Q V+ P P +  +  D     LA+L++QG  T  +   W   +GY +LR+ +D       
Sbjct  29   QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD-------  81

Query  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156
                                                        +A +G++   ++    
Sbjct  82   --------------------------------------------QAVSGKDTAVDY----  93

Query  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
                 S+C  +C L W+W+G++Y++GAYSWQVYKNC+ L   A
Sbjct  94   -----SSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131

>PYVX_18175
Length=147

 Score = 67.0 bits (162),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)

Query  159  IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            IDYS+C  +C L WYW+G++Y++GAYSWQVYKNC+ L   A
Sbjct  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  37  QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLD  89
           Q V+ P P +     D     LA+L+ QG  T  +   W + +GY +LRS +D
Sbjct  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81

>PHYCA_10471
Length=309

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 73/170 (43%), Gaps = 21/170 (12%)

Query  31   AGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDD  90
            AGL +GQ  L  P     DG+ + G           NT      +     Y+SL+ + D 
Sbjct  42   AGLIDGQDYLPVP-----DGMSYGGTPEG-------NTEAYWTAFNASKKYSSLKDLADK  89

Query  91   ESLYQVTE---EAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRN  147
              + Q      +A  +CG + P    + +P    ++  GY+  GPCEVW DD  A +  N
Sbjct  90   TMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFGYSHQGPCEVWCDDKLAFSDTN  149

Query  148  CHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            C   +P     + Y    C  A M++ YW+ +        WQ+Y NC+ L
Sbjct  150  CALHYPEVPANLPYDVDVCTGAKMMQSYWIALH----GLPWQLYLNCVRL  195

>PYIR_23585
Length=240

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 62/120 (52%), Gaps = 14/120 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVWL  137
             G+A+ R+ L+              CG T      + IP++++ + S      GPCE+W+
Sbjct  69   KGFATTRAFLESRGPT---------CGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWI  119

Query  138  DDTKAAAGRNCHTEFPHG--QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            D+T+     +C   F       +ID+SAC  +CMLR+YWLG++  +G   +Q Y  C+AL
Sbjct  120  DNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLAL  177

>PYAP_22257
Length=247

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 24/153 (16%)

Query  53   FQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTE  112
            F+G    Y  +   N     + +  Q  + +L+ M++        ++    CG +S K +
Sbjct  45   FEGRK--YNNDPTSNVKAFTEAFKSQKTFKTLKDMVE--------KQLKGSCGKSSGKGK  94

Query  113  TQLIPTNSSF------QSSGY--TLDGPCEVWLDDTKAAAGRNCHTEFP--HGQHQIDYS  162
             Q +   S        + +G+  +  GPCE+W+DDT+     NC  +F     +  ++YS
Sbjct  95   PQSVEGLSDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYS  154

Query  163  ACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             C   CMLR+YWL +   E    WQVYKNC+ +
Sbjct  155  VCKGECMLRFYWLALHEPE----WQVYKNCVPI  183

>PHYRA_77971
Length=230

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 48/105 (46%), Gaps = 17/105 (16%)

Query  104  CGLTSPKTETQLIPTNSSF-----QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158
            CG T    + Q +PTN           GYT  GPCE+++DD       NC  ++P G + 
Sbjct  87   CGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPND  146

Query  159  --------IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                    +DYS+C   C    YWLG +  +    WQ Y NC+ L
Sbjct  147  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

>PHYRA_85794
Length=230

 Score = 68.6 bits (166),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 48/105 (46%), Gaps = 17/105 (16%)

Query  104  CGLTSPKTETQLIPTNSSF-----QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158
            CG T    + Q +PTN           GYT  GPCE+++DD       NC  ++P G + 
Sbjct  87   CGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPND  146

Query  159  --------IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                    +DYS+C   C    YWLG +  +    WQ Y NC+ L
Sbjct  147  SGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

>PITG_11936
Length=333

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 78/170 (46%), Gaps = 24/170 (14%)

Query  46   FIVDGLDFQGMALAYLQEQGV----------NTSIEAQGWMQQHGYASLRSMLDDESLYQ  95
            F  +G + Q MA     + G           NT+   +G+     Y SL+  ++D ++  
Sbjct  34   FTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASK-YKSLKEFMND-NMVL  91

Query  96   VTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--DGPCEVWLDDTKAAAGRNCH  149
            V E+   +CG T+P    Q +P      S     G+TL  +GPCEV+ D+T+     NC 
Sbjct  92   VNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYCDETRVFQDDNCP  151

Query  150  TEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGK  197
              FP    ++  D+ AC  +  L  YW+ +     + SWQVY NC  L K
Sbjct  152  KNFPAAPAKLPFDHDACLGSSQLSIYWIALH----SPSWQVYINCAPLEK  197

>PPTG_06256
Length=318

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 62/123 (50%), Gaps = 9/123 (7%)

Query  76   MQQHGYASLRSML-DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCE  134
            +   G  SL +++  ++ LY  + +   DCGLT+ K   +     S  + +G+T  GPCE
Sbjct  74   LPTKGGGSLGALIAKNQKLY--SSDVDPDCGLTTFKESARSKLPASQLEYTGFTHPGPCE  131

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            VW DDTK     +C T+FP    +I Y  S C  A  L  YWL +        WQVY +C
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVH----GEQWQVYSDC  187

Query  193  IAL  195
            + L
Sbjct  188  VWL  190

>PHYRA_78161
Length=373

 Score = 69.3 bits (168),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 61/123 (50%), Gaps = 13/123 (11%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--DGPCE  134
            Y+SL+  ++D++   VT  A   CG   PK E Q +P +    S   S G+T   +GPCE
Sbjct  76   YSSLKEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  134

Query  135  VWLDDTKAAAGRNCHTEFPH--GQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNC  192
            VW DD +     +C   +P    Q   D  AC  +  L +YW+ +     + +WQVY NC
Sbjct  135  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH----SSTWQVYVNC  190

Query  193  IAL  195
              L
Sbjct  191  APL  193

>PYAR_16493
Length=256

 Score = 68.6 bits (166),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWL  137
            +  Y +L+ ++  E       ++   CGLT+ K E +     ++ + SG+T  GPCEVW 
Sbjct  78   KSKYKTLKDLIMGEQTVLTEYKSDAQCGLTT-KDEAKRATLPATLKYSGFTHAGPCEVWC  136

Query  138  DDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            D+TK A   +C   +  G   ID S C  A  L  YW+ +     +  WQVY +C+ L
Sbjct  137  DNTKLAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAVH----SEPWQVYTDCVYL  190

>PHALS_03179
Length=372

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 11/127 (9%)

Query  80   GYASLRSMLDDESLYQVTEEAIF--DCGLTSPKTETQLIPTN-SSFQSSGYTLDGPCEVW  136
             Y SL++  + + L  + E      +CG + PK + Q IP +  +  S      GPCE+W
Sbjct  106  AYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  165

Query  137  LDDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQV  188
            LD+ K     +C+ ++ +   +I      DYS+C  G    +R+YWL  + ++G   WQ 
Sbjct  166  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  225

Query  189  YKNCIAL  195
            YKNCI L
Sbjct  226  YKNCIPL  232

>CCA17179
Length=185

 Score = 67.0 bits (162),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (47%), Gaps = 23/126 (18%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF------QSSGYTLD--GP  132
            + +LR  L D+  Y         CG T+P  + + IP + +          G+     GP
Sbjct  46   FQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVASHMGP  96

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQHQ--IDYSACGAACMLRWYWLGIKYVEGAYSWQVYK  190
            CEVWL++ +     NC   F     +  ID+S C   C+L+++WL +   +    WQVYK
Sbjct  97   CEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLALHEPQ----WQVYK  152

Query  191  NCIALG  196
            NCI + 
Sbjct  153  NCIPIA  158

>SPRG_04679
Length=226

 Score = 67.4 bits (163),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (45%), Gaps = 34/150 (23%)

Query  67   NTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ---  123
            N +     +  Q  + +LR ML+ +            CG + P    + IP++ +     
Sbjct  57   NVAAFTSAFKAQSQFKTLRDMLEPQGPA---------CGNSLPNASKKTIPSDGTMTWLN  107

Query  124  ---SSGY--TLDGPCEVWLDDTKAAAGRNCHTEFPH---GQHQIDYSAC-GAACMLRWYW  174
                 G+  +  GPCEVWLDD +     +C T FP        +DYS+C GA CMLR+YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCGGAGCMLRFYW  167

Query  175  LGIKYVEGAYSWQVY---------KNCIAL  195
            L +   +    WQVY         +NC+ L
Sbjct  168  LALHQPQ----WQVYSQLKQPVWNENCVPL  193

>PYIR_19612
Length=260

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 59/118 (50%), Gaps = 14/118 (12%)

Query  77   QQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEV  135
            ++ G+A+LRS L+D+            CG T P    + IP +   + S   +  GPCE+
Sbjct  68   KEKGFATLRSYLEDKGAT---------CGFTDPNVAPRAIPADRKVRFSRDISHPGPCEL  118

Query  136  WLDDTKAAAGRNCHTEFPH--GQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKN  191
            W+DD +     +C + F        +D++ C   CM+R+YWL ++       WQVY++
Sbjct  119  WIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQVYRS  174

>PHYRA_73581
Length=293

 Score = 68.6 bits (166),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 18/131 (14%)

Query  77   QQHGYAS-LRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPC  133
            ++ GY + +R +LD D +LY        DCG + P  + +  PT+ +   S G    GPC
Sbjct  79   KESGYENDVRKLLDSDANLYGA------DCGYSDPDADPKDPPTDGTATFSRGIAHHGPC  132

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQ--------IDYSACGAA-CMLRWYWLGIKYVEGAY  184
            E+WLDDT      +C   F    +         IDYS+C A+ CMLR+YWL  +     Y
Sbjct  133  EIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYWLAFQGSNDGY  192

Query  185  SWQVYKNCIAL  195
             WQ+YK+C+ L
Sbjct  193  VWQIYKHCVPL  203

>PYVX_21297
Length=263

 Score = 67.8 bits (164),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 55/106 (52%), Gaps = 8/106 (8%)

Query  93   LYQVTEEAIFDCGLTSPKTETQLIPTNS--SFQSSGYTLDGPCEVWLDDTKAAAGRNCHT  150
            +  +   A  +CG T      Q +P++   +F  S   + GPCEVWLDDTK A+  +C +
Sbjct  56   IRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDCWS  114

Query  151  EFPHGQHQIDYSAC-GAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             +      IDYS C G++C LRW WL          W+++ NC+ +
Sbjct  115  TYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  156

>PYAR_18165
Length=261

 Score = 67.8 bits (164),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 9/100 (9%)

Query  104  CGLTSPKTETQLIPTNS--SFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY  161
            CG T+     Q  P++   +F  S   + GPCE+WLDDTK  +  +C  +FP  +  +D+
Sbjct  69   CGKTNANAAVQPAPSDGVVAFAISAQHI-GPCEIWLDDTKVVSATDCWKQFPDKRIPVDF  127

Query  162  SACG--AACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            S C   A+C LRW W+          W+ Y NC+ +G  A
Sbjct  128  SKCANKASCELRWIWMATHT----SPWEFYDNCVRVGTGA  163

>PYU1_G006404
Length=272

 Score = 67.8 bits (164),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 7/109 (6%)

Query  87   MLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGR  146
            +L ++ +Y  + +    CGLT  K E +     S  + SG++  GPCE+W D+ K A   
Sbjct  82   ILKNQKMYDASTDP--QCGLTI-KDEAKRATMPSEVKFSGFSHPGPCELWCDNNKLAFAN  138

Query  147  NCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            +C   +P G   +D S C  A   R +W+G+     +  WQVY +C+ L
Sbjct  139  DCAATYPTGVVPVDASKCAGADRFRIFWIGVH----SAPWQVYTDCVYL  183

>PYIR_24421
Length=213

 Score = 67.0 bits (162),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 72/147 (49%), Gaps = 17/147 (12%)

Query  60   YLQEQGVNTSIEAQGW---MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLI  116
            Y+     + S  A+ +   ++   Y S+R +++ ++ +     A  +CG++S     Q +
Sbjct  27   YMSSFTTDPSSNAKAFTAALKSSSYKSVRDLVNAKASF--ISGASKECGISSSSGAKQPL  84

Query  117  PTN----SSFQSSGYTL--DGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAAC  168
            P      +   S G+T   +GPCEVW D+  A +  NC   +P    ++ Y  S C  A 
Sbjct  85   PAQYVEWAHSSSEGFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGAS  144

Query  169  MLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            MLR+YW+ +     + +WQVY NC  L
Sbjct  145  MLRFYWVALH----SSTWQVYINCAPL  167

>PHYKE_2454
Length=374

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN---SSFQSSGYTL--D  130
             +   Y SL++++DD++   V+  A   CG   P    Q +P+    S   S G+T   +
Sbjct  71   FKASSYKSLKALIDDKAKITVSG-ATLTCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHE  129

Query  131  GPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQV  188
            GPCE W DD +     NC   FP    ++ Y  S+   A  L +YW+ +       SWQV
Sbjct  130  GPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH----GPSWQV  185

Query  189  YKNCIAL  195
            Y NC AL
Sbjct  186  YVNCAAL  192

>CCI47381
Length=211

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 60/128 (47%), Gaps = 23/128 (18%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF------QSSGYTLD--GP  132
            + +LR  L D+  Y         CG T+P    + IP +++          G+     GP
Sbjct  72   FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  122

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQHQ--IDYSACGAACMLRWYWLGIKYVEGAYSWQVYK  190
            CEVWL +T+     NC   F     +  I++S+C   C+L+++WL +   +    WQVYK
Sbjct  123  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYK  178

Query  191  NCIALGKE  198
            NCI +   
Sbjct  179  NCIPIAPN  186

>PHYKE_9024
Length=299

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 10/135 (7%)

Query  65   GVNTSIEA-QGWMQQHGYASLRSMLD-DESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF  122
            GVN ++   +      GY SL + +  ++ LY    +A  DCGLT  K   +     S  
Sbjct  62   GVNGTLNFFKDTFPSKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKL  119

Query  123  QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYV  180
              SG+T  GPCEVW DDTK     +C T++P     + Y  S C  A  L  YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLH--  177

Query  181  EGAYSWQVYKNCIAL  195
                 WQVY +C+ L
Sbjct  178  --GDPWQVYTDCVWL  190

>H257_11264
Length=282

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 80/181 (44%), Gaps = 27/181 (15%)

Query  31   AGLGEGQIVLHPPPFFIVDGLD---FQGMALAYLQEQGVN-------TSIEAQGWMQQHG  80
            A L  G +V  P P F+  G D   + G     +   G N        +IE    +++  
Sbjct  20   ATLAHGYLV-DPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSS  78

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ----SSGYTL--DGPCE  134
            +ASLR+ +D +           +CGLT      + +P++S  +    S G+ L  +GPCE
Sbjct  79   FASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIA  194
            +W D T+     NC    P G   I+ S C  +  L   WL +   +    WQVYKNC+ 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVR  188

Query  195  L  195
            L
Sbjct  189  L  189

>PPTG_07509
Length=299

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 19/119 (16%)

Query  92   SLYQVTEEAIFD--CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAA  144
            S+  V  + + D  CG T    + + IP +   +       G+T  GPCE+++DD     
Sbjct  71   SVKDVVLDMVKDKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLH  130

Query  145  GRNCHTEFPHG--------QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            G NC  +FP G        +  +D+S+C   C L  YWLG +  +    WQ Y NC+ L
Sbjct  131  GDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPL  185

>PHYKE_2379
Length=285

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 63/127 (50%), Gaps = 17/127 (13%)

Query  75   WMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGP  132
            W  ++G +SL+  +   + Y      I +CG T      + IP++  +   + G +  GP
Sbjct  70   WFTKNGISSLKEYI---TTYGTN---ISECGNTLKDGTAEAIPSDGYAEHDTLGNSHPGP  123

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQH----QIDYSACGAACMLRWYWLGIKYVEGAYSWQV  188
            CE+W DDT+     NC TEF  GQ      ID S C A+    +YWL +     A  WQV
Sbjct  124  CEIWCDDTRVFNNTNCVTEF-SGQSPAKIPIDVSTCKASSEFVFYWLALH----AQPWQV  178

Query  189  YKNCIAL  195
            Y NC+AL
Sbjct  179  YINCVAL  185

>PPTG_07507
Length=299

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 19/119 (16%)

Query  92   SLYQVTEEAIFD--CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAA  144
            S+  V  + + D  CG T    + + IP +   +       G+T  GPCE+++DD     
Sbjct  71   SVKDVVLDMVKDKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLH  130

Query  145  GRNCHTEFPHG--------QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            G NC  +FP G        +  +D+S+C   C L  YWLG +  +    WQ Y NC+ L
Sbjct  131  GDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPL  185

>PHYCA_15125
Length=334

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 60/120 (50%), Gaps = 9/120 (8%)

Query  79   HGYASLRSML-DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWL  137
             GY SL + +  ++ LY    +   DCGLT  K   +     S  + SG+T  GPCEVW 
Sbjct  114  KGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPCEVWC  171

Query  138  DDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            DDTK     +C T++P    ++ Y  S C  A  L  YW+G+        WQVY +C+ L
Sbjct  172  DDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLH----GDPWQVYTDCVWL  227

>PYU1_G005869
Length=259

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 69/153 (45%), Gaps = 26/153 (17%)

Query  53   FQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTE  112
            F G    +  E   N  +    W Q  GY SL+ MLD          A  DCGL+ P   
Sbjct  56   FAGKIFNHAPED--NAKVFTAAWPQT-GYKSLKEMLD---------PAAPDCGLSLPDVA  103

Query  113  TQLIP--TNSSFQSSGY------TLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYS  162
               +   T   FQ++ Y      +  GPCE+W+ DT+A    +C  +FP     I  D+S
Sbjct  104  PIDVSSMTEFKFQNNEYKEGFIASHRGPCELWIGDTRAWHYDDCAAKFPGYPATIPTDFS  163

Query  163  ACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             C   C + +YWL +     + +WQ+YK C+ +
Sbjct  164  VCKGTCRVTFYWLALH----SPNWQIYKQCVPV  192

>PHYRA_78174
Length=279

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 70/140 (50%), Gaps = 16/140 (11%)

Query  67   NTSIEAQGWMQQHGYASLRSMLDDESLYQVTE-EAIFDCGLTSPKTETQLIPTN----SS  121
            NT+  A+G+ +   Y SL+ M+ D  L +VT  +   +CG T+P    Q +P      + 
Sbjct  64   NTAAFAKGF-EASKYTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAH  120

Query  122  FQSSGYTL--DGPCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGI  177
                G+T   +GPCEVW DD +     +C   +     ++  D+ AC  A  L +YWL +
Sbjct  121  GSGEGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLAL  180

Query  178  KYVEGAYSWQVYKNCIALGK  197
                 + +WQVY NC AL K
Sbjct  181  H----SSTWQVYTNCAALEK  196

>PPTG_07520
Length=294

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 19/119 (16%)

Query  92   SLYQVTEEAIFD--CGLTSPKTETQLIPTNSSF-----QSSGYTLDGPCEVWLDDTKAAA  144
            S+  V  + + D  CG T    + Q IP +        +  G+T  GPCE++LDD     
Sbjct  70   SVKDVVLDMVKDQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLH  129

Query  145  GRNCHTEF---PHGQHQ-----IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            G +C  EF   P+G  Q     +D+S+C   C+L  YWL  +  +    WQ Y NC+ L
Sbjct  130  GDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PPTG_03144
Length=310

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 67/134 (50%), Gaps = 19/134 (14%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF--------QSSGY  127
             ++  Y S+R+M++D+ +  V+++A   CG +SP+  +     ++ +        Q  G 
Sbjct  75   FEKSKYKSIRTMIEDKQVL-VSDDATATCGFSSPEKTSYGALNDTVYWGRNDDITQDEGL  133

Query  128  TLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ------IDYSACGAACMLRWYWLGIKYVE  181
               GPCEVW DD +A    NC   +     +      ID S C  A  L ++W+G+    
Sbjct  134  VHPGPCEVWCDDNRAQQDMNCMKTYTPASGKGAAPIPIDKSVCTDAKRLTFFWIGM---H  190

Query  182  GAYSWQVYKNCIAL  195
            GA +WQVY NC+ +
Sbjct  191  GA-TWQVYINCVNI  203

>PITG_11944
Length=302

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 68/158 (43%), Gaps = 16/158 (10%)

Query  47   IVDGLDF----QGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTE---E  99
            ++DG D+    +GM+     E        A        Y SL+ + D   + Q      +
Sbjct  45   LIDGQDYLPVPKGMSYGGTPESNTEAYWTA---FNASKYTSLKDLADKTMVLQSLSPFGK  101

Query  100  AIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQI  159
            A  +CG ++PK   + +P    ++  GY+  GPCEVW DD  A    NC   +P     +
Sbjct  102  ATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPCEVWCDDKLAFMDTNCALHYPEVPAYL  161

Query  160  DY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             Y    C  A M++ YW+ +        WQ+Y NC  L
Sbjct  162  PYDIDVCVGAKMIQSYWIALH----GLPWQLYLNCAPL  195

>PHYCA_98479
Length=276

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 51/106 (48%), Gaps = 17/106 (16%)

Query  103  DCGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG--  155
            +CG T      Q +PT+   +       G+T  GPCE+++DDT    G NC  E+P G  
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  156  ------QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
                     +DYS+C   C L  YWLG +  +    WQ Y NC+ L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PHYCA_19612
Length=610

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--  129
             +   Y+SL+ +++D++   VT+ A   CG   P    Q +P      +   S G+T   
Sbjct  378  FESSSYSSLKELINDKATITVTD-ATLTCGACDPDETAQALPATYVEWAHSDSEGFTASH  436

Query  130  DGPCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCEVW DD +   G +C  ++      +  D+ AC  + +L +YWL +     + +WQ
Sbjct  437  EGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH----SSTWQ  492

Query  188  VYKNCIAL  195
            VY NC  L
Sbjct  493  VYVNCAPL  500

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (47%), Gaps = 13/124 (10%)

Query  80   GYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP------TNSSFQSSGYTLDGPC  133
             Y SL+ ++   +   VT+ A   CG  +P    Q +P      ++SS +    + +GPC
Sbjct  80   SYTSLKDLITSLATVTVTD-ATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPC  138

Query  134  EVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKN  191
            EVW DD +     +C  ++     ++ Y   AC     L +YWL +     + +WQVY N
Sbjct  139  EVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYVN  194

Query  192  CIAL  195
            C  L
Sbjct  195  CAPL  198

>PHYCA_12943
Length=287

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 19/125 (15%)

Query  92   SLYQVTEEAIFD--CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAA  144
            S+  V  + + D  CG T    + Q IP++   +       G+T  GPCE+++DD     
Sbjct  74   SVKDVVLDMVKDKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLH  133

Query  145  GRNCHTEFPHG--------QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
            G +C  EFP G        +  +D+S+C   C L  YWL  +  +    WQ Y NC+ L 
Sbjct  134  GDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPLQ  189

Query  197  KEATA  201
             + +A
Sbjct  190  GDGSA  194

>PPTG_07516
Length=294

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 19/119 (16%)

Query  92   SLYQVTEEAIFD--CGLTSPKTETQLIPTNSSF-----QSSGYTLDGPCEVWLDDTKAAA  144
            S+  V  + + D  CG T    + Q IP +        +  G+T  GPCE++LDD     
Sbjct  70   SVKDVVLDMVKDQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLH  129

Query  145  GRNCHTEF---PHGQHQ-----IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            G +C  EF   P+G  Q     +D+S+C   C+L  YWL  +  +    WQ Y NC+ L
Sbjct  130  GDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PYVX_22508
Length=298

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 12/128 (9%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP------TNSSFQSSGYTL  129
             +   Y SL+ M+ D      T      CGLT P    Q +P       +SS +    + 
Sbjct  58   FEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASH  117

Query  130  DGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCE+W DDT+     +C   +     Q+ Y   AC  A  L +YWL +     + +WQ
Sbjct  118  EGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH----SSTWQ  173

Query  188  VYKNCIAL  195
            VY NC AL
Sbjct  174  VYINCAAL  181

>PHYCA_97965
Length=288

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 19/125 (15%)

Query  92   SLYQVTEEAIFD--CGLTSPKTETQLIPTNSSFQ-----SSGYTLDGPCEVWLDDTKAAA  144
            S+  V  + + D  CG T    + Q IP++   +       G+T  GPCE+++DD     
Sbjct  74   SVKDVVLDMVKDKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLH  133

Query  145  GRNCHTEFPHG--------QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196
            G +C  EFP G        +  +D+S+C   C L  YWL  +  +    WQ Y NC+ L 
Sbjct  134  GDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPLQ  189

Query  197  KEATA  201
             + +A
Sbjct  190  GDGSA  194

>PHALS_03177
Length=259

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 65/127 (51%), Gaps = 18/127 (14%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN--SSFQSSGYTLDGPCEVW  136
            + +  L++++D+  L +       DCG + P  + Q IP +  ++F S      GPCE+W
Sbjct  73   NNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATF-SRAMVHTGPCEMW  124

Query  137  LDDTKAAAGRNCHTEFPHGQHQI------DYSAC--GAACMLRWYWLGIKYVEGAYSWQV  188
            LD+ K     +C++++ +    I      DYS+C  G    +R+YWL  + + G   WQ 
Sbjct  125  LDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGKTFWQS  184

Query  189  YKNCIAL  195
            YK CI L
Sbjct  185  YKMCIPL  191

>PHYRA_80631
Length=320

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 64/135 (47%), Gaps = 10/135 (7%)

Query  65   GVNTSIEA-QGWMQQHGYASLRSML-DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF  122
            GVN ++   +      GY SL + +  ++ LY    +   DCGLT  K   +     S  
Sbjct  62   GVNGTLNFFKATFPDKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKL  119

Query  123  QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYV  180
              SG+T  GPCEVW DDTK     +C T++P     I Y  S C  A  L  YW+G+   
Sbjct  120  TYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLH--  177

Query  181  EGAYSWQVYKNCIAL  195
                 WQVY +C+ L
Sbjct  178  --GDPWQVYTDCVWL  190

>H257_11265
Length=282

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 80/181 (44%), Gaps = 27/181 (15%)

Query  31   AGLGEGQIVLHPPPFFIVDGLD---FQGMALAYLQEQGVNTSIEAQG-------WMQQHG  80
            A L  G +V  P P F+  G D   + G     +   G N ++  Q         +++  
Sbjct  20   ATLAHGYLV-DPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKSS  78

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ----SSGYTL--DGPCE  134
            +ASLR+ +D +           +CGLT      + +P++S  +    S G+ L  +GPCE
Sbjct  79   FASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  135  VWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIA  194
            +W D T+     NC    P G   I+ S C  +  L   WL +   +    WQVYKNC+ 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVR  188

Query  195  L  195
            L
Sbjct  189  L  189

>SPRG_07795
Length=335

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 50/101 (50%), Gaps = 8/101 (8%)

Query  103  DCGLTSPKTETQLIPTNSSFQSS--GY--TLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158
            DCG+T P    Q +P+   + +   G+  +  GPCE+W D+T+     NC   +P G   
Sbjct  91   DCGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELWCDETRVFQDENCAANYPDGFMA  150

Query  159  IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
            ID S C  A  L   WL +   E    WQVYKNC+ L   A
Sbjct  151  IDTSKCSGAKRLTMLWLALHTPE----WQVYKNCVNLSGAA  187

>PYVX_21174
Length=95

 Score = 63.2 bits (152),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 41/81 (51%), Gaps = 12/81 (15%)

Query  123  QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQH--------QIDYSACGAACMLRWYW  174
            +  G+T  GPCE+W DDT A  G NC  E+P G           +DYS C   C+LR+YW
Sbjct  8    EGGGFTHQGPCEIWFDDTLALRGDNCENEYPGGAVGSTDYSAIPVDYSLCKGDCVLRFYW  67

Query  175  LGIKYVEGAYSWQVYKNCIAL  195
            LG +       WQ Y   +A 
Sbjct  68   LGFQNA----MWQSYSEDLAF  84

>PYAP_18221
Length=226

 Score = 65.9 bits (159),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 67/153 (44%), Gaps = 26/153 (17%)

Query  53   FQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTE  112
            FQG       EQ      +A    +Q G  SLR ++D         + +  CG T+P T 
Sbjct  56   FQGKPFNRSPEQNTQVFTDA---FKQSGLKSLRELMD---------KYVPGCGNTNPNTT  103

Query  113  TQLIPT--NSSFQSSGY------TLDGPCEVWLDDTKAAAGRNCHTEFPH--GQHQIDYS  162
             + +      ++Q++ Y      +  GPCEVW+D+T+     +C   +        +DYS
Sbjct  104  PRDVTKLKTMTYQNNEYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAALPVDYS  163

Query  163  ACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             C   C L +YWL +     +  WQ YK C+ +
Sbjct  164  KCKGTCRLTFYWLALH----SQKWQAYKQCVPI  192

>PHALS_10635
Length=296

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 16/127 (13%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ-SSGYTLDGPCEVW  136
            ++ +  LRS+ +   +Y   EE    CG T PK      P + +   S G    G CE+W
Sbjct  66   KNNFKDLRSLFEGNPIY--GEE----CGYTDPKGPPADRPNDGAATFSRGILHAGTCEIW  119

Query  137  LDDTKAAAGRNCHTEFPHGQHQ-------IDYSACGA-ACMLRWYWLGIKYVEGAYSWQV  188
             DD       +C + +  G  +       +DY  C    CMLR+YWL ++ ++    WQV
Sbjct  120  FDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRIDKTV-WQV  178

Query  189  YKNCIAL  195
            Y+NCI L
Sbjct  179  YRNCIPL  185

>PYIR_14463
Length=369

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 59/135 (44%), Gaps = 24/135 (18%)

Query  66   VNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF---  122
             N     + +  Q  + +LR +L D            DCG + P    + IP +      
Sbjct  74   ANVDTFTKAFNAQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGDGKVVWQ  124

Query  123  ---QSSGY--TLDGPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSACGAACMLRWYW  174
                  G+  +  GPCEVWLDD +  +  NC   F   P  +  +D+S+C   CMLR+YW
Sbjct  125  NPDSGEGFVPSHTGPCEVWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYW  184

Query  175  LGIKYVEGAYSWQVY  189
            L +       +WQVY
Sbjct  185  LALH----EPTWQVY  195

>PHYKE_3912
Length=252

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 78/167 (47%), Gaps = 23/167 (14%)

Query  48   VDGLDFQGMALAYLQEQGVN---TSIEAQGWMQQHG-YASLRSMLD-DESLYQVTEEAIF  102
            ++  D+  + LA   +   +     IE Q W  + G    +R++ D D SLY        
Sbjct  21   INSHDYMNIPLAEFTDSVTSAWVVQIEPQ-WTGELGQLHDIRTLPDSDNSLYGA------  73

Query  103  DCGLTSPKTETQLIPT--NSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ--  158
            +CG T P    +  PT  +++F S G    G CE+WLDDT   +  +C   +     +  
Sbjct  74   NCGFTDPNATPKDPPTIGDATF-SCGMMHIGSCEIWLDDTMVLSSDDCQAAYRDDTQEKA  132

Query  159  -----IDYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199
                 ID S C ++  MLR+YWL  + V+    WQVYK+C+ L   A
Sbjct  133  SVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCVPLTGPA  179

>PYU1_G006403
Length=252

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query  78   QHGYASLRSMLDDESLYQVT--EEAIFDCGLTS-PKTETQLIPTNSSFQSS---GYTLDG  131
            + G ASL+ ++ +  +   +  +EA   CG T   + +   +PT   F +    G+T  G
Sbjct  78   ESGVASLKDLILENQVMWTSGLDEA---CGYTKLDEAKRSELPTEMKFGNGDVGGFTHPG  134

Query  132  PCEVWLDDTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKN  191
            PCE+W DDTK +   +C  ++P G   ID S C  A     YWL +     A  WQVY N
Sbjct  135  PCELWCDDTKLSYDNDCAAKYPSGLVPIDTSKCANANQFTVYWLAVH----ASMWQVYTN  190

Query  192  CIAL  195
            C+ L
Sbjct  191  CVYL  194

>PHYRA_78162
Length=478

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 60/122 (49%), Gaps = 12/122 (10%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN---SSFQSSGYTL--DGPCEV  135
            Y SL++++DD++   VT  A   CG   P    Q +P     S  +S G+T   +GPCEV
Sbjct  76   YKSLKALIDDKAKVTVTG-ATLTCGTADPAAAAQALPKTVEWSHSESEGFTASHEGPCEV  134

Query  136  WLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNCI  193
            W DD +A    NC   F     ++ Y  S C  A  L +YW+ +       SWQVY NC 
Sbjct  135  WCDDVRAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWMAMH----GPSWQVYVNCA  190

Query  194  AL  195
             L
Sbjct  191  NL  192

>PPTG_06253
Length=303

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 65/135 (48%), Gaps = 10/135 (7%)

Query  65   GVNTSIEA-QGWMQQHGYASLRSML-DDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSF  122
            GVN ++   +      GY SL + +  ++ LY    +   DCGLT  K   +     S  
Sbjct  62   GVNGTLNFFKATFPTKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASQL  119

Query  123  QSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYV  180
            + +G+T  GPCEVW DDTK     +C T++P    +I Y  S C  A  L  YWL +   
Sbjct  120  EYTGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLALH--  177

Query  181  EGAYSWQVYKNCIAL  195
                 WQVY +C+ L
Sbjct  178  --GDPWQVYTDCVWL  190

>SDRG_17448
Length=262

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 18/92 (20%)

Query  108  SPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEF---PHGQHQIDYSAC  164
            +P T    IP+++          GPCEVWLD+ +     +C T F   P     +DYS+C
Sbjct  5    NPDTGEGFIPSHT----------GPCEVWLDNKRVFQNDDCATNFGDKPAAHLPVDYSSC  54

Query  165  -GAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             G  CMLR+YW+ +   E    WQVYKNC+ L
Sbjct  55   AGDGCMLRFYWIALHQPE----WQVYKNCVPL  82

>PHYSO_524101
Length=308

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--  129
             +   Y+SL+ +++D++   VT+ A   CG+  P    Q +P      +   S G+T   
Sbjct  73   FESSSYSSLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASH  131

Query  130  DGPCEVWLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCEVW DD +     +C  ++     ++ Y   AC  +  L +YWL +     + +WQ
Sbjct  132  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQ  187

Query  188  VYKNCIAL  195
            VY NC  L
Sbjct  188  VYVNCAPL  195

>PYIW_15526
Length=256

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 23/128 (18%)

Query  78   QHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSS--FQSSGY------TL  129
            + GY SL+ MLD         +++  CG T+P      +    S  +Q++ Y      + 
Sbjct  74   KTGYTSLKEMLD---------KSVSGCGYTNPNAAPVDVSGLKSMKYQNNEYKEGFLGSH  124

Query  130  DGPCEVWLDDTKAAAGRNCHTEFP--HGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQ  187
             GPCE W+D+TK     +C   +P       +DYS C   C L +YWL +   +    WQ
Sbjct  125  RGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQ  180

Query  188  VYKNCIAL  195
            VYK C+A+
Sbjct  181  VYKGCVAI  188

>PHYKE_6078
Length=317

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 13/128 (10%)

Query  76   MQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN----SSFQSSGYTL--  129
             +   Y+SL+  ++D++   VT+ A   CG   P    Q +P      +   S G+T   
Sbjct  73   FESSSYSSLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASH  131

Query  130  DGPCEVWLDDTKAAAGRNCHTEFPHGQHQI--DYSACGAACMLRWYWLGIKYVEGAYSWQ  187
            +GPCEVW DDT+     +C  ++     Q+  D+ AC  +  +  YWL +     + +WQ
Sbjct  132  EGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALH----SSTWQ  187

Query  188  VYKNCIAL  195
            VY NC  L
Sbjct  188  VYVNCAPL  195

>PYIR_20483
Length=287

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 72/157 (46%), Gaps = 34/157 (22%)

Query  53   FQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTE  112
            F G    +  EQ  NT+   + W    GY SL+ MLD           + DCGL+ P   
Sbjct  58   FAGRPFNWSPEQ--NTAQFTEAWPNT-GYKSLKEMLDTY---------VPDCGLSLP---  102

Query  113  TQLIPTNSS------FQSSGY------TLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQI-  159
              + P + S      FQ++ Y      +  GPCE+W+ +TKA    +C  +FP     I 
Sbjct  103  -DVTPVDVSGMKEFKFQNNEYKEGFIASHHGPCELWVGNTKAWHYDDCSAKFPGYPATIP  161

Query  160  -DYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             D+S C   C + +YWL +     +  WQ+YK C+ +
Sbjct  162  TDFSVCKGTCRVTFYWLALH----SQKWQIYKQCVPV  194

>PYU1_G006405
Length=305

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (50%), Gaps = 7/117 (6%)

Query  80   GYASLRSM-LDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLD  138
            GY +L+ + L ++ +Y+ T +    CG T      +     +    SG+T  GPCE+W D
Sbjct  76   GYTTLKDLILANQDMYEDTIDK--QCGYTILDEAKRADMPATEITFSGFTHPGPCELWCD  133

Query  139  DTKAAAGRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            D K A   +C T +  G+  +D S C  A   R +WL +     +  WQVY NC+ L
Sbjct  134  DNKLAFDYDCQTTYASGKVPVDASKCSGANRFRIFWLALH----SAPWQVYTNCVYL  186

>PYVX_20783
Length=276

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 59/127 (46%), Gaps = 18/127 (14%)

Query  75   WMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSS--GYTLDGP  132
            W   +G +SL+        Y  T  +  +CG T      Q +P++   Q    G +  GP
Sbjct  69   WFTANGISSLKE-------YITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGP  121

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQH----QIDYSACGAACMLRWYWLGIKYVEGAYSWQV  188
            CE+W DDT+     NC TEF  GQ      ID + C  +    +YWL +     A  WQV
Sbjct  122  CEIWCDDTRVFTSTNCVTEF-SGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQV  176

Query  189  YKNCIAL  195
            Y NC+AL
Sbjct  177  YINCVAL  183

>PHYSO_374518
Length=116

 Score = 62.8 bits (151),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query  101  IFDCGLTSPKTETQLIPTNSSFQSS--GYTLDGPCEVWLDDTKAAAGRNCHTEFP---HG  155
            I +CG T  K   Q +P++   Q    G +  GPCE+W DDT+     NC  E+      
Sbjct  5    ISECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPT  64

Query  156  QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEATA  201
            +  ID S C A+    +YWL +     A  WQVY NC+AL   A A
Sbjct  65   KLPIDVSTCKASSEFVFYWLALH----AQPWQVYINCVALDGTAAA  106

>PYAP_18226
Length=226

 Score = 65.1 bits (157),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 74/157 (47%), Gaps = 33/157 (21%)

Query  53   FQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTE  112
            FQG    +  E       +A    +Q G  SLR ++D         + +  CG T+P T 
Sbjct  57   FQGKIFNWSPEHNTQVFTDA---FKQSGLKSLRQLMD---------KYVPGCGNTNPNTT  104

Query  113  ----TQLIPTNSSFQSSGY------TLDGPCEVWLDDTKAAAGRNC---HTEFPHGQHQI  159
                T+L   N  +Q++ Y      +  GPCEVW+D+T+     +C   +  +P     +
Sbjct  105  PRDVTKLKTMN--WQNNEYKEGFLASHRGPCEVWIDNTRVFQNNDCAGNYKSYP-ASLPV  161

Query  160  DYSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            DYS C ++ CMLR+YWL +     +  WQ YK C+ +
Sbjct  162  DYSKCKSSKCMLRFYWLALH----SEKWQAYKQCVPI  194

>PYU1_G005868
Length=267

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 61/131 (47%), Gaps = 33/131 (25%)

Query  80   GYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTN-SSFQSSGYTLD--------  130
             Y SLR MLD          A+ DCG T     T   P + SS +S  +  D        
Sbjct  74   SYKSLREMLD---------SAVPDCGFTL----TDGTPVDVSSLKSMKWQNDQEQKGFID  120

Query  131  ---GPCEVWLDDTKAAAGRNC---HTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAY  184
               GPCE+W+DDTK     +C   +T +P  +  +DYS C   C L +YWL +       
Sbjct  121  SHHGPCELWIDDTKIMHSDDCRADYTAYP-AEIPVDYSVCKGKCQLTFYWLALHEP----  175

Query  185  SWQVYKNCIAL  195
            +WQ+YK C+ +
Sbjct  176  NWQIYKQCVPI  186

>PHYRA_80750
Length=275

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 15/121 (12%)

Query  79   HGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLD-GPCEVWL  137
            + +  L++++DD + +        DCG T P    Q IP++     S   +  GPCE+WL
Sbjct  73   NNFVDLKTLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  138  DDTKAAAGRNCHTEFPHGQHQI------DYSAC-GAACM-LRWYWLGIKYVEGAYSWQVY  189
            DD K     +C + + +    I      DYS C G  C  +R+YWL  + V+G   WQ Y
Sbjct  127  DDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  190  K  190
             
Sbjct  187  N  187

>PHYCA_18729
Length=391

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 60/127 (47%), Gaps = 17/127 (13%)

Query  75   WMQQHGYASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQ--SSGYTLDGP  132
            W  ++  ASL+  +            I +CG T  K   Q +P++   Q  + G +  GP
Sbjct  69   WFTKNNVASLKEYITTYGT------GISECGNTEKKGTAQSVPSDGYAQHDTLGNSHPGP  122

Query  133  CEVWLDDTKAAAGRNCHTEFPHGQH----QIDYSACGAACMLRWYWLGIKYVEGAYSWQV  188
            CE+W DDT+     NC T F  GQ      ID S C ++    +YWL +     A  WQV
Sbjct  123  CEIWCDDTRVFHDTNCVTTF-SGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQV  177

Query  189  YKNCIAL  195
            Y NC+AL
Sbjct  178  YINCVAL  184

>PYAP_19712
Length=276

 Score = 65.5 bits (158),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 10/96 (10%)

Query  104  CGLTSPKTETQLIPTNSSFQ---SSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQID  160
            CG T P    Q IP +   Q   ++ +   GPCE+WLD    A+ + C  E+P  + ++D
Sbjct  72   CGKTDPNGAVQPIPADGYVQLQITAAHI--GPCELWLDGEMVASAKQCVKEYPDRKIKVD  129

Query  161  YSACGAA-CMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
            +S C ++ C LRW WL          W++Y NC+ +
Sbjct  130  FSKCKSSKCQLRWVWLATHN----SPWEIYDNCVTV  161

>PYU1_G001524
Length=300

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 70/167 (42%), Gaps = 20/167 (12%)

Query  31   AGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDD  90
            +G  +G  VL PP      G+ F         +   NT      +  Q  Y S++ M+D 
Sbjct  42   SGTIDGPSVLTPP-----SGMSFS-------TDPASNTKAYTAAFKAQTKYTSMKQMVD-  88

Query  91   ESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHT  150
             +  ++   A  +CG +      Q +P    +     + +GPCEVW DD  A +  NC  
Sbjct  89   -ATQKLESGASKECGFSLVNGAAQPLPDQVEWDQLPASHEGPCEVWCDDKLAFSDENCAI  147

Query  151  EFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195
             +P    ++ Y  S C  A ML   WL +       +WQVY NC  L
Sbjct  148  NYPDSPAKLPYDKSKCTGAKMLTSVWLALHVP----TWQVYYNCAPL  190

>PHYCA_123316
Length=316

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 12/122 (10%)

Query  81   YASLRSMLDDESLYQVTEEAIFDCGLTSPKTETQLIP-----TNSSFQSSGYTLDGPCEV  135
            Y+S++  + D+    V   A  +CGLT P    Q +P     T+S  +    + +GPCE 
Sbjct  78   YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  136

Query  136  WLDDTKAAAGRNCHTEFPHGQHQIDY--SACGAACMLRWYWLGIKYVEGAYSWQVYKNCI  193
            W DDT+     NC   F     ++ Y  + C  +  L +YWL +     + +WQ+Y NC 
Sbjct  137  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH----SSTWQIYVNCA  192

Query  194  AL  195
            AL
Sbjct  193  AL  194

Lambda      K        H        a         alpha
   0.322    0.136    0.444    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9238894932

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40